2AX3A

Crystal structure of a putative carbohydrate kinase (tm0922) from thermotoga maritima msb8 at 2.25 a resolution
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
491
structure length
491
Chain Sequence
HHMKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords hypothetical protein TM0922
publication title Crystal structure of hypothetical protein (tm0922) from THERMOTOGA MARITIMA at 2.27 A resolution
rcsb
source organism Thermotoga maritima
total genus 165
structure length 491
sequence length 491
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2005-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 2ax3A01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 2ax3A02
3RSSA 3RTBA 3W4SA 3K9EA 3RY7A 3ROGA 5B6AA 1LIIA 3ROXA 2Q5RA 3DRWA 4JJPA 3K5WA 3RS8A 3IN1A 3PL2A 4O1GA 3BGKA 4K8PA 3FHXA 4UBEA 1DGMA 1EKQA 3RQ6A 5BYCA 2R3EA 2ABSA 3RPZA 2R3BA 4C5NA 4YL5A 1ESQA 3HYOA 5C3YA 2PKMA 1WYEA 2ABQA 3IE7A 3RSQA 4JKSA 4EUMA 4K9IA 1LIKA 4PVVA 4XDAA 3KTNA 2QCVA 4C5JA 2JG1A 3UQEA 4DC3A 3RTAA 3LJSA 5BYDA 3LOOA 2I5BA 3NBVA 3RT9A 3RTDA 2DDWA 4K8TA 5TRWA 4C5MA 1V19A 3NL2A 4KADA 3ROEA 3RQ2A 5BYFA 3EWMA 4KANA 2PKKA 3RNOA 4S1IA 4K9CA 3RQ8A 1JXIA 2DDOA 3NC2A 3NM1A 4EN4A 2AA0A 1BX4A 2NWHA 4GM6A 2JG5A 2C4EA 1EKKA 1V1AA 3RTGA 3RU3A 3JULA 1RFVA 2RBCA 5F11A 1VK4A 2DDMA 3B1PA 4X8FA 1YHJA 3HICA 2HLZA 2AFBA 3RT7A 4LBGA 2HW1A 3Q92A 3RQXA 4LC4A 2I6BA 3UMOA 2VARA 3QA2A 1TZ3A 3RRBA 3Q1YA 3LKIA 4O1LA 3RQ5A 1RFTA 3RRJA 1C3QA 2PKFA 3B1OA 3GBUA 1LIOA 3MBJA 4YWRA 4KBEA 2QHPA 2AB8A 2AX3A 1RK2A 4LBXA 3RREA 2V78A 4C5KA 1KYHA 3KZHA 3RTEA 1TD2A 3N1CA 3UMPA 3NL6A 1UB0A 4K8KA 4KALA 2XTBA 2I6AA 4KAHA 3NC9A 1ESJA 4B8RA 2YXUA 3GO6A 4S1HA 5CM5A 1UA4A 4E8ZA 1GQTA 3ROZA 3RO7A 3IKHA 3B3LA 5F0ZA 3RSGA 3RSFA 2A9ZA 3MBHA 4LCAA 3ZS7A 4XCKA 1RKAA 2A9YA 2HQQA 4K93A 4DU5A 4E69A 3IBQA 3DZVA 1RFUA 3RPHA 3NL3A 5C3ZA 4XF6A 3RRFA 1LHPA 5TQIA 2O8NA 4U7XA 4C5LA 4JKUA 3UQDA 3RM5A 3BF5A 3NM3A 1VM7A 1RKSA 3B1QA 2FV7A 2AJPA 2YXTA 3B1RA 3B1NA 1RKDA 4S1MA 3OTXA 3D3KA 2F02A 3UQ9A 4E84A 4E8YA 5CGEA 2AWDA 3RO4A 4B8SA 3RQQA 3KEUA 1LIJA 3IQ0A 5C41A 3VAQA 3H49A 1TZ6A 3H74A 4N08A 3RQHA 3RS9A 2DG2A 4E8WA 4E3AA 2PKNA 5BYEA 1TYYA 4XF7A 1YGJA 3HPDA 1YGKA 3FHYA 3VASA 3LHXA 3UQ6A 1LHRA 3RTCA 4WJMA 1GC5A 3QAIA 4EOHA 3NCAA 4N09A 4EBUA 3GO7A 3I3YA 3CQDA 2JGVA 1V1BA 1JZTA 5EYNA 1L2LA 2DCNA 4K8CA 3IH0A 3PZSA 1JXHA 5C40A 3RU2A 5CGAA 3D3JA 1VI9A 3KD6A 3NL5A 3NBWA 5EY7A 5COJA 2C49A 1U2XA 1V1SA 3UBOA 4S1IB 2F7KA 2AJRA
chains in the Genus database with same CATH superfamily
2F67A 5ALUA 3DVAA 2H63A 4B4UA 3DKPA 1SOWA 4IDNA 4GP9A 4WW0A 1PGPA 2JFNA 2WC1A 4YT8A 3TTWA 3MTIA 3QMMA 4IQ8A 3JWEA 3UHJA 2A9KA 2J33A 1VHDA 2PBZA 2W4MA 4WMLA 3OCWA 4WZBA 3JYOA 1DB3A 3SJCA 3LFUA 5L4LA 5DXFA 3OPYB 1KVRA 1AS2A 3CO5A 1H8EA 2P5SA 5GV7A 3DV0A 3E1KA 4LZLA 2R7AA 3KZMA 2ETVA 3T5DA 3VKFA 1N5DA 2PVSA 2JI6A 3KOXA 5F51A 1KIAA 1E0AA 2WF6A 3G2PA 4BVJA 5FAXA 4I4IA 4KODA 5EL0A 2ZBGA 3WMGA 1GZVA 2HSEA 1GD1O 3PFIA 4IW3B 4MQFB 2BMAA 4Z4FA 1R8XA 4I55B 3U44B 3ZY4A 4H6WA 3VPGA 1QORA 4I66A 2DWPA 2DZDA 2MYPA 2PN1A 4YNBA 4JR0A 1OGYA 4I1OA 1DT5A 2HWKA 1Y9JA 4OXXA 3WWCA 3IEVA 1DJPA 1V7ZA 4FD3A 4XWAA 5JSYA 5HK9A 1PJSA 1WXIA 3K70C 1Z63A 2RHLA 2IS4A 3DMHA 4TT3A 2JFPA 4Q19A 5EZYB 5ALMA 1GT91 4LRSB 4M89A 5K3BA 2AMLA 3LPCA 5LQRA 2OZEA 2PKRA 3U7IA 1W87A 5I7EA 3R76A 2JFXA 1X7YB 2DFVA 1UMBB 1SG9A 4DGSA 2EGUA 2N42A 3ESCA 1YULA 3O82A 4L5BA 2AX3A 4DEXA 2LD4A 2BFFB 3QKRA 5L9AA 3I8SA 4H27A 5HOEA 4ARCA 4BO1A 4HXEB 4ZVNA 4FT2A 1E2KA 5J5AA 4OU5A 1WD7A 4B40A 2OG2A 2R97A 4B8RA 1QDEA 3TBFA 2JDIA 4H6PA 5FQOA 1EJ0A 3MAJA 3MS2A 3TKAA 1M66A 4B4DA 2AD1A 1QHSA 1ENZA 1YQDA 3NDIA 4BO7A 4NXNB 1TMGE 4MMYB 3AKYA 4MR9A 1DJMA 1VPDA 1WPGA 1QZZA 4LXXA 1J8YF 1U0HC 1NXSA 3M9LA 5TPZA 1GKYA 5EG5A 1EFVA 4QJ3A 2Q41A 1DHRA 3D3WB 4HWTA 2NUTA 4BEBA 2BMJA 3WGOA 4JUIA 4IEIA 1GGFA 2FN3A 3DMFA 1UBKS 2EJUA 2GCOA 3R6WA 4MB2A 1KE2A 3CBGA 1O95A 3HHEA 4XJSA 3ZX4A 4DXHA 4Z51A 4C2BA 3CYFA 3F5FA 2O8EB 2I4MA 4ZVKA 4DG8A 3KOUA 1P1FA 1XDGA 3EVCA 1UFKA 3PJEA 4RF4A 4I6JA 2HLNA 4GXTA 5DBFA 5I7UA 4FS3A 4BBJA 2XZDA 1GGJA 5JV5A 1KETA 4N0MA 4BVBA 3WWZA 1WXFA 1II0A 4X91A 1POXA 2JGLA 3NUQA 2OECA 3LBHA 4UJ3A 3EZFA 5LP6F 3OUUA 4M1YA 5ENDA 1TA9A 3VI3B 5EJGA 2DFTA 1V1BA 3EC7A 2O05A 4DJFC 1NNUA 2WU8A 3JVVA 4K8OA 4OHRA 1NVFA 4D4LA 4PO8A 1U04A 2PU5A 1GG2A 2IYLD 2M6SA 3NBXX 3NDJA 4MW6A 1U2ZA 4OXRA 1GGHA 5AW0A 3UKJA 5CGAA 4LGYA 1YJCA 1OAKA 4ZV7A 1D4AA 2RI0A 1U6KA 4KFTA 4BTEA 1O6BA 3RRZA 3KRTA 3HYRA 4LOAA 3MS4A 4GBJA 4Q9DA 5A02A 2ZFUA 5DBHX 1KY2A 2W6PA 1LIIA 2HL6A 1VBFA 2X8JB 3ROXA 4F3YA 3LC2O 5CLJA 2HIGA 2I3AA 4IHAA 5COBA 2DFDA 4DUZB 3QX3A 4WCFC 3G0GA 4LY6A 1KJ8A 3H8SA 4PZDA 1NVTA 3UJ9A 5KQGA 5HKKA 4X1KA 2G88A 2QTBA 3AB3A 2XCUA 4DCSA 3KLBA 3NTOA 3T99A 4CTMA 4OO3A 2IEBA 3AZQA 3HVRA 3O74A 2GBGA 2ZIWB 4Q66C 3P9PA 3KETA 3GLGE 4P3YA 2OSBA 5JCJD 4BZPA 3PVSA 4P7JA 4UJ5A 4QLOA 1S8AA 3V4LA 1FFSA 1H1TA 4P4UA 5J58A 2ECQA 3OD5A 4DW8A 3EVBA 5LDGA 3RKRA 4RFLA 2ZUFA 4R0VA 4HEA6 4YMIA 3UYKA 1JBWA 2ZUCA 1BX4A 1JDBB 1KNQA 5E9AA 4WLVA 1FSFA 4Y2XA 3VR6D 1V1AA 3HJRA 1DCKA 1OWOA 4KNWA 4LZZA 1V4VA 3LXXA 4XSVA 4YMWA 1Z08A 4CIDA 4L4SA 1NVEA 5A04A 4LBGA 1JFFB 1V96A 4GOOD 3SEAA 1U0JA 2D1QA 3ZHBA 4Y1RB 1ODFA 1Y1LA 2R7MA 4PYRA 3CZQA 3HBLA 4G6ZA 5EZSA 1Y5NA 3AM1A 4E3WA 2WUFA 3D3EA 2A0KA 2YXLA 3LKZA 1RE1A 1VIDA 5JNUA 3T3EA 2GN1A 3II6X 1O03A 1XMVA 4XVHA 5C5EA 1RAIA 2H06A 3K8OE 2OBBA 4I55F 1RR6A 3L4SO 2Z4SA 1TQ2A 1W93A 4A5OA 3VR5A 1Z8FA 2ORED 1F3LA 2Z5VA 4IGAA 5LKAA 2O8CA 2VR1A 2XBLA 4IJUA 3SICE 1M7BA 3RS2A 2DKFA 1DKNA 1KXZA 1TECE 3ABQB 4PZCA 2FWPA 1BS2A 1HQDA 3S3TA 3T1OA 4B5KA 1BXRB 5KU7A 1GGEA 2PXCA 1M6YA 4G9GA 5EZYF 1YRHA 2X2EA 4Q4AB 2JBWA 1RU3A 4IHJA 4WINA 1LBTA 4X7BA 3RH0A 4E2WA 1FZTA 2ZE7A 5AHKA 3Q41A 4CT0A 1BVYF 3CFYA 2VQFB 1ZCFA 1RKSA 1NMYA 4HJXA 2R8XA 3UJPA 3OAAD 3Q85A 3HRKA 4ND7A 5DHPA 1G5TA 2FSHA 3FYSA 1JA0A 3H0EA 3DFUA 3GJ7A 4NDZA 3MILA 2VXYA 1HT0A 4RK0A 4DBLC 3IESA 3OY7A 3IILA 3H19A 3KIPA 4P32A 4I1PA 1V0JA 4PSKA 2JBAB 3A3OA 1XZKA 2OQVA 3A2NA 2SCUB 5CNJA 1ZCZA 1QIJA 2FX2A 1ZGCA 4HB0A 4ID9A 4MGEA 3ASVA 4EA6A 5KNBA 4JGBA 1OFUX 3NOVA 3E8XA 4HYTA 5K6AA 4JDUA 2J3KA 4C3VA 5JCOA 5CEEA 3ZCXA 1GZ4A 3PD7A 4P83A 1BVUA 2GPAA 3IVMA 4WEQA 1DV1A 3GZTB 4BKQA 1NN1A 3BL6A 3BD8A 4AS3A 4TTRA 1G8PA 3P52A 3P9SA 1X1EA 4PX5A 4V2IA 3C3DA 3E05A 4S1IB 2WZDA 3UBOA 3BZWA 3RSSA 4FI3C 5F3DA 3AUJB 2O8DA 1XP5A 1TZMA 1NLMA 2DKNA 3BJMA 5CDYA 2XGOA 3W06A 1PKEA 3AMVA 3PPIA 4QOJA 1E3SA 3GZJA 5K20A 4IOMA 2N1MA 4TMYA 2VTKA 3FH0A 4ITVA 5FF9A 1VFNA 5KAPA 2WTXA 3ETHA 3FW1A 3R20A 2GRAA 5G41A 4XVCA 3IAAA 3E70C 4JBWA 2DX7A 4J76A 2LBPA 4KDFA 5IWAB 1QIIA 6ADHA 5B6PA 4GM1A 1OTYA 3N8KA 1T9CA 2B4QA 2I5BA 3H83A 4HG2A 2EX4A 5DW3A 5JD4A 1JE0A 2YY5A 2H52A 4JAVC 4KANA 1T6YA 2LIVA 3EH2A 3QF4A 3W5BA 4KZPA 2XCQA 4LY3A 4DV1B 2O2GA 1TT7A 1NQXA 1HA3A 1M6VB 1EVIA 4ALJA 1R6VA 5CX4A 1SOMA 1T8YA 4BGVA 5JY1A 2JLXA 4HUTA 3M1AA 1A9RA 3PGXA 3QSYA 4YJKA 5FR1A 3AR5A 1HEIA 2F90A 1JZSA 2Z95A 2Z3WA 1O6FA 5IJWA 1B2LA 1IHXA 4PVDA 3W7VA 3U09A 3L4JA 3L4KA 1LA2A 2FZEA 2VQ3A 2B8TA 3I01A 4ZQBA 5EGSA 3NHJA 2XD4A 3VR2A 5K0LA 5CFNA 2J0QA 4PHHA 2IXFA 4RTOA 4KV9A 5AM5A 4HV4A 4BGEA 3GHYA 2VRWA 4MAMA 4QTXA 1RADA 3L7CA 1DINA 1Z26A 2DTEA 4FW9A 5IDXA 2CDCA 3EZ6A 3GJXC 1W5BA 4PCAA 4ESEA 4WOKA 1XZCA 1RIFA 2HMUA 4TQGA 2R4QA 3LBNA 4YCMA 2ONKA 3KXPA 5G0VA 3BMXA 2W2OA 3AI1A 1TAUA 1B8NA 3C7DB 4NCHA 2LTAA 1SC4A 3PC4A 1P77A 4NU5A 1MIHA 1QHIA 3WTBA 3A1SA 4E6PA 4TWBA 1N2CB 3IIKA 4CMIA 1E3WB 1JBKA 2B5OA 3D2LA 3EG9B 4P7BA 3E23A 3ZDYB 3KWJA 2ZZMA 3NL3A 1UL1X 2YS6A 1EUCA 2I7TA 1THGA 2ZB8A 3B5JA 1CU1A 1P2FA 3MWFA 1JW9B 1V1RA 1XDZA 1UK7A 3DYBA 1VBMA 2G17A 3LCVB 5EUBA 3USES 2YJ4A 3BXZA 3EOZA 3NH6A 4LZJA 2PA3A 3LKBA 4S1MA 5LA6F 4BAZA 1G2IA 1RQ2A 1SQ0A 2RH9B 3B8HA 3LFHA 1JHXA 4OD0A 2EFDB 4CW7A 1XJ5A 3UJ8A 1NXPA 1WPQA 1DWOA 3BWEA 1TM2A 3WLHA 1PO7A 2O1XA 5KJ1A 1JXOA 1Z4QA 1C3VA 1KXJA 2JIRA 1I36A 2QYHA 1IJBA 1RI3A 3G17A 3H5VA 3HUEA 4IOKA 4RPJA 5DM60 4EHHA 5HUJA 3KUKA 5AJUA 4K0RA 1JT2A 1AMOA 5KYVA 1VJ5A 2EAUA 1HDGO 2O1EA 4JX9A 3VPHA 4EBUA 3P19A 4XM0A 5A3JA 3L0BA 4QL3A 1JZTA 2OLJA 2QTZA 4YH1A 5JDIA 4EW6A 2VWGA 3H8JA 1YR3A 2FXIA 5GADl 1RAEA 5EFZA 4C9BA 1WB6A 3GYBA 2LPMA 1QRAA 2IXDA 2QP3A 1WL8A 1WNFA 4OMDA 4AWBA 4ZQFA 1PS0A 1L8OA 3TQQA 4NBUA 4FUQA 4L9WA 2R7NA 4RA9A 3T9AA 2ZJ1A 3ZIAA 3PWSA 4FSHA 1KQFA 1MCZA 5AW1A 1LDNA 2JFYA 2E0IA 4DMFA 4CODB 2GZHA 2H9YA 4I8DA 1T1SA 2H1RA 2ID9A 1VKOA 4YUYA 1LWNA 2VJAA 1O08A 3IR6A 2EKPA 1M7GA 2J4FA 3NALA 1LX7A 3I45A 1UZNA 5I7FA 1ZI6A 4D0NA 3O2NA 5LPNA 1USVA 1NXXA 5MN5A 1DIRA 1GNVA 1M34E 1IOZA 3VJKA 2IC5A 3PNBA 2H4HA 3KOYA 4HB3A 4HWKA 5EHZA 3L7IA 2YWEA 3WKCA 2EZ9A 1MV5A 4TMZA 4C0XA 2C61A 2JRCA 2C94A 3OPMA 2YRWA 3BGSA 3CC8A 4OYYA 1THMA 1Z33A 2RHMA 2ZUVA 4FEGA 1J49A 4N82A 4ZIRA 3QXJA 5KINB 4IJVA 3NL2A 1VL2A 5D3QA 1UXKA 2WWFA 5CDFE 3SVTA 3GR6A 3VGPA 1IBSA 1ZVVA 4E30A 2GNOA 4BXOB 1DBWA 1NY6A 2CNWA 4A15A 4L72A 4AS2A 2CXQA 1NXOA 1NVXQ 2E87A 5F4ZA 2ZE6A 2EVWX 2QUIA 2RGNC 1CVLA 1KEEB 4XCQA 2G25A 2WUWE 2W48A 1KEUA 2FEKA 3OQVA 5F1KA 3DQQA 3A06A 1WUIS 3ZBUA 5IT4A 2DY1A 3N74A 3IJ5A 3OF5A 2NO5A 1OXBB 5EYPA 5CFRA 3UW3A 1OILA 1FP6A 4R6XA 1EDBA 3NVAA 3LKIA 4ZU3A 1TVKA 1ZQ9A 1C3QA 1SIOA 2HTFA 3RUFA 2A88A 7GPBA 2AC7A 4MKIA 1NJ2A 5FEMA 1XTQA 2Y0CA 5ECDA 4EKIA 2DQYA 5C8DA 4GR4A 3SYNA 5K0SA 2FSGA 4P08A 4EVQA 2H92A 2GA8A 4V39A 4L4RA 2K87A 5K0EA 4U6QA 3ELWA 4UM8B 5AYVA 1IL0A 2OUKA 2YIJA 3HG7A 1CX9B 1QIKA 3DBRB 5JS1A 5AM0A 1XZQA 4B3SB 1Z74A 3RRXA 3B2NA 5FHQA 2IYFA 4D4GA 1ULBA 3PHLA 2IYVA 4QG3A 4CVLA 4ZC8A 1YL7A 2AUNA 1IWOA 3ZJ4A 1II8B 3WRXC 4M2LA 1C3XA 5EHXA 1VG1A 4FHEA 5CCXA 3A8TA 1OIXA 3IQEA 1U3WA 2WP0A 1TPYA 5A4IS 5DP1A 4UCFA 2NVUB 2VJBA 3ENNA 3T3DA 4F4CA 4HDNA 3SGLA 4X95A 3C8MA 4LE0A 5HIMA 4X62B 1IEXA 3PUHA 4X5OA 1QV9A 5JNRA 4EJSA 1YO6A 1NY5A 1UC4B 1NUHA 1P7YA 4F60A 4GKKB 2NTYC 3HWX1 3OTQA 4KNVA 5AQ1A 3ZK7A 4DA0A 4EDHA 2IS2A 3AL0C 3EDCA 1FL9A 3FGOA 2JFUA 1NRXA 2RGRA 1BMDA 4LHVA 1EVEA 5C5IA 3JZAA 4OIFA 4WN9A 3QFSA 5ADUS 2WU1A 3PXAA 4FFDA 4COOA 5L6MB 1GVNB 3CHYA 5MN4A 2WNHA 1HDIA 1M6WA 3HR8A 3K6JA 2E9SA 1VCMA 4WZAA 1RP1A 5L3SB 2C59A 2XAUA 2GCAA 1L8LA 1G8SA 1RLTA 2XT0A 5CNKA 2VT6A 1OIWA 2A57A 3NL5A 5CLGA 1ZBQA 2CNLA 3IBGA 5EZ5A 3UAXA 2V6JA 5C1BA 1CK4A 1QG0A 3H11B 2A33A 4TKZA 5HFJA 4ZO6A 3TDMA 4DCUA 1DG9A 1Z22A 3CZRA 3H13A 4GPIB 2YV4A 2UKDA 2ZREA 4RMGA 1SVNA 3CH6A 4X8MA 2B3DA 1HT2E 1U1GA 4N76A 4CBVA 2I1WA 3OKPA 4D9IA 4ENWA 3VAAA 1CQIB 1QFZA 3D54D 2AC4A 2UUBB 4NC9A 4UCWA 3ZW8A 4D41A 1GITA 1CJMA 4I3FA 1ZCJA 4G0OA 3BDIA 2W42A 3D4LA 4N9WA 3FFTA 2RHJA 2ZJ3A 5FH9A 1E2JA 3QXCA 2G9QA 1LD3A 1DXHA 5DKFA 3NHWA 4RPHA 4RGYA 4AJ1A 2KYRA 3WNDA 5FUQA 3T1VA 1RTTA 5E6RA 3TTVA 2SNIE 2D5CA 2PD4A 1TPZA 4UHCA 2BEUB 3L6BA 3DONA 5E7MA 4YMGA 1Y81A 4P80A 1KQOA 4KDCA 1RPZA 4R7TA 1UANA 3OU7A 5CBPB 3N2GB 4GPBA 2QXTA 2RI1A 2Y67A 3FOAA 3TO5A 4QQRA 3P2YA 5L51A 4CM9D 1RW4A 1TA0A 4ETNA 1RYBA 2WJPA 5EJ9A 3KSMA 3N8IA 4UE6A 2IHVA 5EJ8A 1PWZA 4DBVO 1ZM4A 5I8ZA 3UPUA 3ASZA 4DUGD 3AZPA 2Q4TA 4RSRA 1BDBA 5BYJA 1IPFA 1HKUA 1OLSB 3KE8A 4HFRA 4N5DA 2VFAA 3UWKA 5KOHB 4J1QA 2C31A 1GG5A 3K1JA 3TW8A 2PKWA 1GDTA 2HBQA 1ZHOA 4EW1A 3IRVA 2QQEA 1UBEA 2VWPA 4OFWA 4Z9BA 3OUZA 5IAAA 1DEKA 2Q2NA 2WICA 1N6PA 3F6RA 2BT4A 3CY6A 4GYYA 3WADA 4K8KA 5A0VA 1C3JA 4DLYA 4HQOA 1UA4A 3NC0C 1FFBA 4DM7A 2F8TA 4FN5A 3PFBA 1E9CA 3IUBA 3OWXA 3GLFB 1TEXA 4DSTA 5DI9A 3CRVA 3RSFA 1CBUA 3OQJA 1WW3A 1VHQA 4LE2A 1G0NA 4MR8B 4IH4A 1LJ8A 2BSQA 4DDVA 2FR8A 3A9SA 2OE2A 3K2IA 4B3CA 4ENRA 5CT5A 1G5FA 2H2GA 5IM4F 1FFYA 2H17A 2I71A 2P9YA 1ZN2A 5FTLA 2FZKA 4BGUA 1J09A 5KMGB 4C04A 3EXFA 2CLHB 3MIZA 3YASA 1M2VB 2BH9A 1K98A 1CQWA 4G84A 3VOSA 4ECEA 3TG8A 2VORA 1GFZA 2VXBA 3V2GA 1KMQA 1AUQA 2O5VA 3C41J 2XVAA 1ABFA 4CUJA 4DPMA 2O8BB 1N8NA 2WNIA 2KHZA 3OF2A 4G5YA 4I1UA 1TK9A 2GS9A 3ER9A 1E4YA 3KQHA 1NKTA 2JEYA 4AU1A 5HHTA 1W6UA 2D06A 3T7TA 2YXEA 4LJLA 4JGGA 1T1GA 2CJYA 4GRAA 1NE7A 3KR9A 4HL6A 1KZ9A 3T1NA 1KRHA 5IU6A 1FJXA 3A4IA 3E58A 4Q9JA 4E22A 3HKEA 2RAVA 4DA6A 4EFDA 3OCJA 1TFUA 3LLCA 2XAAA 2HK7A 2Z83A 4JT9A 4WBNF 3QY9A 5AP9A 5DW0A 3N2EA 1N2BA 1XF9A 1JDJA 4LXHA 2FZVA 5BQPA 1VDMA 4AYWA 1ZAYA 2AMYA 5EY7A 2V97A 3IMKA 5B2EA 2QIPA 4QTTB 2Z9DA 5KVQA 3LCRA 2VDOB 2PRIA 3TBKA 4S12A 3SI7A 3K9EA 1J5XA 1XVUA 4FX2A 3PHBE 4INZA 4UAGA 3T41A 1OAAA 1Z36A 2M2IA 2WD8A 4PX3A 1PUIA 1NQWA 1UFOA 2Q4DA 3A27A 3FJYA 1T5OA 1B26A 3R5KA 2H6EA 2PQMA 4FQ8A 1C9KA 3CUEF 4M46A 5D51S 5FBKA 5A9TA 3ZQ6A 3ED1A 2GDJA 3RQ6A 3UJHA 1L6IA 1DC6A 4IIGA 4B7ZA 3I1FA 4KP7A 1AUXA 3IXLA 4K9DA 3CT4A 2DUJA 2R87A 3G7NA 1GZ6A 3KXDA 3QHPA 2BTQA 4HBZA 4IL5A 3PF9A 3LRTA 4TYNA 1QHNA 2J5BA 2PX3A 2XJ9A 1ECGA 1GP2A 3AR6A 3PQEA 1VIVA 1JIJA 3OKAA 4CTKA 1XE3A 3H5OA 3C7AA 1NBMA 3FDXA 4WD3A 4C43A 2D2FA 2OBFA 1DIHA 2D4HA 1CZRA 3CLRC 4PZUA 1GAWA 3QBTA 5DIFA 2OILA 3G82C 1ZYUA 4KI0A 2GLUA 4RIHA 3L6CA 1A1SA 4Y6PA 3RQSA 4AY3A 1XRMA 1G63A 4H1TA 1T9GS 3UXEA 4P4SB 4PRZA 1M2EA 4BFZA 1K08A 3AEXA 2N9UA 2JRLA 4D1YA 1WS6A 1ISMA 2XITA 3B1ZA 3H3JA 4I9NA 1HPLA 4LY9A 4MIEA 2VO1A 2ZJYA 1HF3A 2NWHA 2E18A 1U7UA 3OE5A 2XZTA 3NTLA 1IZ0A 2Y1KA 3A28A 3RU3A 1OA0A 2NX2A 3L4BA 2W90A 1S89A 2E4ZA 1TJNA 2XMPA 3FGPA 1U02A 3VNRA 5AM3A 2PJRA 4FPXA 3EGEA 4BMDA 4K5QA 3U3OA 5JY6A 4ESHA 1CUAA 1TYDE 4DL9A 1BDJA 3VPDA 1NYTA 4X3OA 5F7JA 4AWAA 4YWRA 4G8DA 1JWLA 2Q4OA 2X1HA 5JSUA 4MKZA 1XPRA 2OFFA 3ZV3A 1H6DA 4HNSA 3RTEA 4K2AA 1BHO1 3QXXA 1EE9A 2CE7A 3DE6X 2ORIA 1F0YA 3ZWCA 4C1BA 2VUSA 2X9GA 4PPFA 1P5FA 3VTKA 4CG3A 4EYKA 3VZCA 2I1QA 1E3DA 2FHSA 2II6A 2ILVA 2O14A 4NICA 5BNTA 3LVQE 5CH3A 1PZNA 3PPXA 3RWBA 5CYOA 4EM6A 4FFVA 4NR0A 1P2DA 2GEVA 2HIAA 3QLVA 1A9OA 5JXGA 1JA9A 1Z5WA 4MV7A 4ABYA 4BNVA 4MWSA 2ZRAA 4LF4B 5C3ZA 3DWEX 2PVCA 3CW9A 5ED4A 1P33A 1WLSA 4K9MA 3T1TA 2IOQA 3NIFB 3R3YA 4JA0A 5A71A 1GLVA 1XA3A 1YRBA 3GY0A 3TSOA 5FLXA 3PA8A 3C16C 4MQUA 4OLAA 3RR2A 1JHPA 3FYUA 3DZ8A 2GN9A 1PWHA 2WI8A 4R31A 3F98A 1ZZEA 2JD2A 8GPBA 2J9RA 4LRTB 4M36A 5EY5B 4MUFA 2FCAA 1S96A 2AT1A 3AQ4A 3PD1A 1F14A 1UJBA 2RG7A 1Y7HA 5LU9A 2CL5A 4WVLA 3OQ1A 3ANNA 4GNKA 5HBRA 2FW7A 4FINA 5D1NA 4AS1A 4GQBA 3GH3A 1B2RA 4O4LB 4NZOA 1MN6A 4RKRA 1CRZA 1LWOA 3HXPA 4IJWA 4QRHA 1ZUHA 4BLRA 5M5BA 3GGSA 3NHRA 2O2HA 1QGDA 4HHEA 2DC1A 4BLOA 2QB5A 2V7QA 3FCEA 2C88A 1YI1A 1G20A 4GWLA 4HMQA 1KPGA 1QOPB 3W3AA 1EMDA 2DEUA 2NXNA 3I6QA 3WLNA 3VHLB 3E3AA 1SC9A 3IUPA 5FOUA 4YIKA 4RTMA 1P62B 4JJGA 5HF5A 2IS1A 4LVOA 3E53A 1CVRA 1M2WA 2QR3A 3CN7A 3ESQA 3IYLW 2FX5A 1J0EA 4QRIA 1YQQA 3I30X 3BM5A 3KL2A 1O97D 3RYHB 1TUBB 2N1BA 2B61A 3LL4A 1B0PA 4MRMB 5E9JA 2WV9A 4KX3A 4M21A 5FULA 4LBZA 4RTJA 3B1YA 3CLKA 4DSZA 1X7HA 4FOOA 1JWAB 1WSDA 3ZCRA 5HQTA 5CFZA 1T2UA 5I7VA 2F9LA 1Z6YA 4L7VA 1J8MF 3B7PA 3GA0A 4FOTA 4UMVA 3SG0A 4EUSA 5J9FA 1VI2A 2J08A 3SHOA 3AKEA 1OX4B 2JGKA 1RNLA 2D2EA 4PYOA 4X92A 3KYDB 2HZBA 3DE1X 3NOXA 1J42A 3OHSX 4BPRA 4CUZA 3WLLA 4UNNA 2G36A 3AY7A 2R47A 4YUVA 3OP1A 3BBLA 2VSYA 4NEGA 5U4XA 2Q2QA 5ALOA 1SK9A 3OTWA 3BWYA 5K05A 3UHPA 1KZ4A 1E6CA 3T9EA 2EFGA 2WAYA 3ONVA 1XR3A 1U0SY 1ILEA 3ZM5A 3N6VA 3OICA 4FLMA 1JECA 9LDTA 1Z29A 2WG0A 3FKJA 3NYIA 2A5DA 2RAFA 2CVZA 2Q6OA 2R4UA 4X6XA 2PCLA 3NJRA 3PUZA 4OJNA 5JAZA 4KQ2A 3KT0A 3ZCVA 2WWXA 3BXEA 2ZTSA 3LWZA 3QVGA 4RZUA 3ZEAA 3RUDA 5HCUA 1S02A 5BVGA 1LBIA 1J5PA 3DDHA 3X43A 1C0EA 1CRLA 1WNTA 2C99A 3TQHA 2CLLB 3B52X 3F6EX 3PPWA 5U9CA 1RK2A 1J8FA 1PSWA 2R8ZA 3QEMB 5JZBA 4R8RA 1GJRA 4I50B 3TK1A 3IUNA 3WHIA 1R0BA 4YREA 4BBZA 5JI2E 3WYCA 1SKAA 3A6PC 2XGJA 4TXNA 1C1DA 1VHWA 1F38A 2OCYC 4G2NA 5HGJA 2IYUA 4A2WA 5A4DA 3EXEA 2WF5A 3LJKA 1GPDG 1LXCA 4DMHA 1P0FA 3EY9A 3MTDA 2QSYA 4CR7A 4HQRA 5EWMA 2A58A 5BWMA 1AGNA 1P5HA 3AUTA 5LC1A 4FONA 4M88A 2G70A 4UBIA 2A3NA 4Q9NA 1CRWG 3WAJA 2YYZA 3CISA 1PJ4A 4I1YA 3PZBA 1BEEA 1FTSA 2WVJA 2C2YA 2BONA 2PUWA 3AP3A 2QT1A 3FZYA 3GJQA 1R0KA 3L07A 4OHZA 1O8BA 2XA2A 3PE6A 3WP1B 1N3YA 3ELDA 2IZ1A 1BJKA 2FUG6 3TUZC 5LLSA 1ZI8A 3EVDA 5K0ZA 1D2HA 1IHYA 2CXHA 3HDHA 1G5QA 2WJYA 4B74A 1FRZA 5IVHA 4W1PA 1O5IA 2YMQA 3G5UA 3GRFA 3DBOB 2Q7OE 3MS7A 1DAKA 1LBQA 1JHZA 16PKA 4U3JB 1YQTA 3N7UA 4EB8A 5EIBD 3ZOKA 2KLBA 3DSRA 1HYBA 4V2UA 4RY0A 2CB9A 2OHJA 1G8FA 2VUTA 5EEHA 5P21A 4HUJA 3ZG6A 4N41A 4X44A 2HC9A 3ENQA 4RD3A 4IQ0A 3UG6A 1IDN1 1YQXA 1IN5A 4QXAA 1PWEA 5JDCC 3PDUA 3DEYX 3ODGA 5DHUA 3G9TA 3K70D 1GKUB 5IJAA 3DBHB 5J2TB 1V5IA 1JR3E 2Q5IA 3MF4A 2CYAA 3GP3A 4OI2A 4ZCLA 3WL3A 4BNIA 3O95A 4JEMA 2IGTA 3WO1A 1JDNA 1P9OA 2GPWA 1GQFA 5ALQA 5KU1A 2DETA 2C58A 3PI7A 1NSFA 5IRCD 2IXEA 4N7JA 4HC4A 3CKYA 1FTWA 2CMGA 2PXHA 3B3FA 5BOVA 1WQ4A 4PYJA 1PUJA 2GCNA 3E9YA 2GAFA 3LY5A 4XB1A 2X0JA 2PKMA 4AECA 4RPKA 4DRZA 3IE7A 1MC4A 2QD2A 3G49A 3H1TA 1NM5C 1U99A 2VK2A 2YHAA 4L57A 1OXSC 4LOIA 2XT9A 4RTKA 2BFCB 4ER0A 4Y2UA 2JJYA 2OOKA 2P0AA 4O4LF 5AVUA 1F8UA 3JQBA 4QYMA 5CURA 3TR6A 3TSZA 3LX4A 3EGDB 4YJ2B 1K1EA 3TNDA 4P0TA 3BG5A 5C1PA 1CHNA 2HJ9A 1VE9A 1T6BY 4JLPA 1NA5A 1Q22A 4Q9LA 1S3GA 1K5PA 2RGWA 4GW3A 5FL7A 2OD9A 2IY8A 3PPVA 5CLHA 4CF6A 4MV3A 3TLGB 1I1HA 8OHMA 1NUAA 3D02A 1E8MA 2RDMA 4EGJA 4XLZA 3OH8A 1JRLA 3F46A 2GCGA 3WHPA 3BFXA 1Q17A 3AV3A 4EGSA 4CGZA 4B3GA 2D3WA 2F17A 4EI2A 1F6BA 2HMAA 1DXOA 3B3AA 4MS4B 3OQBA 3ZU5A 5KNDD 2XEXA 4CF7A 1QHHB 4IYJA 5KCMA 5LYJB 5A4AA 4UMDA 3Q7EA 5FORA 4N8SA 5DT9A 3ZD9A 5HDBB 4IXWA 1T9DA 4F1JA 1TZ3A 1MB9A 3JRXA 2FMKA 1C0KA 1EIZA 2C4TA 3CUUA 4FOPA 4WDQA 3BIFA 4DV7B 4IYRA 2FRXA 3KR2A 2ZJ7A 3PDCA 3WXMA 1F2VA 5IF9A 4V0RA 1CJTC 3OEWA 3TVTA 2X77A 1X6VA 4G41A 4BNJA 1WZUA 2QPLA 2HEGA 3C3EA 1J00A 3ZCQA 2R6HA 1NR7A 3RVKA 3BEDA 2J87A 2QVGA 3L0YA 5TT1A 4YT2A 2WFLB 2I6QA 3BRWA 1Z6PA 4N6NA 4GE0A 3FPJA 4EPTA 4E5DA 3AR3A 1VRVA 3Q0IA 4LMPA 2H2FA 2CV1A 3ZV5A 1GEEA 2AWOA 4JUFA 5KTMA 1XSEA 3PZRA 4PLFA 1KZGB 1XNRB 1O6ZA 1Q14A 3AEYA 2VWHA 2AOWA 1BAPA 3M6WA 2VHJA 2NTEA 2X0EA 3BQ9A 5CFQA 2X76A 5DK4A 3UK6A 5JRJA 4B3BA 1VLQA 2GXSA 2XWPA 4IOJA 4LJ6A 5WRFA 1W581 1BEUB 5AI6A 5LP1A 3FFWA 1FXWA 4BB0A 5E2AA 1VI6A 5HQ3A 2HF2A 1ORWA 1IN7A 3AY6A 4I4CA 4UBKA 1DELA 5JARA 4IXMA 5DLPA 3HJBA 1MH9A 4FMDB 3TIGA 3ZHYA 2Q62A 2JIDA 1CY1A 3GNSA 4I50F 4W6ZA 1IMOA 3V97A 1PV2A 3N8HA 3RSCA 4UMFA 1O94A 6PFKA 3SDSA 2D6FA 1AN0A 4ZQCB 4WERA 2HHAA 3K16A 5JISA 1TADA 3EIQA 1JI0A 3IUMA 3HCNA 4FLEA 1L5GB 1A5TA 2HQOA 3OLZA 1IIBA 5J43A 2WQ6A 1QP4A 4ZGGA 4HAXA 1QQ7A 2NO6A 5HZGA 2LNDA 2W2PA 5AUOB 3M6UA 4N0PA 2CNBA 3CSDA 3FCCA 2AOUB 2F7KA 2GCPA 3DOJA 2BR3A 1XCOA 2P6OA 3KTFA 3ROGA 1HR0B 4OK5A 3JQ8A 1YB4A 2GZMA 2H2HA 4I4TB 4UAJA 4HO1X 2AYZA 4LE1A 3MRXA 1RRFA 1P81A 3T4UA 4G1MB 1T15A 2EBUA 3AG5A 3VR4H 4ZZ1A 1XTVA 4RTLA 1Y8RB 3QZUA 4G97A 1BDMA 2OZKA 4QYIA 3PA6A 3F8SA 5BVHB 4C2TA 4RVFA 2XNSA 3F49S 1YD7A 3S2GA 3IC5A 3R7FA 4E5YA 4Z7JA 4RSMA 3WMRA 1YZVA 1R27A 2B0CA 4QKQA 1LBEA 1EESA 3GFTA 2FPGA 2VTDA 2JKYA 3LA8A 4MHOA 5L7WA 3UGJA 3CIFA 4RPCA 1D4FA 1R12A 1GEGA 2H0AA 4Q3NA 5AQEA 3A58B 3DHYA 2O19A 1W8IA 2W9XA 1VHTA 2NM0A 5J2TF 4HPJB 4JLUA 4TRMA 4XGNA 3WHLA 3N28A 2HLDA 4QWMA 4WTOA 1HTWA 4B31A 5TMPA 2HWUA 1OZHA 3DA8A 1UMDB 2EG9A 1DIAA 1CB0A 2GBPA 1WZNA 3QW2A 4I5GA 5HGXA 2XQFA 4GC5A 4UNSA 3SC3A 5J47A 4LF7B 1JLKA 2I62A 2RBCA 2P90A 4GOMD 4MVJA 1ZG3A 1B42A 2VAMA 4DQ0A 1E9BA 2YVUA 2HBYA 5EUCA 3LUGA 4FR5A 5BMOA 1SA0B 3ISJA 1I1QB 3HVJA 2IEZA 1KYZA 3QA3E 5C8ZA 1D7AA 2ST1A 3NNNA 3IP9A 5IKXA 3PQ4A 2IHUA 4DYDA 1Q1ZA 2CF6A 3P27A 4PZLA 3H5TA 4AFNA 2OFOA 4B84A 1UBTS 4MR7A 1R0YA 2QZ9A 3KM0A 2TMDA 2DBYA 4GS5A 4DA9A 3JALA 4UKDA 5LCXA 2QQ5A 4ICIA 3LHDA 1EK2A 3IUSA 4TMVA 3CJTA 4KWTA 3ZWDA 3ZWKA 4YP5A 5KOYA 1DC8A 1SY7A 3MJEA 4PTLA 3B3LA 5ICGA 1I1NA 1RWVA 5LM3A 2BN4A 1PQYA 3K0BA 3R44A 3FI0A 4G4SP 4DMKA 2H4XA 1E94E 3FD8A 4MRNA 4YLEA 4OB7A 5ALIA 1GUZA 2EHJA 4Y0VA 5LYJF 5AVSA 1WQ3A 3T7CA 1LDYA 2ZSEA 3HN7A 1L5NA 3K70B 4KYTA 1WLYA 3P9IA 2GN0A 2Z5GA 3NYRA 3U7QB 4JA2A 1HNWB 2A9VA 2HWXA 1MDBA 2JGAA 3FOWA 1JPNA 1KYTA 1Z16A 2AZDA 3AK4A 3R3UA 4YQEA 3AV0B 1PS9A 2Z8XA 3ZZUA 4JVNA 4EHBA 2CHQA 3ZWNA 4DR3B 1J39A 1AB5A 2W6QA 3AIMA 4IKEA 3NNDA 1U8YA 2AHRA 4UDXX 3AVQA 3G2JA 2NTVA 4PXYA 1G21A 3UOGA 3MMZA 2PG3A 4MQMA 1V71A 4KGVA 1OMOA 1SD5A 3OEHD 4PIVA 1E3LA 4R1MA 3WGUA 4EEZA 1G3MA 2XIJA 4ZEOA 4YV1A 1ACJA 2G9ZA 3AVOA 1E2UA 1VE1A 1QO0A 1M33A 3D0OA 3FSEA 1AKRA 2XMQA 3GC6A 4H08A 4YMVA 3LM8A 2PH1A 3WIUA 3GG9A 2DQ4A 3RU9A 1E6KA 4BRWA 4OKSA 1AHIA 1HMYA 1V95A 5DN6A 5CVTA 1UJ6A 3MGKA 3VU9B 3RAFC 2D74A 2QTVA 3FDZA 2WZQA 4U0KA 4V0MA 4M87A 4KN8A 5DTQA 2YBEA 3NFRA 5GGXA 5HIIA 3RUPA 4FMDF 4CMEC 1T6ZA 3ANMA 3PUVA 3ZNQA 4IFEA 2C8KA 2XX3A 5HUQA 1ZN7A 2IYRA 3D4BA 1XKTA 5HZMA 5F12A 4BNTA 1UBCA 2NSJA 3QEBZ 1PTJC 4LHWA 5AHRA 5FA5A 5TR9A 1O0CA 3ZNOA 3KKPA 2VK4A 2EIXA 1IAVA 2QY6A 4DLTA 4U63A 1CZHA 1ZH8A 1QNLA 5AW7A 4PLGA 2VVTA 2I6GA 4BMSA 5C0OE 1TZBA 1YCDA 1ISJA 5LR6A 3MTAA 2CFSA 1OLOA 3FY4A 1JJFA 1B8PA 3FCAA 4P7FA 1E3JA 1RWPA 1SVUA 3DVLA 4EN4A 1IY2A 4XX0A 4C4ZA 4DYVA 5FTWA 4Q4JB 4NKRA 3UMVA 3VYWA 4LZOA 3IL2A 1O9GA 4UM9B 2AMFA 2JJ1D 2VHUA 4I4TF 5HE8A 4NMXB 3CNNA 3PFKA 4E2FA 2ZZNA 1RM3A 3Q7SA 2J3EA 4OUKX 4W1QA 3CVOA 2HJVA 2B7LA 3IV7A 2EP7A 3B9BA 4E94A 2JJ2A 4R2JA 3O8OB 5G0SA 3JQCA 3KPUA 3Q5EA 2XADA 4JIGA 5CB4F 1R2QA 5KSYA 2GPNA 3QE3A 4C7OA 2CJWB 3EGVA 3D3QA 3ZY5A 4WIAA 4ZK6A 3FPAA 2GWHA 5EMKA 1TX4B 5YASA 5KC9A 3UBTA 2DPHA 4Q12A 3H5LA 2Q27A 3MAAC 4HWPA 1EP3B 3U26A 1NTOA 3SLGA 1Z4PX 1VL6A 3X1DA 3VA7A 1XCJA 2XXAA 3FVWA 4X1IB 1NVGA 1EVYA 4Z1OA 2FN9A 1BO6A 3IRUA 2IOHA 4GG1A 3A4LA 2VHZA 4TKUB 1DWPA 1U5CA 4JJZA 1PI3A 3BQMB 4AMZA 5BYAA 1CD5A 5H3LA 4HVCA 1BVRA 1PNVA 1Z0KA 2D1FA 2R86A 2Z09A 1ZESA 3DZFA 1Y1RA 3K2QA 3KVNA 4M1TA 4CQLB 4AKTA 3SE7A 1HG0A 1RYHA 3BD6A 1F3OA 1I4DD 1LLFA 1PNOA 3NM3A 2R66A 3JAMA 4CKWA 2FEPA 3HUTA 1XWWA 2Q29A 4IIBA 5J2UB 5I8WA 3H84A 4KXLA 1NGSA 3IDFA 3OP4A 3UWOA 1A2KC 3J7AC 3ZYCA 1BDIA 5BQOA 1OFTA 1Z0FA 3FETA 1V3QE 4RYLA 4AICA 4EAQA 2XWJI 4ZOLF 3TZHA 4WESA 3PD0A 2PGAA 1J0AA 4HWSA 1IIRA 1JV2B 1BD4A 5JSHA 4EJ2A 3LOUA 4Q18A 2HFKA 2FA9A 5C4IA 3BKXA 8AT1A 1EZ1A 3O31A 1PL8A 1VLHA 1OH8A 2V03A 5E1MA 3SD7A 5DTJA 3H3FA 1FLDA 1YZNA 3DZIA 5KI6A 4CLDA 1WX1A 1P39A 1QB8A 3A0UA 1MC8A 2FUCA 2ZR8A 1PJ2A 1G59A 3IP7A 4RJKA 4Q3BA 4FHDA 4X24A 3NV9A 4ZVOA 2V5VA 4J1TC 3UK0A 1ZK1A 4EG6A 1V16A 2BUCA 3K1ZA 1QPGA 2JGIA 3SVZA 1AD2A 1H4QA 4GD3Q 1W2WB 4R1TA 3K20A 3MWYW 5T5QA 1ZN9A 1RVV1 2X0KA 4FYMA 1VMDA 5ALVA 1QAQA 5FHRA 1O87A 4IOLA 2GYVA 4KPUB 1C7ZA 3U61B 1HURA 3UBMA 2WAMA 3B20A 3KSZO 4GO1A 5DU2A 4JKSA 1B41A 4DADA 4FXPA 1CW2B 5EQTA 3WBBA 4C4YA 1Y5MA 3UICA 2FDRA 2R60A 4EFKA 4CEHB 2CDRA 4MO9A 1SAYA 1H3FA 1N2GA 3LPNA 4N5HX 4W8OA 5IDYA 4Q7QA 2ZB4A 4ZVPA 5BOSB 3IQFA 1SCUB 2Q0HA 3OC0A 4PC6A 1SZDA 3BULA 5KTSA 3UQYS 3LWDA 2WBLC 4GR5A 2GZ2A 1JG4A 4D0GA 3RG2A 5B4VA 3ZZNA 5IN5A 4WNAB 3SEQA 3BUSA 1KMIY 4EMBA 3C2QA 3MT8A 4YLYA 3ZY2A 1GUFA 1SVOA 2C4EA 2I1VB 1WMAA 3WMWA 3O9ZA 3O92A 2GD2A 2ZQZA 3PGJA 3I5AA 3R6TA 1NQ5A 4G23A 3ZLUA 2HLZA 1JYFA 2R6R1 1Y89A 4PX9A 5CAEB 2A5FA 2DFNA 4JCOA 5LB4A 2B30A 3E0QA 1X7XB 1QC5A 3OO0A 2F8SA 1ZVQA 3L7JA 5KNDH 1P4RA 1FVFA 1DADA 2PZBA 2O2JA 1GGKA 3GT0A 3CRQA 4RCZA 1R0SA 1SR8A 2OGSA 1ZU5A 3I76A 1B3RA 2PSFA 1I80A 4MLZA 2B4AA 1F0KA 1J0DA 1QZUA 4QYXA 3BGOS 3SNKA 1WY5A 4L9AA 2Z3VA 1Z28A 3B78A 1TLTA 5HFAA 1UKAA 3W8RA 2JIZA 3DMPA 4B3DA 1ESJA 2W58A 3LD9A 4ZCIA 1Z4NA 2HXSA 1QX4A 4B3HA 1F2TA 2CDNA 5L7TA 2W0SA 2DR0A 1L7RA 4MOWA 4R40A 1TZCA 2YNMA 2QAGA 1NF9A 3MQFA 4EI8A 1CIVA 4LOKA 3H2HA 1XDDA 4FIDA 4M9SA 3WLRA 1R8QA 1DXYA 3F3MA 3V8BA 1AZLA 1RI5A 3NIWA 2ODEA 1RJFA 3QEJA 5DTMA 4A82A 2C2GA 4OGWA 3F1LA 1OSNA 2SKDA 4D9NA 3IDOA 3NGXA 1HV8A 2PKQP 4HXFB 3SM9A 1N4DA 1EP9A 2OPHA 1QTIA 3HXKA 1EA5A 1BQ3A 1EGHA 3SHVA 2H1OA 1IG0A 3WLKX 4QJ5A 3IKTA 1NF2A 4CQJA 3R3SA 3OLXA 4YAKA 2OV3A 2RAUA 3OD1A 4E4RA 2MINB 4HAUA 1G8KA 1U28A 1CUVA 1N5JA 2ZU0C 2GAIA 1E9RA 1J8DA 1YRAA 1D6NA 2OVFA 5F2EA 1CR6A 1U90A 2OBLA 3U7EB 3W0LB 1HEYA 2EKLA 1UPAA 2QRNA 1V4NA 2V5UA 2VDJA 2YCBA 3CLSC 2RHHA 3UMGA 2PE5A 1LEHA 1PG5A 1RWOA 3LQQA 1QG6A 4BGDA 2CLIB 2JIPA 4TZKA 1SCIA 5BQXA 2ABWA 5JNVA 3ZE6A 1GG8A 3CZPA 5CPBA 3K1AB 3JD3A 1CDZA 3RKSA 1DO2A 3CWQA 2KBFA 5JZ9A 5KWVA 3GGCA 4TYWA 4M1KA 2P9EA 5EE3A 3WNVA 4XYLA 2YXBA 3VR3D 1ILWA 3BH0A 2WMYA 1X8LA 3X1KA 3FFXA 3ELYA 1NUTA 4HAVA 1P6QA 5IYZA 4JLKA 2EC5A 3HKCB 3Q2KA 1WCXA 2FQ1A 2PT9A 4D9MA 2VQSA 3I0ZA 1JWBB 3PDIA 3KYCA 4KVZA 4Y6QA 4Q48A 4M55A 1E5DA 4EUMA 5CM2Z 2OO7A 4JLNA 1PN3A 1L8XA 3B6KA 3WLMA 2FUKA 1XGKA 3W2GA 4MVXA 4ZRDA 1JG6A 1VPTA 5KEIA 4DIUA 4TTIA 2H3HA 3MUNA 4X60A 2J32A 1HDXA 1IC6A 2H2AA 3KT3A 2FGJA 4MV8A 2GSWA 3USCS 5KTKA 4CDGA 4QM6A 5DGCA 3EXHB 3FNIA 2AG5A 4C87A 1N2SA 1O5TA 1CUDA 2FUNB 3W90A 2IXTA 5LQSA 3R75A 2YL2A 2IOFA 5E6SA 4O5OA 1IPEA 3TPFA 3NAQA 4ZO9A 1XZFA 1OYOA 2AG8A 2R79A 1IZ9A 1UJ4A 3PNVA 4IDPA 4JCCA 4MW7A 5KQRA 2OXEA 4P22A 4QNNA 1REQB 3FCSB 1WVGA 3ZU2A 3W6NA 2WB2A 1VYHA 5JMOA 2PO5A 2V7VA 1AVTA 2C9MA 3EXIA 4F2HA 5ADHA 3BTVA 3RRBA 1FDRA 3JRWA 1UM8A 1HFWA 2OFXA 3FF4A 2GETA 2VZ0A 3AJAA 3KS9A 4S1OA 4KVFA 2P4SA 4XD7A 4BUBA 1VCIA 3LRXA 3I61A 2H48A 2HO4A 3TF5A 4YCNA 3AHHA 4DCGA 3GEBA 3L8GA 3MJFA 1YJAA 2DH5A 4PIPA 5JAUA 1JLLB 1PNTA 2O50A 2ZKIA 3BE4A 1OB2A 1TJYA 2ORVA 4ER5A 1LK0A 1XKXA 5K0GA 1IEQA 1UEXC 4KRFA 2V8OA 2JCSA 3K2BA 3UWSA 2EWVA 4RNCA 2YZKA 1DI0A 2C4VA 3TRHA 3OZWA 3AJ9A 4DHWA 1FDIA 1RYYA 1FFGA 2XOKD 5KX5F 4DJAA 3RIHA 2REQB 4QU5A 3S2UA 4D9HA 1I7QB 3W5DA 3P20A 2FG6C 2PLAA 4FI3F 4GHWA 5ALZA 2PX5A 1NW7A 5AESA 4IV0A 3PFWO 3UOWA 3OJXA 2B94A 3PSAA 3K15A 1D9ZA 4G67A 4MGZR 1GL6A 2C3UA 3R6GA 3M5PA 4OXNA 1VLMA 1FRQA 3QPCA 4X7PA 3KKLA 2EKZA 3K71B 2RK4A 4IFBA 5KX5B 4MJ3A 4QA9A 5JMWA 4J0KA 4OKNA 4PFKA 4ZQIA 4HAIA 5JZOA 4ZCQA 1LIJA 5AJTA 3OU6A 1XOIA 4NS1A 1R64A 4PQGA 4X20A 4FDTA 1SQ6A 4G89A 2HPHA 1DTWA 3CPHA 4IGFA 1NPDA 2BWJA 3TZQA 1SULA 3GBSA 4B7CA 3IXQA 4XOUA 4YRGA 1OF1A 2F43B 4A8JC 5JJ5A 3RTCA 5MGNA 1P80A 1FLAA 3SYMA 5IXSA 2WHRA 1R66A 1HZJA 4N03A 5IULC 1BQEA 4ARSA 1X86B 1L5VA 2ZTHA 1AV6A 4R9NA 4H1VA 1XTPA 1NXTA 4TKVB 1KVQA 3ZX5A 3ACCA 4MKFA 4OBXA 1RCFA 4K81B 5BWCA 5T41A 1KP3A 4BU0A 4C2UA 4CIVA 5COJA 1P2TA 4RFVA 1JDUA 2W6JD 3ZWXA 1PT7A 3LA6A 5MGBA 1C3LA 1YGYA 1ZK0A 2VYVA 3DXYA 5F4BA 2YJGA 3TD6A 4CF3A 2W2TA 3DE5X 2GZ3A 1KKLA 1GLNA 1OX5A 1DFGA 1P4JA 2LDXA 3NUZA 4F6RA 3ACDA 4AWXA 1ULZA 3AWIA 5FBRB 3B8EA 2IYXA 1A5ZA 2IW1A 2R96A 2X7XA 3MK31 4MUXA 1I32A 3BMNA 4MW4A 3TJRA 1SNYA 5JWOA 3QYAA 4PPQA 1PK8A 1SHJA 3CSUA 2SECE 2HRZA 4U0JA 1V11A 5HIJA 1NBOA 4OXYA 5TQ2B 2NZ2A 3IDAA 2E6KA 3RJTA 5BYDA 2D54A 3VJRA 4J8PA 4RZ3A 4B2PA 4TYYA 3EBPA 2DR2A 1E20A 1U0LA 1PJRA 2G8NA 2XTBA 1EWYA 1ZLYA 4QNRA 3ZTYA 3VXKA 4C0BA 5C37A 3E7FA 3CCCA 4G2TA 4JLAA 4KAJA 1QKIA 2OBNA 3X1ZA 2NZVG 1BOFA 2VTBB 5KSPA 1DE0A 4K26A 4QREA 2WE7A 1N3LA 1S2IA 3EZNA 3UMRA 1GO2A 3L6OO 1A9ZA 1T26A 2O8FB 1FDOA 1QX3A 2VDLB 2PU7A 4I46A 4C6HA 4DIEA 4DQUA 1FP4B 4B34A 2C00A 3KWMA 3OFND 4JC5A 5F35A 1PK9A 3NETA 1I6LA 1XV5A 3GJYA 3S1LA 3EFOA 3LQ1A 3OOEA 5F98A 3G59A 2BJHA 2P7HA 3DOOA 2C1ZA 1ELOA 3H16A 1MAVA 4XIFA 1EGMB 3TLYA 3WK5A 4DV3B 1AN9A 2BKVA 3D6UA 4HX9A 5L8VA 1PHPA 4YGYA 2EQ5A 2QGZA 4YFVA 3KZNA 3W6PA 1XFAA 4BX9A 5C8VA 3RFUA 1RZUA 1ZRHA 4LJAA 5KOIA 3WL4A 4CLOA 2QX4A 5C3UA 5AXBA 3N0XA 3AFHA 3QF4B 2C8LA 4X9XA 4Y2RA 2OT3B 1JG2A 4F5ZA 3VMFA 4LK3A 5ENVA 5GIOE 3TSYA 4KRGA 3C39A 3F5QA 3OOWA 2XUHA 5JAQA 1PL0A 2VSXA 3QIVA 5LOVA 1U8UA 1SBCA 1L7DA 5H80A 1GTJ1 1IJFA 1I8TA 2I2DA 4QUGA 3B9RA 4IKPA 4RSGA 5A03A 4OFXA 4IXNA 1PR0A 3PRHA 3VAYA 4HH0A 3WOVA 3I5MA 4RJIA 1KE1A 3F2IA 4ME6A 1OH7A 1L4UA 2AQ8A 4TS9A 1Z0UA 4M6WA 4RM2A 1TZKA 3UUFA 2W7TA 4JOQA 4ZJUA 5BORA 5BXYA 2G0NA 3QV2A 3SJAA 5K8IA 4KN5A 5CX1A 5EQFA 4UZSA 1CRQA 4IFTA 3WX0A 4BVLA 4XW2A 1JYEA 2A30A 1VFPA 5ALLA 3AL2A 5KNCD 1QG4A 5F5LA 5BRJA 1H93A 1N5RA 1IWBB 1VLZA 2L17A 2QUZA 2V6GA 1FUEA 2ZU6A 4Q39A 2C7QA 1PYDA 4PRYA 3CB2A 2ERYA 5HF9A 3NG1A 4UASA 2QN9A 1V7PC 3MSCA 2EP5A 4LKOA 5DM70 2WJZB 3P0EA 5BY2A 3SZ3A 4NZPA 1XEWY 3GQVA 2ECOA 4XQ0A 4MW5A 4ZQEA 3CQDA 4K9QA 5DM0A 2PMEA 2ZAGA 4KFRA 1K6IA 4QHTA 1QFYA 1U8TA 4YHBA 3C48A 4FGZA 4MDEA 3EIEA 1NIJA 1QGUA 4GBMA 3AOEA 1FUKA 4QBFA 1ZGJA 2UZ0A 1YK1A 4H1HA 5D6NA 4ZHSA 4HMPA 5AVRA 2CNDA 3K0HA 2BGKA 3U2QA 5DNCA 4TXLA 1GZ5A 4H6XA 2FP4B 1JIUA 3KUXA 1G5IA 3DLCA 4HP8A 5AM2A 3TW6A 5LMUB 2QWXA 2M6RA 2AJCA 4R8VA 3RK0A 2CBZA 2ZW9A 1OHHD 1RACA 4PGFA 1IVNA 4AX4A 3C15C 3RVNA 4NF2A 1GQOA 1GFWA 3M3PA 1A7AA 3RUEA 1KRWA 1EFRA 3C0KA 3GQBB 4BVAA 5I45A 2QTTA 3MMPA 1HWYA 2XB8A 2P9TA 2Q3HA 1T8PA 1BEZA 2DPYA 3FAKA 3OCXA 4X45A 3WGGA 3N53A 1JIIA 1XXHA 1ZNWA 1EG7A 2XNJA 4QUJA 4AO8A 2YHSA 2ZRNA 4F06A 3A1CA 1X80B 3TTSA 3L05A 5DF1A 1K97A 1E4EB 4BNZA 2QCVA 4N3GA 1QZTA 1T2FA 2DFLA 1B16A 1SXJA 3OPQA 1GTZA 2ZI3A 4K05A 5AXDA 2GUGA 1SXPA 2P67A 3OM9A 4G1CA 3JAKB 3LNTA 4HEHA 2M1ZA 1LBSA 5HTKA 3WSVA 3KB2A 4EA8A 3DLHA 2BEVA 4BX8A 1JR4A 2R65A 3PNYA 4J6EA 3IQXA 4TXJA 3RIEA 5HS4A 2H1HA 1N6NA 3DE0X 3DQPA 4AO6A 1I3MA 1YZHA 4OL0A 2VQEB 2JLZA 1QK3A 3BICA 1JQLB 4M8KA 4PONA 2O2CA 5IBQA 4YA6A 1IQPA 2G7ZA 3FHJA 3M0EA 3C4JA 3B13B 2B20A 2BJVA 2NYVA 3VC1A 4AXXA 2HW1A 4R2KA 3IXMA 1KU6A 4L6CA 1J99A 2D7DA 1C7FA 1OV6A 1YDGA 1CNFA 5H16A 4BIIA 4CG0A 5AK3A 4LK2A 3HACA 4LDZA 1AZSC 1Z5GA 4NENB 2QBYB 3DEFA 1SC3A 4XWGA 3EISA 4NAHA 4YACA 3P9KA 3UH0A 4BC0A 4AQYB 3TLJA 5DHAA 1S2LA 1E1KA 3CCFA 5CMLA 1XJWA 2A7QA 3A1UA 2AEJA 3CJQA 5CM5A 1EPUA 1DAIA 3WQSB 3HCOA 4Q3DA 4GI5A 3B82A 3T9BA 4I8XA 2XNDA 3CEJA 3OETA 4Y6SA 3W5UA 2C7PA 4EZBA 4Q3OA 4NFYA 1VLVA 2VDVE 2EHDA 2RB5A 4ZVQA 5IK2D 1TAHA 1R8SA 4NH4A 4EZIA 2H1CA 2ZRDA 3PBKA 5A62A 4ZVRA 1Q1GA 1U2TA 1KGDA 1U94A 3I52A 2ODAA 1BHSA 1MX9A 1P1BA 1VL0A 1VL8A 1XTSA 3QELB 2QRVA 4Y8VA 4MDYA 4P3OA 1BZYA 4B73A 5AW2A 4BFCA 5L3VA 1IOVA 4YS6A 1A8SA 2D2VA 5TJ9A 3HDGA 2WJAA 3UT5A 2CDBA 2DBZA 3LT2A 4LQDA 4PGMA 3OTXA 5LQUA 5TQIA 4F21A 4G8CA 3ZLBA 2BGGA 1GWNA 4WKGA 1JJAA 4II7A 5C52B 4RZXA 3IQ0A 1K7FB 1FP1D 1XLTA 4BFLA 4YRRA 5BN5A 3KALA 2X9QA 3QIAA 2DP4E 3BC1A 3SQMA 3AHDA 3T7RA 3SEZA 2DG2A 5AW3A 2AFHA 2JAXA 4MS1A 4QEKA 4N49A 1BXKA 4BB5A 2EKDA 2O20A 3KYIB 3PEFA 5T7BA 1VCNA 1NZDA 3H2ZA 1WCIB 2QT0A 2V9CA 3BFJA 2BM8A 1SRRA 3OCYA 3AW8A 3V8MA 3E84A 1UXGA 4GWGA 3BMCB 1M0SA 3VU1A 3EBOA 3FSGD 4DRXB 2CEAA 2BISA 3W5HA 3BZUA 3FOCA 2FOXA 3BKWA 3AERA 4F12A 5BN4B 5KVCA 1TI7A 4S2UA 4LYDA 3NQ41 3MJ4A 5FTMA 3JZIA 3ZLVA 3A3PA 2ODTX 3ET5A 3I42A 4A5SA 2O9JA 1X9HA 3O8NA 3ME5A 4ZT4A 1LV8A 1J7KA 3PCRB 3DZKA 1DT3A 4ZAXA 3K96A 2FU5C 4P8RA 5BQFA 1A9YA 2PANA 2PYZA 2EIHA 4IDEA 4AJEA 2P8SA 3HJGA 4AP9A 1YFLA 1ULUA 3B2QA 1XBTA 1G5HA 2P40A 2QL5A 2NP7A 3SOPA 5JFTA 3ZE8A 4YRMA 1CLEA 3C97A 1ETHA 3HCRA 1KJIA 3MJRA 2BSAA 2YV2A 1AHNA 5H5JA 1QIGA 1Z8DA 2XYRA 3L5KA 3MMSA 5FA8A 5TXGA 5HTOA 5JC1A 3J7TA 4FZRA 1U4NA 3FWPA 4W9MC 4PN7A 3I9V6 3LZCA 1DKRA 1QPZA 3WLQA 1KK0A 5C1IA 1QO7A 2EG5A 4B6OA 2VA8A 5J3JA 3TGLA 3WB9A 2YICA 1SHUX 2WAOA 4XUEA 3THWB 4QHSA 2Q46A 1NN3A 3EOBI 4UXJA 1WD5A 2OL4A 1U8ZA 2BBSA 3Q10A 4JHLA 2C84A 3FWKA 1PFGA 4I5EA 2B2XA 1JB9A 1I4LD 4XKJA 3ENWA 3FTPA 4TS1A 1JBEA 3KR0A 3AVWA 4A27A 1QFMA 4PRKA 3IEXA 1XN1A 3EMDA 4I08A 4MP6A 4OJQA 2E48A 3JQGA 2I6XA 2CNNA 1HMPA 2C5GA 5EMMA 1ZMTA 4AI6A 1HDYA 2E2WA 2FI1A 3EB9A 5T6BA 3KX2A 3OTGA 4Z1MA 4IHJF 1E5LA 4DBLE 1FX0B 2EQBA 3O8RA 1MT0A 2CMDA 3EX7C 3MJDA 1ZUNA 2EATA 3RKUA 2P9BA 3LU1A 3HDQA 2G09A 4RC9A 1C30B 5K0FA 1UZUA 4F86A 1V8BA 4JC4A 1DBQA 1UKZA 3M7IA 1E58A 3QG1A 1A9XA 1LVUA 1JLHA 3KJNA 4LYFA 5DSXA 3E03A 1ZNXA 3A04A 2Q49A 2ODBA 4TVBA 2ZE5A 4URHA 4AKEA 4UM5A 8MHTA 3BCHA 3EXAA 2KBEA 1TJ4A 4GPD1 1AJEA 1THTA 1Y6RA 3Q3VA 1QFXA 1KDTA 3VDMA 3PJDA 2CY0A 1DLIA 3LUBA 2FSSA 2E49A 3QNUA 3U60B 2PWZA 4ADSG 4BX2A 2B98A 5IN4A 3QUTA 5T8KA 3ZHTA 4ZRNA 4JKUA 4DLRA 4FDAA 4HRAA 4H18A 1CY7A 4OAOA 2QM3A 3R41A 5KKNB 4C4OA 3SS7X 4AYTA 1X42A 2Q5FA 4WFQA 5I47A 3EJ6A 5LJIA 1KSJA 1QYDA 3W04A 5DOZA 2NV0A 1VM6A 4MKRA 1KHHA 3K8QA 4A2PA 5MFZA 5GOTA 1H66A 2ZJ4A 1XQWA 1HSOA 4YRFA 3IEUA 5LP6A 1TYZA 5HF8A 4URWR 2GZ1A 1PJBA 4QDJA 4QG7A 5CP8A 3CUTA 4JXJA 2FPPB 3LDHA 5FO0A 3WKDA 4C3ZA 3PJGA 4X0EA 4DIDA 5A6SB 2QJFA 3ZU6A 4PYKA 4MUMA 3A6JA 3AR9A 4IILA 5JD6A 4K8CA 4EOGA 4ZEMA 2AX4A 3QWFA 4HGRA 3PUYA 1EM8A 3D5EA 3GZNA 2UZ1A 1VE7A 3HH8A 2WABA 3U4CA 1KZ6A 1U0EA 2VJDA 3EXG1 2G3YA 3P2EA 4HH3C 1XMJA 1FQKA 3S55A 1U4OA 2HU5A 2ES4A 3DGEC 1P0CA 2C3YA 1V5FA 4D9FA 2OAP1 3DW1X 4FYWA 4QWWA 3DTVB 1PRYA 2F1HA 3I32A 2IZ5A 3QVKA 5G0WA 2HY7A 5E4FA 4JK3A 3WNQA 1VLJA 3FXAA 4IQ4A 2W6ID 2W2QA 721PA 4PW0A 1G60A 2QX9A 3BK7A 4PYLA 3JATA 3JW8A 3O47A 4C5JA 5JNWA 1KBQA 3O8LA 5C46F 1ATIA 2JFQA 4CQMD 1F4VA 3B9PA 2B0JA 2LDBA 3GEHA 3AB8A 3OT1A 3H7AA 4DDHA 2ZATA 1MF7A 1R0ZA 4JB8A 5CJPA 1PGJA 3NV7A 3RJ9A 5FWXB 1DKPA 2YMMA 2HJWA 1GAXA 3BIXA 1RQNA 2FAXA 3AONB 2KLHA 2DDOA 1KEKA 4CVNA 1XU9A 3TLZA 4DSAA 4FC6A 1G4AE 4V0NA 1G66A 2BGJA 4NYMQ 2BL4A 3FPEA 7REQB 1E1NA 4FYJA 5K0TA 3G0BA 2Y9PB 1PV1A 4AZ3B 2FY8A 5G53C 3N2AA 4PZ0A 1PR6A 2YW2A 4QXPA 4KLZA 5EHGA 3OPYA 2HUPA 4FS8A 4KU4A 3RLFA 1LLUA 3UCFA 3DPIA 4C01A 2IUSA 3GJ4A 4WDRA 3UZUA 3LSYA 4CCWA 1MQAA 1ITZA 2XNHA 4BE9A 5AKGA 1WAMA 3ZYZA 5BV1A 4WACA 1NUUA 4MQFA 4IDQA 1EK5A 1YC2A 1OJ7A 4ERNA 1T4BA 4I55A 3U44A 1UDXA 3FIJA 2L82A 2BZGA 4LC1A 4ZXFA 4MI3A 2AFRA 5IMSA 4K8PA 3FI9A 1NFFA 3H2IA 3CUWA 5JCOC 3FM9A 2HMVA 3ZS9A 3C5VA 1AQJA 1OZ0A 3RS3A 2ZI4A 1M1YB 3ESAA 4ID3A 2WOJA 4BQEA 4KAXA 3VSCA 1XWIA 2NV6A 5EZYA 4QZVA 2LRHA 4RHTA 4RLHA 3EZGA 2Z2XA 1JHQA 1X1AA 1FIUA 2C9YA 3MCUA 3DEHA 2VNIA 4BP9A 2CXNA 3KQNA 2IEAA 5JEEA 4K8RB 4FNOA 3GROA 3R24A 1B8VA 4ZGWA 1YA4A 2IVZA 3PNSA 1X7YA 3QWIA 1QVZA 1UMBA 4PYMA 3N59A 3AVXA 4TL6A 4BKMA 4Y9DA 2FV7A 2BFFA 4MUBA 1S9HA 2GBIA 2VRNA 1N34B 4LHYA 2QMQA 2JH9A 1AKQA 1IVYA 1MABB 3OZSA 2WT9A 4HX2A 3K4HA 4M0DA 2AZTA 1X1TA 1GHTA 4XE5A 5IJ0B 1C9EA 1LVGA 3GUUA 3W8NA 5KNCH 1Z6ZA 4O3FA 2UZ4A 2CCKA 4CWAA 1YDWA 2VDQB 1ZRSA 3A6HA 3CZAA 1H23A 3QTBA 5FD8A 1DDIA 4MWOA 5JXHA 5K45A 1GPYA 3MGAA 2AI2A 2BHLA 3F71A 1COWA 4A0HA 3D3WA 4EKDA 2VP6A 2BEWB 3ZGNA 4PLTA 1Y1KE 2ZWMA 1TB4A 2RCNA 4AP5A 1F2UA 3CW8X 3SMQA 3GJ0A 3EXG2 3F6BX 4CM4B 4D8UA 1YJXA 3NANA 3M6LA 4LUCA 2P3QA 4G1UC 4OSEA 4PR0A 4BNLA 5GIPE 4URUR 2O8EA 1Q20A 1Z3CA 2WJ6A 3OLYA 3JYHA 3OZGA 3SKXA 3ZUPA 8ATCA 2I2BA 3M3HA 1NMQA 4B8WA 3M2PA 5ES3A 4GKBA 3H4MA 4G5GA 1XQ6A 1MKYA 2Q3EA 4I4LA 3HVKA 5T4FA 4NHOA 2YH2A 3EA0A 4Q82A 2QUHA 2G1JA 3GCDA 1H3EA 1T4MA 2PFSA 4MUYA 3HJUA 2I9PA 1ISSA 1Z8NA 1Q74A 1QH1B 3OCZA 4M86A 4AUEA 4D46A 2RHRA 1M0TA 1JIXA 3HB5X 4NABA 3W79A 5JYBA 3EWMA 4E4YA 1KQPA 3LL7A 1HZZA 4DWVA 4WLOA 3COZA 3V4RA 1VJCA 1AB6A 5EFOA 1Z5ZA 2X8JA 1G19A 1WMSA 2NYAA 1PFUA 4ESVA 1MG5A 3RYTC 5ELLA 4NRDA 3R1IA 1T1EA 5IM5A 4YJFB 4EYSA 1FQWA 3O91A 1QLWA 2VYNA 3WG9A 1E61A 1U98A 3ZCPA 1G3QA 3JULA 4XCVA 1CQXA 3NEYA 3QMVA 3VO1A 4E07A 1FMCA 3QPWA 3UY4A 4A2QA 1S2MA 3G8YA 2NVOA 1CSEE 1JKXA 3QNWA 4CFZA 4ER6A 2HDWA 3AUUA 1VXRA 1YS9A 3KOOA 3ZU4A 1DAFA 3E6AA 3IAS1 4F72A 3IHKA 4DHEA 1JL3A 1YU6A 5K2MA 1U3GA 2GK4A 1NLFA 5D5HA 4YR9A 4B5LA 5ICMA 4PBTA 5K4GA 1EAYA 1Y33E 4WOBA 3WYGA 5AH0A 1X39A 3SOZA 1ZXLA 1E1QA 2B2CA 3JCZA 3DEKA 4Q3LA 1F48A 1NKVA 1L7XA 4TVKA 4BUCA 1HLDA 2NN3C 3TQSA 3DF7A 4PPGA 2DSTA 5HKLA 5JDIC 4PG6A 2FTKE 1C2YA 2QE7D 2ZJ6A 3B36A 2VOJA 1U3FA 3FX2A 1KQGA 1VKNA 1R5NA 1QP7A 1TKCA 4DMLA 4PFJA 3LQ2A 1N75A 4UNRA 3VHQA 2FW1A 1JFFA 3FVRA 1C5KA 3Q6NA 5DT2A 3FZGA 3DFZA 4Y1RA 4E7PA 1MAHA 1F2DA 1E69A 4EECA 5LZ5A 3C4VA 3MGBA 2QL9A 4K28A 4R51A 3IELA 1NI5A 1UKCA 4YECA 1KI1A 2GCBA 2I65A 4GNRA 3B1QA 2ID8A 3EGOA 5TMEA 1RKDA 4B3XA 1FGSA 2D0PB 4HTAA 2EFEB 3FOEC 2HV8A 3U80A 4E88A 3NBYC 3QPUA 1WXWA 1QAOA 3UUGA 2V59A 4PG7A 5BMVF 4YRSA 1UT8A 4LWQA 5E9WA 4YY3B 1W4BA 3SQWA 2JLBA 4HATA 2NG1A 5JBNA 1PZFA 3CGGA 4C7MA 3KEOA 1LHRA 2XVZA 4KE9A 3SQNA 4M4SA 3VYTB 2D7JA 1M67A 4UULA 1BXRA 1X1DA 5AKIA 1TZJA 2AL7A 1H0KA 1H1LB 2IHTA 3I73A 4S3MA 4J3FA 3DQZA 4Q4AA 4MAFA 3WRYA 2LR0A 4FFNA 1CV2A 4FSDA 1FSSA 4OG2A 1CULC 4RZSA 3QPAA 5FO1A 3U1BA 3A6FA 4JIMA 4YQYA 3W1WA 4OQMA 4REQA 2BD0A 3O4JA 2OESA 1ACLA 3BXFA 2A4KA 4HCJA 3S5UA 2CNOA 3CF4G 4R8LA 4DCMA 1XD2B 3ZS8A 4J0CA 3B1KA 5FA6A 1M3SA 3EDOA 1AZTA 2ZDHA 2G5PA 2ZUWA 4HX5A 3SSMA 4BZWA 2DBQA 4GL2A 1Z06A 2ACKA 2ZRJA 3LOPA 1JJ7A 4YV0A 4R41A 1EFTA 5EERA 2JBAA 4XR9A 3U4QB 1UT5A 1V25A 3DE7X 2SCUA 1TTPB 4ZPXA 3AVPA 2JBHA 4OGLA 5J40A 3O4RA 4XDHA 3U31A 1XWFA 2ZXFA 2WJ3A 1HE3A 1Q15A 1RIIA 3GWZA 4GMFA 3ZIDA 5KO2A 1F8XA 2PZKA 2PGNA 1FP7A 1EXNA 1LSOA 1VPEA 1NJ5A 2Y27A 4RXUA 1DUVG 1Z0SA 3M6XA 4JB3A 4TN1A 4DIOA 4HRYA 3LOOA 2AV6A 2ECKA 2YZNA 2CXOA 2G06A 3SC2A 4DXDA 1DU4A 2PH7A 3KLMX 3WFIA 1W7KA 3LF1A 4FNGA 4TWZA 4EHFA 5FOTA 4R16A 2WMDA 2HSZA 3UMMA 4S1IA 2Y1GA 2JVJA 6REQB 2PGIA 5LMZA 4G8BA 5EESA 5ESWA 1YDEA 4YPOA 1J2EA 1T9GR 3MWDB 5EUMA 4COKA 1N2IA 5FPYA 2QR2A 2W5UA 4FB5A 1T36B 1V39A 1OCEA 1TUGA 4WUVA 4X8FA 1D09A 4NDAA 1FZQA 3KKNA 1I3OA 4RIFA 4MV0A 1IHPA 1BKDR 2ZPUA 3K1TA 3KDAA 4EY6A 6CHYA 4E33A 2FW6A 1A5AB 2ZETA 1JTFA 4AJLA 4PO9A 1ESCA 2DTDA 4UNPA 4O1LA 3SDBA 1ZGAA 1XCGB 1P29A 1Y48E 3WNBA 5FLYA 3JVEA 4WA7A 2GYYA 4MPPA 1DRKA 2FPWA 3CLSD 1MJGM 3INRA 3UAYA 4E09A 3EVFA 1WJGA 1FP2A 1ZDMA 4UPVA 4N8EA 2R8RA 1M6VA 4KYIB 5AWFC 4YI5A 2JASA 1D4OA 1U9YA 2ZYWX 4JJKA 4PCLA 1ZJJA 1AG9A 3STUA 1HY3A 4U5XA 5K01A 4WBSA 4BRZA 4X1YB 4JI4B 2VK1A 3D7SA 3WQRA 5F5NA 5GJBA 2IV7A 4TGLA 4MKHA 4IX1A 1DJQA 5HJ2A 4Z7NB 3BREA 4DOMA 3K53A 2XGGA 1YR9A 4X8OA 4DMGA 4R2HA 1U0NA 4XPIB 4AMVA 2I7DA 2DHCA 2WF9A 5ICFA 3QYJA 1L1FA 4UUOA 5B5SA 2FWMX 2P69A 3HLKA 3S4YA 2DFPA 1WUJS 4IBOA 1E9SA 1X8KA 2N75A 4NATA 2WWWA 3VKVA 4RY2A 3G79A 4JJ6A 4DQLA 1XZEA 2QN2A 4TMTA 1ADCA 1RM0A 4XIYA 4DM3A 1KSGA 4X6UA 4BKUA 1L7AA 5JAMA 1RE0A 2IWHA 1S2GA 3HRIA 3L4EA 2AJ8A 3OKFA 2FPKA 5EP2A 3VDQA 4IRXA 2ZTVA 3U40A 4DLUA 1PYGA 4LYJA 2B25A 4YAJA 5EIAA 4BYGA 1GILA 1L7BA 2QV7A 1N2CA 5DM4A 3VPFA 4YDQA 1J97A 1E3WA 1V3VA 4L8YA 4WLFA 1YZ3A 1Q83A 3EG9A 3VDNB 4L0DA 3GLHB 2PUAA 2CD9A 2BCGY 5LQNA 4NPCA 2IQ5A 2ORYA 2Q6VA 4UFPA 3ZE9A 4XFDA 3DHNA 2CUTA 4R3WA 1HSZA 4MYDA 4M7PA 3WA6A 3HB1A 1DL5A 2QTNA 2Y2UA 3V46A 4XYGA 1RABA 2EGHA 3HYNA 4LOJA 4RKFA 3PC8C 3GCXA 2I03A 3GEMA 2FQQA 5T67A 3SJZA 2F4NA 3VHRA 4CM7A 2UUCB 2OWDA 1GSOA 4I9FA 3OMLA 4IDHA 2E4WA 2CL6X 4YT4A 2YJ6A 4L8GA 2J9XB 4CN9A 3E9CA 4JD5A 4G0WA 4RD6A 3IX7A 1NN0A 4D74A 4WY8A 5FOXA 2H7VA 3DFIA 3HPQA 9GPBA 1PDVA 3LW8A 5ALXA 3A1VA 4L5AA 5DV9A 5IUNC 5JFOA 3WB0A 5C3YA 1C8LA 4RPIA 1UXHA 1RJEA 4LFCB 2FZGA 2GUWA 4RPGA 4IY1A 4R2IA 4PZAA 3CSSA 3PFGA 5HNKA 1NW9B 4BFXA 1GQQA 3O4VA 3GT4A 2XHZA 1AKVA 1GL3A 1JQDA 1QMGA 5DNVA 1TEZA 3TTUA 2EYUA 4ZT5A 1HDZA 1W0JA 1P2VA 2CFRA 5EKSA 3E8SA 2JFZA 2XMBA 1A7JA 4I5DA 1YDHA 2XBUA 3GGGA 1D8TA 5D7NA 1PW5A 1GYPA 2CXUA 3ZC3A 1LGYA 4BS9A 2QP9X 1Y8ZA 4MS3B 2ARKA 2H1VA 3HKBB 3VR6A 1YIOA 5FIUA 2GXUA 1T9BA 2FFRA 4M9RA 5AR1A 5K1ZA 1RS0A 5SZHB 1RXWA 4TTQA 1I3CA 3OBIA 2GK7A 1Z2AA 4HEQA 2QMZA 1KKMA 2IRWA 1NJGA 3DG9A 4I2NA 5EIHA 3K73O 1KA9H 3C3AA 4TSFD 2P30A 3RQ5A 1UBRS 2CYCA 3AVUA 3EA5A 3Q11A 1VGQA 3EAQA 5IAEA 2AVDA 3R7WB 2PM8A 4AJKA 4DJ5X 1SU4A 4PWYA 2R8PA 1RQPA 4IO1A 3NJ4A 4BXOA 1TK2A 2HAEA 3LVBA 5BNIA 2FEAA 1U1EA 1GUDA 1LFAA 2IGBA 4GFDA 3ZWQA 3TE7A 1E1RD 3HSYA 4I36A 5ALDA 1KEEA 3RQIA 3AHFA 2ZDQA 3Q15C 1QU2A 1W4RA 5IM4A 1J8QA 4C4XA 3PUWA 5KKCA 4E69A 1WSWA 1IUNA 2Q0SA 2JFWA 1FC0A 3BCUA 4JUDX 2ZIXB 3HP7A 4URZR 2I87A 1H2YA 4IZHA 1N2JA 3P0JA 2AR7A 1EXMA 1L3BA 3WJ7A 2IHZA 3BWXA 2FEXA 3L3BA 3V1UA 1YB1A 1IHDA 3HO8A 5F7OA 1EDOA 1A9QA 4E84A 3OAAA 2BTEA 1YHNA 1A4XA 3PSHA 2BRUA 1JGTA 5HZHA 5L4NA 2GM9A 2LKCA 3AHGA 1Q19A 3EK2A 2GAJA 2I34A 3OQPA 4G63A 1W4AA 4OBEA 4ZJZA 4L02A 3DBRA 3KJGA 5FPTA 4GF5A 1N5LA 3GRYA 3QVWA 3MCWA 4ZVUA 2QW1A 1ZICA 1SO8A 2IIBA 4TTVA 1SUBA 2VHWA 2ZVDA 3ZOZA 4DBZA 1GC5A 3L0DA 2MWMA 1ZM7A 5JWHA 1JF8A 1II8A 1WM1A 2Z0MA 5ALRA 4Z8XA 2I2AA 4D81A 4JQYA 2OV1A 3ROPA 3HS3A 1XEFA 4YAFA 2NVUA 3DZDA 3CA8A 2LZ0A 3LE8A 4MA0A 1VL5A 5A4FS 3JQPA 3L4BC 4ZC1A 2C49A 5BN1A 1KAQA 1NNLA 4ZOEA 3ZDQA 5I4KA 4J3NA 2PVPA 5ILOA 3U1VA 1GRVA 3R7AA 3M5CA 1ZOSA 1O6GA 3FPFA 3JD2A 1XELA 3V4FA 3NBQA 3O7MA 4E3ZA 2EJCA 5K7SA 4Q24A 3REFA 5JC8A 1BMQA 2R3EA 2GJ9A 3PLNA 4C20A 2D5BA 1JP7A 1WHSB 2Y66A 2WJHA 2VAWA 4AK9A 1P9WA 1UPXA 2IZ0A 4GMGA 4QULA 1P9NA 3K0FB 4D3XA 3PNLA 4TKLA 2HMWA 4KQKA 3HCBA 4JT2A 4KGXA 3UH1A 4BDTA 5L3SA 4MGHA 1WB4A 4C89A 4JBNA 2QKYA 5LFAA 4UXHA 2ZT8A 2HPZA 3WB1A 3RIYA 1D7OA 1F7VA 1G7TA 3H11A 1UK6A 1VSBA 3JS5A 4UHEA 4RVUA 4OQZA 2QEQA 3NHUA 3RC9A 3WSWA 4QFCA 1P7WA 1I6MA 3QLVC 2J67A 5DGXA 2XQKA 3NWPA 2CEKA 4M0CA 3MHPA 4MW9A 2XF2A 1JSRA 1YBVA 1TYCA 1B8UA 1DWQA 4B17A 1L4HA 1W1WA 1CQIA 2WB4A 4QIHA 3ZXSA 5CBKA 2WTUA 2VLBA 1SBNE 4CCSA 4GECA 3KZ1E 4DDUA 3SDZA 3KZXA 1FS6A 2WILA 2ZBRA 4BECA 2Z43A 3FYUC 3QJ5A 2EJTA 4YALA 5DPMA 1K3UB 3V4OA 4LYYA 3G1UA 3TBHA 4QF5A 5AI4A 4J0HA 2UDPA 1GL9B 2GHQA 2HADA 2YYAA 1QGZA 2GPSA 2R5NA 4L07A 4ND6A 1KYXA 1KP9A 4Q03A 3C5HA 3K5IA 1QUFA 2IUTA 2MSEB 2OM6A 3C7TA 1N9GB 3G13A 1USWA 2BEUA 3FMIA 4NU0A 3LF2A 4OXIA 2VHXA 4H7DA 3TTXA 4EI9A 5FRDA 1MU0A 3PT5A 2Y1CA 1I2CA 2WQZA 1UAGA 4XWKA 1NHWA 1W75A 2BMWA 3N2GA 5CBPA 2GEKA 2VPIA 4HNUA 3KHUA 3NHYA 2JFHA 3NMUF 1UBOS 3UTCA 5BPFA 2ISSD 3TD2A 5A0FA 1YTUA 4W5HA 2H5LA 3E4DA 1CUHA 2GVZC 2O2EA 5CB6A 2C2OA 3H6KA 4JP2A 2XKJE 3NEPX 3Q9NA 2VSFA 1J4AA 1DTSA 5LMNB 1GPKA 2IT1A 1TT5B 2ZR0A 1FTYA 4G1BA 4JT4A 1Z7YA 1OLSA 4WHMA 5KOHA 2F55A 4P4NA 1GADO 1KBOA 2ZROA 1E77A 3RYIB 1Y9ZA 2XSZD 1LV7A 4CNBA 1MDFA 2BE7A 3PGMA 1BKYA 2C2KA 4B6FA 1BWSA 2A6PA 5DX8A 4AJNA 3ZDEA 3QUAA 1H4VB 3PPYA