2AX3A

Crystal structure of a putative carbohydrate kinase (tm0922) from thermotoga maritima msb8 at 2.25 a resolution
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
491
structure length
491
Chain Sequence
b'HHMKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords hypothetical protein TM0922
publication title Crystal structure of hypothetical protein (tm0922) from THERMOTOGA MARITIMA at 2.27 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 165
structure length 491
sequence length 491
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2005-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 2ax3A01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 2ax3A02
3KZHA 3UQDA 4KADA 5F0ZA 3ROXA 4K93A 2AB8A 2YXTA 1LIKA 1UB0A 5CGAA 1LHPA 1TZ3A 1LIJA 5C41A 1RFTA 3RU2A 4JJPA 4C5JA 2A9ZA 2C4EA 4S1MA 4E8WA 3NL2A 2O8NA 3RRFA 3NM3A 1L2LA 3GBUA 3N1CA 1LIOA 1JZTA 2DDOA 4K8PA 3RQHA 4K9CA 3NBWA 3H74A 5EYNA 4YWRA 2DG2A 4DC3A 4E8YA 4K8CA 2C49A 3RS9A 3B1PA 5TRWA 1VM7A 1LIIA 1V19A 4PVVA 3KTNA 3RQ8A 3RSFA 3K9EA 2A9YA 2AWDA 2ABSA 4KALA 3UMPA 4JKUA 3KD6A 3UQEA 4LBGA 2AX3A 3OTXA 2HQQA 4GM6A 3RTGA 5B6AA 2HLZA 3RO7A 1DGMA 1RKDA 3FHXA 4N09A 1C3QA 4DU5A 1JXIA 3BGKA 3NBVA 4KAHA 5COJA 3RQ6A 2RBCA 3JULA 2DDWA 3IN1A 4YL5A 3RQQA 3UMOA 3DZVA 3RT9A 3ZS7A 2JG5A 2PKFA 3IQ0A 4EUMA 1RK2A 2VARA 4XCKA 4E3AA 4EOHA 2DDMA 3MBHA 2F7KA 3D3KA 4LC4A 3RTAA 1LHRA 1YHJA 4X8FA 2AJRA 3RRBA 3PL2A 3Q92A 5CM5A 4LCAA 3KEUA 3NC2A 3LOOA 2JGVA 3RNOA 3NL3A 3MBJA 3NL5A 2PKMA 4K8TA 3CQDA 1EKKA 3BF5A 3W4SA 1UA4A 4XF7A 3RTBA 2FV7A 3DRWA 3RM5A 3UBOA 4C5KA 1TZ6A 1VI9A 3ROGA 3RSSA 1WYEA 5BYCA 2QCVA 2AA0A 3B3LA 3UQ9A 2I6BA 5C3YA 5BYEA 4JKSA 3RPHA 3FHYA 3IBQA 3NCAA 4S1IB 2NWHA 2I6AA 3H49A 3HPDA 4UBEA 4XDAA 1KYHA 4O1LA 3B1NA 4E8ZA 4EN4A 4EBUA 4E69A 1U2XA 3RY7A 4E84A 3K5WA 3D3JA 3NC9A 1RFUA 1ESQA 3RQXA 4C5LA 3NL6A 3Q1YA 1RKAA 2ABQA 2QHPA 3RU3A 3RQ5A 3HICA 3ROZA 3RSGA 3RTCA 2Q5RA 1GQTA 1RKSA 5EY7A 3RTEA 1VK4A 4S1IA 3VAQA 1TYYA 2AFBA 3RT7A 2R3BA 3B1OA 5BYDA 1BX4A 3RS8A 5TQIA 5CGEA 3LJSA 3UQ6A 1GC5A 3RSQA 3IKHA 1TD2A 3LKIA 4XF6A 1V1AA 5BYFA 2DCNA 3QAIA 3IE7A 3RTDA 1YGKA 5C3ZA 2V78A 2HW1A 3I3YA 4B8RA 3GO6A 2PKKA 3GO7A 3VASA 5F11A 2AJPA 4C5MA 2YXUA 3ROEA 4KANA 4O1GA 4B8SA 3RREA 5C40A 1RFVA 1V1BA 2F02A 3B1QA 3EWMA 4C5NA 3RRJA 2R3EA 4S1HA 1JXHA 4K8KA 4LBXA 2PKNA 3RO4A 2XTBA 2JG1A 3NM1A 3B1RA 1EKQA 3QA2A 4N08A 3RPZA 2I5BA 3IH0A 1V1SA 4K9IA 1ESJA 3RQ2A 4KBEA 4U7XA 1YGJA 3HYOA 3LHXA 4WJMA 3PZSA
chains in the Genus database with same CATH superfamily
1C9EA 3AEYA 1J00A 4PBTA 3BK2A 1YIOA 1A5ZA 2RC5A 3G17A 3UCFA 5HJ5A 3OIDA 1D1TA 1KI6B 3G9ZA 5KJ6A 2CKDA 3IVXA 3GJZA 2HK6A 3EFOB 2GLTA 3GVIA 4S1WA 5HIIA 4CLDA 5KTRA 2GESA 1NDQA 2MIIA 3NM4A 3AFGA 4PYRA 2ZYSA 3K1AB 4URHA 2EU8A 4RO0A 3O26A 2BTOA 5EC8A 4E14A 2R6HA 1OWPA 4RJ2A 3MOSA 4YWRA 2H00A 4DC3A 2VPIA 4XWWA 1P2GA 4OIMA 1Z4NA 1WCIA 2IBTA 4OHMA 1DI0A 3KM0A 3E8MA 1E1CB 4JBLA 5ED4A 4ZHQF 4NQRA 2OO5C 4ER5A 2NPOA 4ZALA 2POCA 1AUXA 5IS2A 4L85A 2ZRIA 3ZIAD 3ZU2A 5ALXA 7ADHA 2IIVA 3GMTA 3EXAA 4KXYA 2IY9A 3ZZ0A 1NJ1A 2BR3A 5CCXA 3JULA 1Z2NX 1IULA 1KL7A 1Z9BA 3PDHA 4XDHA 3NNDA 4U7DA 4OI0A 2DECA 4HAZA 2WB2A 1V37A 5CEJA 3A28A 2V58A 3MT9A 2QX6A 3VHXB 3ZWKA 2A57A 4KYTA 2Z5FA 3LF1A 1VLVA 3HWSA 1ZD3A 2HJVA 4GKVA 3E18A 4DEXA 2OCDA 2X0KA 2H2AA 3G0IA 4RMIA 3MD0A 2O0MA 3HB1A 5D1HA 1SC4A 2DR2A 3FFAA 5JAHA 1VE6A 3COYA 3AJRA 2JAPA 2ZR7A 3U40A 3BIJA 2IELA 4PE5B 3ZNQA 2CUTA 3DBVO 3LHSA 3QEMA 4WCFC 4JVMA 4KR9A 3K8OE 1ETHA 4QASA 1N0VC 1SXJD 2CMGA 1WUYA 2PS0A 3ITNA 3GPIA 3TLMA 3EFEA 1Y7PA 4YRBA 4H1WA 5L95A 2Q0HA 4LYJA 3QJYA 2A4MA 3HA3A 1KH2A 3NWOA 1OTHA 4UZEA 1E4EA 4I81A 3QRWA 4Y2TA 1MOQA 3CVWA 3Q1YA 1CUWA 2CHVA 4DC9A 1Q74A 2CK3A 2Q46A 2FUG6 4MW2A 4XCQA 4XXHA 1GCAA 1TT5A 2HCJB 2L42A 2HM7A 4TGLA 5GJBA 3QUAA 2VTEA 4UAVA 3D6FA 3MTAA 2YICA 1XZFA 4O4IA 3EEFA 1NPYA 4J90A 1ID1A 1U28A 4UAUA 3Q9UA 3V6LA 5C3ZA 2IHUA 2J9FA 3ETCA 5A6VA 3KSBC 4FCCA 3L6BA 2G1PA 1QK3A 4C0HA 2G70A 5ADHA 3CLVA 3MTDA 1G55A 4FE4A 1K89A 2ATVA 1AKVA 1U3FA 2O1WA 4U8HA 5AR1A 1NI3A 3OM9A 2F3RA 4NBKA 1MX9A 3T52A 4DW8A 2WTXA 4YRKA 4C4TA 1AO0A 1UKBA 3PQ7A 3KC2A 1ZN8A 4AJ9A 2R96A 4G8BA 2VWPA 3V4RA 2R00A 4JT2A 5FO1A 1SM4A 2Q1TA 1HTTA 3A4YA 4B8YA 4TKVA 4RF3A 5LLTA 1UUFA 3CF2A 1MAUA 2AF4C 1CQPA 4AM8A 1BGWA 3CONA 3QW4B 2VNAA 5LA6F 5BW8A 2R3SA 3OOEA 1W29A 3Q72A 2OGTA 3JD2A 3STYA 4HRAA 4QYIB 1DDGA 1N5KA 1LY1A 2AKYA 3LXUX 2CV2A 1FNBA 1XN4A 4YMWA 4DMLA 3QFRA 3JQ6A 1RWVA 2FPPB 1GZHB 3PNKA 4OXKA 4IKOA 4N4AA 1RWMA 3QQPA 2WAAA 4OMUA 2QSJA 2IHVA 4R2IA 1QKJA 3JY6A 5D8DA 5H82A 3K5IA 1KARA 1J2TA 4MWDA 2ONYA 3DCJA 2VVTA 3GNTA 4HFMA 1IXYA 4WZAA 2PUEA 3S55A 5AXAA 4HDKB 3FOBA 5T64A 3P4XA 5WRFA 4PSVA 3AR8A 5BT9A 4ADSG 5DH9A 3A0RB 2BHTA 3WZLA 3PVCA 1YS1X 1WVMA 4MLDA 4C4PA 4FJ0A 3ICOA 3FB4A 2OILA 2ZUCA 4NL4H 2ZUTA 1J39A 1JMKC 2O20A 1VG8A 4N0EA 1W36D 1M1ZA 4L5BA 1XMJA 1AN0A 1ZIYA 1JV2B 3A1NA 3KZCA 3P20A 3NVAA 4CM4A 2CHQA 3CH5A 1T8PA 4MGEA 5D3MA 4DLVA 1I32A 3FVVA 2G71A 1L5HA 1RLOA 4XDZA 3VR6A 4Z0NA 2XUAA 1X8KA 2D74A 2CZQA 2BMAA 1DBQA 3AU9A 4Z2YA 1JKIA 2LRHA 3KXPA 4EJ6A 3ER6A 5KZMB 1HNXB 2WE7A 3H5VA 4A9AA 1K8ZB 1EA5A 1OKKA 1YOBA 3D3KA 3U4IA 4YS6A 1RAEA 1OB5A 2C8JA 4FR0A 4DR2B 4CLOA 4KB5A 4GLOA 4AROA 1R0SA 3RNOA 1O5IA 3K6SA 5ALNA 2D0OB 1RKBA 3GCZA 3AHCA 4OI1A 4G2NA 1SN7A 3LKBA 3CPSA 2XQIA 4YRJA 1J06A 1BEUB 5F1PA 2Q2OA 2B4KA 3X1DA 1KI4A 2FJ0A 3HZOA 2D8MA 3Q88A 4II7A 1QU3A 1WO8A 2TMDA 4JEMA 2AZMA 4TVBA 3V46A 5DDIP 4NV1A 3KZMA 2AN9A 1RXEA 2D0DA 3H3XA 3PG5A 1A7KA 1YOVA 3BFVA 4KSYA 4IFEA 1VL8A 2V1UA 5CJ2A 1O2DA 4JVLA 4MRVA 1VIMA 4MRPA 4BGVA 4EGAA 7YASA 5JJCA 4EITA 1NQWA 1WMSA 2XLBA 4PPQA 4G0UA 2G0NA 1X1CA 3PFKA 1MZVA 3WDSA 3ZDZB 2XDYA 5IYZB 2WQ6A 2ZRHA 3RS2A 3WIEA 4XM0A 3W5DA 1O6FA 5ALYA 2DMRA 3R9WA 3OLXA 4MUBA 3G2KA 3ND6A 1C2YA 3FTFA 1J56A 1HG1A 1DKLA 1OWNA 2ZE7A 4U5XA 4WFIA 3UJ6A 1BVHA 4Q9HA 2X7XA 4XCXA 3DZKA 4L5CA 5J59A 4XJXA 2OAP1 2VUUA 5DF1A 3NKLA 4FYXA 5LB2A 3TFWA 1JFFA 1W0CA 1BX4A 3MTJA 1U11A 3LY5A 2PFSA 1YQQA 3L84A 3SJBA 1KAHA 5F35A 4BMDA 1SBIA 5KNBD 2OV1A 5BV2P 2PT7A 2DCNA 1RQPA 2CHUA 2LTAA 4TS4A 4O5OA 1CIVA 1RJWA 1PR9A 3L06A 2B30A 4QOGA 2OAEA 4EPXA 4YMUA 4U9IS 3UJBA 4PQYA 5SY9A 3WBJA 3D0RA 1ENOA 1T1JA 1X14A 3B3JA 2F7SA 5DM0A 4PQEA 5HTKA 4K8RB 5AHWA 3WV4A 1VLMA 5KOYA 1CSEE 5GOTA 2C5SA 1NW5A 2QZJA 1HFKA 4B2LA 2PSHA 3VTZA 4EVIA 1RYDA 1H2YA 3RAJA 4BMSA 1UBNA 2N1BA 4XD2A 3UV7A 2M32A 1S4QA 1GAXA 5DT2A 3KTAA 1LNSA 1UPUA 5I01A 3S8YA 1IONA 3JAKA 4TRMA 3A37A 3C6KA 2QQEA 5FH9A 2IPMA 1D0VA 4PBRA 3CB2A 2GPTA 5EP1A 5JYCA 2H57A 1VB5A 1DPFA 3MLEA 2Z43A 2VDOB 3Q7SA 4RFSA 5B3AA 4ZCMA 1DJQA 3DQPA 4LF5B 5FFFA 3HKCA 4S1MA 2Q29A 3T1NA 1Y1LA 5IEJA 3HFSA 4D3DA 3AVTA 2P1ZA 1SKUA 1FXSA 3OKAA 3T6KA 4M21A 1E0SA 1KVSA 1KYTA 5HPYB 2FMTA 3I2GA 2JCXA 3I2IA 4B44A 3H75A 3ZGXA 3THXA 5E6RB 3WMFA 5TPZA 3WLEA 1ENZA 4KQJA 3KQTA 2XCTB 4LXHA 4GPIB 1N2IA 1ORRA 1TVKA 1GXSA 3N59A 4BV3A 4DCPA 2GBIA 4EI7A 3GLIA 3R8FA 3RM5A 5I7WA 2W90A 2B83A 1K06A 4CKBB 1Q0TA 1C81A 1QQ5A 1U8FO 3AIMA 1NVXQ 3L0YA 4FN5A 2PT6A 1BEEA 2DLNA 1XNHA 3R0VA 3TVDA 3VHRA 1J0XO 1J9ZA 3ZTYA 1CETA 4UXIA 1G21B 4ZYWA 3DL7A 5JXGA 3PCXA 3WGHA 3SF8A 4RE6A 4L3WA 1TF2A 2AWOA 2R8XA 4WXRA 2MHCA 1JSZA 5LMCA 2PUFA 3T5GA 2XA1A 4RMNA 1UK7A 2J4CA 2R1ZA 3AF5A 2WUWE 3NPAA 4HUQA 3ZI7A 4D9FA 2QRNA 1X80B 4LDPA 1H2XA 3D5QA 1DEOA 5L53A 4RTSA 3KXDA 5K9ZA 4C0JA 1KDRA 2W4QA 2AOUA 1H66A 1ZLXA 3R75A 2FFAA 3KFXA 1X2BA 2BMEA 2QGNA 1UA4A 4WLNA 2VJAA 4Z6KA 1ZRHA 4HFNA 1ZGZA 1K6EA 4AULA 2RGDA 2VUHB 5KU7A 3IYLW 3OQPA 2M6KA 5EGNA 4PFJA 4CG3A 5I9MA 3RVMA 1IQUA 5GJCA 4BAGA 4TV8F 3REQB 3SN6A 4CF5A 1N2CB 1YVRA 4NYMR 3CX7A 3LPMA 1H1TA 4IJ5A 5TGDA 1QTQA 1HQYE 4ENVA 3F47A 4PTZA 3UJHA 2K4MA 4PRZA 1PV4A 3WC4A 4S1TA 3PRYA 1OI2A 1J8VA 1FK8A 1QOZA 2DULA 1GCIA 2OD2A 1G9XA 2ZJ5A 3WMWA 4DVJA 2Z9DA 4B3IA 4YX9A 1WV1A 4BFTA 3TLKA 2GS9A 4I8XA 4ZJPA 2FGJA 1C8KA 5C7OO 2A4KA 1KQFA 4XQ0A 2BKUA 1SB9A 2ECQA 4QL3A 4F6RA 2IYOA 1I7LA 1ULAA 5MN4A 1VYVA 1NUHA 2BGRA 1G6OA 2B36A 3EH2A 2GZ3A 1XMPA 2R87A 1NSTA 4KAFA 2IW1A 4HN9A 3K0AB 4KQ6A 4P4TA 4QBKA 3R7BA 3VDQA 1TUEA 1XVTA 3EVFA 3WIUA 4AJPA 2ZI3A 3TEFA 2OYRA 3NYQA 5AJYA 3E2MA 1P91A 4FP9A 4KXMA 4YJHB 1QCCA 4J9UE 5FI1B 2W2QA 4AMVA 1I7SB 1JS1X 1TTQB 3A6KA 1JJFA 1Z0JA 1W5EA 4E4TA 3I30X 2WZDA 2OBXA 4IDQA 3MWKA 3RU7A 5JPDA 3R9XB 1QVZA 4H17A 3RQ2A 4A0QA 4PLPA 2QTAA 4HCJA 5HR5A 5JY6A 4A36A 2EDAA 4FLMA 2C1XA 2J4FA 1JTEA 1NTRA 2JAXA 2OXFA 5JBNA 4WOCA 4WW0A 3ZM6A 2P5YA 2ZYTX 3K2BA 3EF0A 4Q4JA 2C4KA 1SOMA 3CVUA 3P8ZA 5E4TA 4CZ2A 3EC1A 4G0MA 3X3HA 1T3TA 3QBDA 3HMQA 4M1ZA 1P4SA 3C45A 1UJ2A 3U3MA 2JW5A 2O2IA 2PU7A 1U28C 2NP7A 5FI3A 3HNPA 3AM3A 5AJTA 1A3CA 4ZV7A 4JUAA 1QYWA 4KCGA 3FUCA 1JQEA 1DXOA 4LYDA 1T4CB 2VFAA 3PYXA 3BHIA 4FYWA 3RQ8A 4R9RA 1PG5A 2IIQA 1I3NA 5CA1A 5DOZA 5GJVC 3W8FA 3H1BA 1P4RA 3USCS 3Q2KA 4WGGA 3DTVD 1GPMA 1FSPA 1P7YA 5IP5A 4CUZA 4DWJA 2Z6UA 1T8WA 4CKCB 2CLLB 2XRYA 4LJ9A 4KK3A 3KJXA 1W73A 3SC2B 4EY4A 3I4CA 2FCRA 1WETA 4OHFA 4QDXA 1KDYA 2DTEA 1TK3A 3QI7A 4ND7A 1RJFA 1D7OA 3HZZA 4MGHA 2CFTA 1RM3A 4MP6A 5AWFC 1WTCA 3HBNA 1M8GA 2C57A 4HQ6A 1TKRA 5TQ0A 3V32A 1Z7BA 4KIUA 2Z5GA 1PQ4A 4CMEA 3LP5A 2P9GA 2W2LA 2PBFA 1P5ZB 2BTQA 4EPTA 1QF7A 1T2AA 2DHQA 1ZHOA 1HR0B 2PV7A 1M34B 4HEA1 4BVGA 4IHJF 2ZSDA 1WBBA 3C87A 5C34B 3SP1A 4AO6A 2V59A 3QVLA 4L4SA 3U0VA 2VF2A 4S3MA 3D43A 2HI0A 1VE9A 2EATA 4NCJA 1GUAA 4Z0HO 1N78A 3FDJA 1AKRA 1DCKA 2G5TA 4F3KA 1P5JA 3E58A 1L1FA 1VFPA 1T10A 1YE8A 3SYNA 5CB4B 2IW3A 1Q11A 1ONSA 1IEQA 4UBOA 4R6XA 1V96A 3P9NA 1OX6A 2V74B 1JA1A 2BEWA 2H48A 4JKOA 5FEMA 3F97A 3CVOA 1ZNZA 3I37X 3UAOA 3URKA 3Q5GA 1BX3A 2Q3EA 4KGVA 2ZROA 3WMGA 4M9XA 2R7KA 2GAAA 3GDOA 1Z56C 3OJOA 3PQ8A 5EHGA 5HKLA 3I6ZA 5IHPA 5BO5A 4BVBA 3H2JA 3LUBA 4MUKA 4DV4B 3K70B 1DFGA 1R50A 4I6JA 4GWGA 3AM1A 2QM0A 2UUOA 5L45A 1B1CA 4NU6A 5AKZA 5REQA 3SHQA 1V95A 4X20B 5HKKD 1NUSA 2FUKA 4JP8A 1W5SA 2IXBA 3I64A 4RHFA 1USUA 1ESCA 2CFOA 2QTVA 1KAGA 4Y1RB 3PPYA 1PK7A 3QEBZ 1LK7A 1UQRA 4A8PA 3FHTA 1E79A 1RC1A 1AZTA 3NYIA 1OFHA 3GLHE 3WQRA 5I4BA 1HNNA 5KNDA 1FJGB 2ZB3A 2F02A 4P3OA 1VKJA 2C2MA 2W6QA 4C5NA 3VR1A 3SOPA 3DA8A 1XTZA 4NV3A 1LBEA 4HDQB 2CLMB 3T99A 3CCFA 4OFBA 5GONA 2PH1A 1LSJA 2XA2A 4J8PA 1TCBA 2OUIA 2R9VA 3GEDA 3V2GA 4RZ2A 1Q0ZA 3WL3A 4DJJA 3EQ6A 3Q3EA 4IIGA 4TTTS 2AR7A 1G8PA 3ZU4A 3V7NA 5H8WA 3TLXA 2PCJA 2RB5A 3O21A 1KYVA 4M53A 4M0MA 3WRVA 1WCIB 2Q4DA 3LX6A 4N8EA 1JLLA 4R2WA 4AJ1A 1KA9H 2JJ2A 3OSZA 4FDAA 2QUJA 3IDOA 3R7NA 4CIAA 3NJRA 4H7JA 2BWJA 5IEBA 2BFNA 1VCMA 2IF0A 2OFPA 1E3EA 1JJBA 4KLNA 1ZCAA 2P1DA 3WWDA 2OHOA 4E8WA 4BLVA 3FGNA 1N6IA 3IOCA 4IHAA 1X1AA 2QE7A 4YRFA 3WE7A 3IDFA 1ELOA 1YA6A 4LYGA 1QO9A 3D3WA 3ZHXA 3OZTA 4O4HA 1TDJA 3UKOA 4OB7A 3RVDA 3MJVA 3L79A 3QFFA 3V7WA 1EVYA 1Z4LA 3LXXA 3H5RA 3V8NA 4B35A 1U2DC 1Y1QA 1G63A 2PVSA 3CH7A 1SRRA 3DCNA 4X7BA 1AQLA 1PNVA 2IRWA 1JE0A 1EZZA 3CRQA 3L8DA 2I6GA 1I7DA 3OC6A 4ZAFA 1IZZA 1YMVA 2BZGA 3CXRA 3I5AA 4OHWA 4AT1A 1CY8A 5F4ZA 3AGPA 4L6IA 5EWMA 5EOVA 3S70A 3FNGA 3K09A 4QFBA 1V25A 3MJHA 4BVFA 2WF6A 2L2QA 2VYCA 3I2HA 3QEMB 4XCKA 3L41A 2NACA 3NDBB 3I09A 4FEAA 4KR7A 3PL1A 3M5CA 1IB6A 1RP1A 1E32A 3VYUB 3PC4A 4RGVA 1JDVA 1D5WA 1G8MA 4JC0A 4BO9A 1VL2A 4O8CA 3WGKA 3ZCSA 1APBA 4M7PA 1E4EB 4LC0A 1Z6ZA 3VVLA 1QGYA 2ZT5A 2RHMA 3KKMA 3KHSA 4PIVA 5I51A 1GPH1 2I65A 3QXHA 1P75A 2GYYA 3ZJ5A 1TT5B 1Z5ZA 2X14A 3LT5A 1R0LA 4IIEA 4PZDA 5JWHA 3RHFA 4B48A 3VYWA 3DFMA 2DAPA 2GFHA 3ZJVA 2JFZA 4O4IB 4BYMA 4EB0A 2LNDA 5JVDF 2R6JA 4FMPA 2J9FB 3A4IA 4DQVA 2XHZA 4JN6B 1Y6FA 5BMVA 1A2OA 1XCLA 3H65A 3T5CA 2W0SA 3LQKA 3LPCA 3HXOA 1JKFA 3O75A 2DETA 3BWXA 1YU6A 3IPYA 3R3VA 3NIWA 1AO3A 4HQ0A 5KAPA 3WK5A 5I9TA 2GO1A 4TKVB 1R8SA 3JYNA 2H63A 1Z35A 4NH4A 3FDFA 4EPWA 3B3QA 1DDOA 2GO7A 3EXHC 4EF5A 3HU3A 2CNWA 1SUWA 2EXXA 3OJ0A 3QVJA 2E7ZA 3I3OA 1ZL0A 2XVZA 4BFVA 3PA8A 4D56A 3HZRA 4JZKA 4KGXA 1TCAA 1WEHA 1XEFA 4HNVA 2BKXA 4Q1FA 1M0TA 4D9KA 3KR9A 3L49A 5JANA 1GYQA 1X39A 1E1DA 3TLGB 2PKEA 5ALVA 4TLAA 1DQNA 1T6BY 2ATIA 2QNRA 2GUGA 4YCMA 2A9PA 2EW1A 2HPVA 2G72A 1CNMA 4WZAB 5EIOA 4CG2A 2D0IA 4C4YA 3ECSA 1NE7A 3GLGE 2XB9A 2F3TA 2ZXEA 1MHPA 3LUAA 3ETDA 4DRXA 1YDFA 3SICE 4YT2A 3ZE2B 1L6IA 2EFEB 3KEFA 1NYLA 4IPTA 4P5PA 4XGRA 5EYPA 4EI9A 4IUYA 3HWX1 1KJNA 3AB7A 2HA0A 2GPNA 1Y0BA 2IC5A 2YFYA 3X1WA 4R0VA 4X90A 1T13A 1E8NA 4CM4B 4AKGA 5IAAA 4NAUA 3F98A 5D3MB 1SCBA 3NM3A 2WAMA 3HWRA 3BMOA 1F8XA 1L5HB 1GCUA 3O47A 4R3UC 4NEHB 1MC4A 2G4CA 2Q6OA 3TBHA 1PQUA 1ZM2A 4A6PA 4BQIA 3TR5A 1P19A 3KUCA 3AUSA 3RS9A 2PZLA 2RHJA 4PVVA 3CHYA 5DISB 2JLRA 1G7RA 4FFBB 3CTPA 2AUNA 1ZY2A 2Q28A 1NRXA 4KE8A 4CLOB 4JFRA 4YCJA 3K6SB 1TCUA 2AKEA 4YRAA 1YB4A 1LF0A 3M89A 2YJTD 4P58A 1RXWA 2ZYWX 1TCVA 5KQRA 1AQJA 3O83A 1E5TA 2C29D 3ESZA 4MI1A 2QLBA 4RS3A 4EA8A 4BGIA 3DEZA 4OP1A 3VU9A 4J0GA 4HNTA 4RU1A 2WNSA 4TZTA 3HCAA 5F21A 2I6FA 3WLRA 1YOVB 4JB2A 1X1RA 4RAOA 1RJ9A 2PE5A 3DDUA 2Q62A 4BO5A 3JVUA 1KZGB 1Z8FA 1CQWA 1T1RA 3L9XA 4NS1A 2JFYA 4JVNA 3GZJA 2IYNA 4WNIA 4U2KA 4LFCB 2HSJA 3SX0A 1SULA 4Z1OA 3K70D 1VMDA 3CLKA 3R6GA 1DCMA 1QO0D 2PZKA 4RA9A 3DRWA 221PA 4LTDA 4DR1B 4WAUA 5BWCA 1Q14A 3FGPA 3HRIA 1USIA 5DNEA 3TOVA 3SQXA 3KPUA 4ZTZB 4ND1A 5IJZA 4JV5B 2AW3A 5T3YA 1COWA 1M73E 1JFFB 2FW0A 3VKUA 2J6BA 1KSFX 3WIBA 3O4JA 4HDNA 2QMHA 2JCYA 4F97A 4MUAA 4GVXA 1PQYA 3ADCA 5JQGA 4W9NC 3W8RA 2O2ZA 1A82A 1I24A 5FP0A 1N2EA 5HQJA 2O3UA 5BN5A 1JLMA 1JAXA 3GYGA 4AKEA 4J1TA 1WE2A 2J09A 1KH1A 3NC1C 4OMFG 4PGHA 2NO4A 3GLSA 1V6CA 4Y2XA 1VK4A 3GEEA 4GGOA 1TM3E 2CC2A 4BGUA 1U0FA 3KWFA 4U2GA 1FSGA 4EDHA 5FL7A 2JAUA 4Q9JA 1CVRA 4LOHA 5DNYB 1VJRA 2OM6A 3GJXC 3ZI0A 1W19A 5FOTA 1Y48E 3BMXA 4QTXA 4IS3A 3KTAB 2ZM6B 4R1TA 2YKGA 5TJ9A 2VDQB 3QVGA 1BMFA 5HMLA 3JAKB 3DLBA 1QU2A 1L9KA 4Z3DA 1KEVA 4IFIA 4L95C 3WSWA 2HPZA 5KDOA 3BCUA 3G5UA 2XH8A 5KYYA 4KBEA 4YMVA 3KQNA 2LGJA 4RFSB 2GF9A 4AZWA 2JEZA 2P8SA 3EWAA 3S5UA 3HKCB 2GPWA 4RKEA 4QG3A 5JASA 5LMZA 5HNKA 4KR0A 4B9EA 3G7UA 3BWVA 3YASA 2BI7A 3ZLJA 1G38A 5DPMA 1M0SA 2ADFA 4BKPA 3U17A 4OOFA 4R1LA 4MOWA 1TVKB 1GXSB 1Q91A 3KYIB 5CPBA 4DB4A 1XWWA 5JD4A 3GLIB 3KZHA 3DBLA 1VDZA 1XP5A 1Y9ZA 4C6SA 1U9CA 1Z88A 3V34A 2BUCA 2XWBF 3GUZA 3Q1KA 4HPJB 3TB6A 2BZSA 3DL2A 3ESCA 4P4SB 1WRBA 2BT4A 3T3MB 4C7VA 1G7TA 1OW3B 1N3YA 3E70C 2WG0A 3AY6A 3UC5A 1OY1A 2RAUA 4UBKA 2B2CA 3MRVA 5AUQA 1QYXA 3SF8B 1OXXK 4FMCF 4KXLA 1G8YA 4BB0A 5K7SA 2WWVD 3CX3A 4G84A 4Z1MA 3NAQA 2JGKA 4TWAA 2DLCX 4CIVA 3MGGA 3OKCA 1W7AA 2TMYA 4HUQB 1E6WA 5EJEA 4Q4LA 4L6CA 4BVAA 3OF3A 3RG2A 3UHOA 4K7JA 2AOUB 4G3XA 1UBRS 1WUJS 3KOXA 4LZWA 1NAHA 3G9XA 3NKVA 3EXHB 3SC6A 5IT5A 2WNHA 2A58A 3TKAA 3GZNA 4M3NA 3G0OA 1FNDA 3IT3A 1IHXA 2YWCA 2H5LA 3DEAA 3H1TA 3K9LA 4GPTA 3LUFA 4I1RA 2QRPA 2GN2A 4QARA 4Q4AA 3WNCA 1BX1A 1UP7A 4TYYA 4E3AA 3E8SA 4L73A 1QUEA 1KQPA 3BTVA 1P33A 2QPTA 1P29A 4OLJA 1CUEA 1QPGA 1G59A 4CKEA 2XA9A 2CBXA 2QMEA 3U5ZB 5JH7B 3RB8A 3TZKA 5I7OA 3AILA 1IZ0A 1VYHA 1UC9A 3OZIA 5F73A 4BMOB 3WK6A 5TSDA 4CMHA 1TUGA 3WGYA 3CPJB 1Y5RA 1Z47A 3WGZA 3NFYA 4R8KA 3GJ0A 5CGZA 1QPZA 5KVQA 3GBSA 1G3RA 2YVQA 5SY4A 4K9DA 4YK7A 1DWUA 1TPZA 3ZX5A 5C8DA 3KQMA 2CYCA 4OYLA 2AKAB 1JLRA 4F6RB 1SXIA 3UJPA 1CERA 3GGOA 4JR0A 1CUCA 4K5QA 2CLSA 5L4LA 5IU6A 2Z6AA 1NN1A 1XF9A 1BZYA 3OLYA 5DB4A 3NL6A 2OVFA 3N3AC 4Q9LA 2HBYA 3C5HA 5CA0A 4EVRA 1DG3A 2C4MA 2B1QA 3RTCA 1DLIA 4EGQA 2YJGA 2O7NA 2XZPA 5EUCA 2W6JD 3O4HA 4WLFA 5E1MA 3GEBA 4D9EA 5CGEA 2QT0A 3NBYC 4EEZA 5IJ9A 2NYRA 3DLCA 3H84A 3QKSA 4H7EA 4OP3A 4YN3A 4FHCA 4MYRA 4BKQA 1MD9A 2NNLD 2YWEA 3OCYA 4CCYA 3CF0A 3GO7A 3GMDA 3AG6A 2VWQA 1V9SA 1XFAA 2D1SA 3BC1A 1O9HA 3CC8A 3KB1A 4Q4JB 4UVDA 4P7GA 4TUYA 3A1TA 3HFRA 5M34A 4UOZA 1UKVY 2GASA 3ZV5A 1P0CA 2MWMA 1RJGA 1U8XX 3HVIA 3DOEA 1OKKD 3LHFA 4KV7A 4B3BA 5CYPA 1TKAA 4F60A 2XX3A 3CN7A 3LC0A 5FAKA 4EYQA 5T7BA 3ROQA 2XE4A 4FYMA 2HY7A 3KOZA 4W5JA 4WERA 4ETWA 4AN4A 1U8YA 2FWIA 2ZE8A 1N2OA 4B32A 1K7SN 2P9HA 3AM4A 4WLOA 5TQJA 5CA1B 2FP4A 5TMBA 3K1ZA 2JLBA 2WIGA 2XB4A 3K4PA 4O0MA 6NULA 1E5DA 3DV2A 1E64A 3NXSA 4JEUA 1L4UA 4UUOA 3DNFA 2RK6A 2A9ZA 1MJHA 3BWYA 5INTA 3WBKA 2IK8A 1FFGA 5MN5A 2AZ4A 3MJ4A 2BY4A 4PO8A 4LWQA 2XDQA 4JVOA 5HBRA 2Q7OE 2W11A 1GUYA 4O08A 1YRHA 4M0PA 4Z9AA 1IWOA 2PL5A 5FI5A 3WFJA 4HNUA 5JNLA 2PJZA 3R23A 1YR8A 2JFBA 2BTQB 4AECA 3O84A 4QGSA 3JWGA 1XYGA 4RGQA 3BQ9A 3KUKA 1ABFA 4UTZA 4ETNA 4XUGB 4OB8A 5IT4A 5IDYA 4K87A 5HFAA 5FTWA 5TR9A 3DVSX 1U8EA 2J6IA 3NNSA 2XQFA 3FBWA 2RAFA 1DGMA 4N09A 5L7YA 2OQ2A 3EOBI 5DHFA 4BTVA 4DC0A 2ZIFA 4N3CA 4BKOA 1NN3A 1RQLA 2IXFA 4J0FA 5EIEA 4E8YA 2B6NA 4EOHA 4AKSA 1M33A 1FTWA 4BFYA 1ZXBA 4L27A 1PFWA 3OZSA 5B7GA 3PL2A 1CU1A 2PSJA 4INPA 4HTFA 8AT1A 1SUSA 4DR4B 3IIMA 4NLLA 2BFDA 1AZWA 2BEWB 1EXDA 4GX5A 4OQPA 4WEOA 1PW7A 2DEUA 2XYRA 3WMRA 5AD1A 1WU7A 1NMZA 4OREX 4XJTA 1ECBA 3WG9A 1XDUA 5F2OA 2ASVA 2C98A 2C03A 1SOVA 4S35A 4N1AA 1RYYA 1V35A 8OHMA 1T9GR 3I45A 3HBAA 3K53A 1E2IA 1T4DA 4IDGA 4WD3A 2P9FA 2CE7A 2H4FA 2Y4NA 3JPWA 4DDWA 4HMPA 2Y9PB 3NVMB 3PXAA 2Q3LA 3NGXA 3DLPX 1KYHA 2J59A 1Z33A 3D4NA 3QA9A 1Z8DA 2QTVB 1HOXA 3O3CA 5BSTA 4D0GA 4Y9UA 1EXNA 4P36A 3P7MA 3IAUA 1YZTA 3FLMA 5AVQA 4X8OA 3A1SA 3HXTA 2VZLA 1TCCA 5ILQA 2VP6A 3WYAA 3HICA 4CHTA 5BQPA 1DEHA 4TLCA 5A02A 4O2AA 3OOHA 1ZONA 3II6X 1HYHA 2ET6A 4RNCA 5TPZD 3ADPA 5GONB 4Z4CA 2R65A 3RC9A 3E48A 2MSKA 2WY2D 1RWXA 3FFWA 5LQMA 4A8JA 3NHAA 4AX8A 2P3OA 2ZYDA 3DZHA 4CWAA 5LMUB 2ZI7A 2BFFA 3WGQA 2QRJA 3WKBA 2PLNA 3BL5A 4IS2A 5E4FA 4C5MA 4UHKA 1ZW1A 1JLLB 1G291 4MARA 4XE5A 4AKTA 3HDGA 1SK9A 2B2NA 5AJXA 2LVBA 4LBXA 1L4BA 5LU8A 4CIBA 3H2BA 4OPMA 4DNOA 2C92A 1SEPA 3H7IA 3N2KA 4UU8A 2KJQA 1OH5A 4TS9A 5CVJA 4N7RA 1FEZA 3KP1A 4UQLA 1C3OA 1PDWA 3IQXA 3D3WB 4JLPA 2NVOA 4O4HB 3TIVA 2O05A 2Y4OA 5BNFA 4Y7CA 4EJSC 4LN1A 2E87A 1RCFA 3MTIA 4RAQA 1XAGA 2OCIA 1KMMA 2OHFA 3O7WA 2RGYA 2SNIE 1CWUA 3DF7A 1JXQA 5EHIA 2A92A 1RFTA 2R4TA 3KHUA 3RODA 3W3AH 5KTYA 1WUTA 1L9XA 2RHBA 2XUKA 4J3NA 3NL2A 1T0IA 4EG8A 2PXAA 3LPNA 1L2LA 2H1VA 3LHKA 2ECOA 4BFXA 4KVAA 4X24A 3HPRA 5CLHA 1TK9A 1YJXA 5DGTA 3ZXSA 1BWRA 5EWMB 3OQIA 3CISA 4D5GA 2X8AA 2LCIA 2D1TA 1VPEA 2J0SA 3RARA 3PJEA 4GR5A 3DFFA 2PT5A 4KLCA 3S0JA 2YWBA 3IUQA 1GR0A 2WA1A 3MK31 2QP3A 2XJ9A 4MDYA 3M34A 2Q7DA 3ZKAA 2L19A 1PQPA 1WMDA 4ME6A 1SZPA 2C20A 2YS7A 4R2JA 3USZA 4B73A 3NTRA 2HQQA 1GQOA 2FRDC 2HX1A 3CSSA 1ODCA 3FCEA 1DARA 1N8SA 1UP4A 3LKZA 3RR2A 4WBNA 1OFUX 3QCZA 2YIVX 1ZVJA 4IYRA 5KC9A 3TH5A 2QRHA 3WFZA 5JSHA 3JVEA 4EX7A 3T12A 3AMVA 3RT9A 3RDPA 3Q10A 4GOLD 4RZIA 1R4MA 2CZGA 1ZOPA 2CDAA 2GNOA 2LUOA 1C4XA 1EFKA 3BXHA 5DLDA 3H6GA 4DIUA 2GJ8A 2IS2A 1M3SA 3ID6C 1T0PA 2HYIC 5F98A 5JC8A 3L01A 3CO5A 4QOHA 2AWNA 3PZRA 4L72A 5CPFA 1TUIA 2NVUA 3ANXA 3RKUA 3W6PA 4X1IA 5BMVB 4ZTUB 3I53A 1A9OA 3RVBA 2RGUA 1IVSA 1BN7A 1DAKA 1M1YA 1Z6PA 2D2FA 2IJGX 2VAMA 4HQRA 2I66A 1PFUA 5E8RA 3ZGLA 4M76B 2H4ZA 3GELA 2E48A 3I4FA 1BW9A 4MYUA 3ND9A 4EY5A 1JYEA 1YULA 6AT1A 3JZMA 3VU8A 3CX8A 4M9ZA 4Q9IA 1K9VF 3BSSA 2BJWA 3HA5A 1AQYA 2ZCJA 3TLEA 1KPGA 4FX5A 4WOBA 4R1PA 2P5TB 3BXGA 4WZBE 3MILA 1QDLB 4BS9A 1E92A 4OI4A 3NALA 1GT6A 3AHGA 1VC2A 4UEWA 2QXTA 3IEXA 2JGMA 1N2BA 1LS1A 4EG1A 1LB1B 4IOLA 2J5BA 3OPNA 4Z51A 4OGKA 1N3IA 4XM1A 5LP6C 4Z9BA 5HIKA 3AHJA 3OU7A 4GLJA 1B8UA 1JLHA 3GARA 4X1KA 3TE7A 1NVWQ 2N9UA 2HA4A 3DONA 4UFNA 3U4DA 1ZINA 3BIXA 1E9FA 3E1GA 1C0LA 4GBGA 3F5DA 4B45A 3GDGA 2VDVE 2Y1GA 2DPXA 4INZA 3LY7A 3UQZA 4XRRA 3VZQA 4DIBA 3ZL8A 2BBWA 9LDTA 2JNWA 3I3YA 2YNMC 4G5HA 1J0BA 4D7AA 4DRXB 2VOSA 4NECA 4RW0A 5DM2A 1ESDA 2FN8A 2D3WA 3KR2A 3F74A 1P5RA 5ETJA 5EYPB 3UW1A 2HJSA 1NURA 4EFDA 5TJHA 5BSHA 2H1OA 2ERYA 3NXKA 2FSUA 1G4AE 2RBGA 4AF8A 4A5SA 4X54A 5C8ZA 1RKXA 2PKNA 5C52B 2WM8A 5IK2A 3R76A 1OTXA 2XECA 2Q1UA 4L8YA 2W2LD 3DD5A 2DOKA 3BMOB 3O3OB 4L0DA 5AKYA 2DQ4A 2ID9A 1OI3A 3DHNA 1EFCA 2WJZB 3IH5A 5DBGA 5EP3A 1QF6A 1TC2A 1KVTA 3ELWA 3G8AA 4X0EA 4B17A 3NC4A 4YMHA 4YLYA 2P2LA 4HQKA 4K9MA 4RCYA 4EYSA 3BRWD 4CTKA 1L5LA 4CQMA 1EFTA 1XKXA 2COUA 3AL3A 3EQ2A 4MQ4A 3JQ9A 5SYMA 4CF6A 4ZCRA 3HTXA 3G7NA 4BNGA 2XZLA 2C9MA 3W3ZB 4C3OB 5JRJA 4C9BA 3EVBA 3Q2IA 3CR7A 3C85A 4M0KA 4BP1A 2JVKA 1IK4A 4IKPA 3C6XA 1PL6A 2ATEA 2GVZC 3IUJA 3SJAA 3VU9B 1F2TA 5KREA 4QPJC 5EYNA 1C4OA 4B80A 2OV6A 4O4LF 1RJ9B 2V0GA 1GNVA 4LBYA 2BKAA 4RJKA 1GVHA 2I7VA 2HLDA 5FWDA 5ARBA 2G5GX 5KX5F 1D2GA 2F9MA 1UBJS 1VJCA 3MRXA 3QE2A 1JEEA 3KU4A 4MW4A 5AM2A 2QXYA 3WNVA 3E84A 2R4QA 3ZXXA 1XEAA 3R0ZA 4RA9B 5BR1A 1ZSVA 1R0XA 1U98A 4TTQA 3GRCA 4CHGA 4W5OA 2WV9A 4LKRA 3N2YA 2G28A 1K66A 3QEJA 1JVSA 2CXSA 2GCNA 4LGVA 3W34A 5AVTA 1SKYB 1AK2A 1E79D 5DHRA 1MOZA 5KNDD 3MRSA 3G7SA 4Q1DA 2NU9A 1ST3A 3ZBTA 4HDNB 4EUEA 3TM4A 2YV5A 1RPJA 1Z8HA 1OFTA 4GICA 2RK4A 5BWLA 4E4RA 1ULHA 3K9NA 3SHWA 4JQZA 4PWZA 1SVWA 1VXOA 2PAFA 5JQGB 1P7WA 3JASA 4ZI7F 2G8LA 3LIPA 1HT1E 3EXEA 2QLMA 1SUCA 1EBUA 5BN5B 3QXSA 3CZ9A 3RSSA 2CVFA 5L3VA 2Q5CA 2UYOA 4RMGA 4LJRA 3D5EA 3HP7A 4QICA 5BYEA 2B8JA 4MV7A 1YQ9A 1FLVA 2C4TA 4WH0A 3ZE7A 1BC5A 2Y93A 2LPMA 4E5MA 2QF7A 4BLOA 1S1CA 3PL5A 3CR8A 2J8ZA 2LD4A 4X63A 4M9UA 1Y34E 2GN6A 1ZMRA 3QY9A 3LRXA 2IIBA 1EVQA 1RVDA 3QVGB 4D9CA 3ZTTA 2Q4TA 2B8WA 1TZCA 4YRLA 5C5EA 3I9JA 3OM8A 5DHTA 2Z8ZA 4IX9A 2E3JA 1ZG3A 4CR7A 5J4HA 3OCCA 5KYYB 1W52X 3BB1A 4E5KA 5BVGA 1Q0SA 1NKSA 1YHYA 1PNTA 2FOIA 3O94A 1U3CA 2Q1SA 4UPEA 1VI6A 2G4VA 2XADA 4MKXA 4NYJQ 2PR2A 1FP1D 1NDHA 2HGZA 2J3QA 5CEFA 4BBAA 1C7EA 1V48A 5IZCA 3Q9SA 4UHJA 1JEOA 4U7WA 4Y2SA 2CN1A 3OCXA 4W1PA 4AJJA 3U7HB 3JTEA 4P4LA 1QHEA 3P2IA 2X5NA 1Z18A 2IYYA 2OECA 1TJ3A 1K88A 2PSDA 3QK7A 3SXPA 5FUWA 3R6DA 2CZCA 3DBLB 4RVUA 3LDHA 1S3GA 1RWQA 3EWMA 3CLSD 3FNIA 2NYUA 4ZQHA 3FCOA 1EWRA 4M0CA 1PV2A 4NCKA 3KT8A 4QNMA 1RAGA 1K9SA 1ZGAA 3DKRA 5L4NA 2RD2A 3UBTA 1W93A 1GA6A 2Q5LA 5LDHA 5EUQB 2C7OA 3ZX4A 1QDUA 3E9QA 3OCVA 2I6UA 3UAWA 1WTAA 5BYDA 2H52A 4Y1GA 1NOIA 4H3VA 4G1UC 4M8NE 4V1CI 3DNMA 4IDBA 1YAJA 3E3MA 5AKEA 4ZT5A 2PRSA 1BCRA 3K32A 5BUCA 5CDFE 5J2UF 3NR2A 1IPEA 2OKCA 3B5IA 3ROXA 4KFCA 2B98A 2ODAA 5AKIA 4I55A 3CN9A 3CX6A 1R10A 3WA6A 4A2WA 4Y67A 2VK4A 4L8GA 4DNQA 5I45A 2FY8A 2XF8A 2P3QA 4J2HA 1EJBA 3MB8A 3IEPA 3GZNB 3QOFA 2Y9MB 3D7NA 3HM2A 1W6RA 3QE0A 1EINA 3QHQA 3ZCTA 3G2MA 5ICEA 4B3TB 1U0SY 1DB3A 1KYYA 1NYRA 4V0NA 3DXZA 5EE9A 4D4MA 5IUJC 4Q4AB 2DERA 2AXQA 2WEKA 3E1SA 2P91A 2INGX 3FW1A 2HTEA 1GGNA 4EKNB 1NMSA 1AM4D 1XMIA 1XQ9A 1GNRA 1U2EA 2QY6A 2AJLI 3VR5H 4DCMA 4CKEB 2ZUDA 5K8IA 5CFQA 5IANA 5FR1A 1DKUA 2FMUA 2ZK7A 5AH0A 1DO8A 2A9FA 3F9RA 2OKGA 1RAFA 3UY4A 2HUNA 2HCFA 1QVWA 2I71A 5H3CA 1UMDA 3SM3A 3SAJA 3T15A 4FFSA 5B6PA 2CNWD 2O8VA 4QGAA 3REFA 5JTTA 2MSNA 2V8BA 1YGPA 3UJ3X 1JA0A 2HWWA 1RI5A 4OHCA 1GPUA 5CDUA 3S2UA 3UICA 3FZGA 4HDOB 1CULC 1O6GA 2HBRA 3PC7A 2XD4A 4JCOA 3BTUA 2VZ8A 1RI2A 3HJGA 2HQRA 2VXBA 1KYXA 2FTKE 4NJMA 1VSQA 2ZQ5A 4UNNA 3ZXUB 2J5QA 2QORA 5KNCH 5M29A 3UFBA 5A7FA 4K2HA 3VM6A 1BYIA 2BP7A 2X76A 1FY2A 4G0PA 3RF6A 3ZWVA 4XIYA 2Q1WA 2HCTA 1EP2B 5CA0B 3B12A 1NN0A 3G8CA 4ROTA 5JMWA 4FUTA 2AHRA 3C98A 4BDSA 1GHTA 3MUNA 1ESEA 1ZH4A 1VECA 3U19A 3M9LA 4MUIA 4L7VA 4U2BA 2PIAA 5BNIA 1R18A 5IJ9B 1E7RA 1YO6A 1R6VA 3NEAA 3QKSB 4GC5A 4E8ZA 1QKIA 3R4VA 5A3RA 4NFHA 1F48A 1K97A 1FLNA 4BCBA 4CCYB 1IE3A 1XTUA 1Z4OA 2DFDA 4IEFB 4AU1A 5AW2A 3H5OA 1IAVA 4FEEA 3FPEA 4TUYB 2AFVA 3KZOA 3CVVA 2QENA 1FVFA 3BCSA 2ZYGA 3RE1A 2QX7A 4O1IA 1SWVA 2ODPA 2P2GA 3AYXB 3G2JA 1AN9A 3IAS1 5F5XA 1BXZA 1GVNB 1YDGA 3QWBA 5TMDA 1Y1TA 1UJ5A 4N5LA 1D7AA 3HUUA 3BWEA 3JD3A 1IOLA 4UEJA 3BJZA 4DCOA 1EUQA 3DW3X 1WS6A 3QLJA 3ETHA 1T0JB 4UMVA 5DI9A 2FP4B 1DC7A 1MQ8B 2OD9A 3PLRA 1SVNA 1SBYA 2HEGA 3BE8A 2SBTA 3OTQA 4OFXA 4U39A 5ESRA 4D43A 1MB3A 2A0WA 3L8EA 4A8TA 3TNLA 1LSSA 5DYGA 4PFQA 5B36A 1FTNA 4DYDA 1IQ0A 4Y9TA 2JATA 4HWSA 3GT3A 3JYPA 2XDQB 4BKMA 3DOUA 2NUTA 1Z83A 1NXOA 5KPDA 3MERA 5I9LA 3HU2A 1XQ6A 5B2ZA 5JD5A 1SCAA 4FZVA 4ENQA 3CV3A 2VWGA 4Z0PA 1PR0A 3DQQA 3L5KA 4C6HA 1PEAA 3DC7A 2Z08A 4DEYA 2FVXA 1RW4A 1XQYA 4IF6A 2ONZA 3UXMA 4KFUA 5EAIA 3IOBA 2Y0PA 3VMFA 1A96A 2WJJA 4YIKA 1BJRE 1JJ7A 2ZRBA 2E2WA 4M0FA 3O92A 3OZGA 3LP6A 3ORYA 2WSYB 1C4KA 5LLSA 1Z7EA 3FIUA 1E1NA 3OE7A 3WJ2A 3O1JC 9ATCA 5KJ1A 1PEKE 3WL4A 4D9GA 1OZFA 3QNMA 4FLEA 2EIXA 2LZ0A 2R2GA 1JKJA 3BSFA 4A16A 1I94B 2BFPA 5EZYF 2R1VA 2XJAA 3IHWA 3IEIA 4N65A 4QGBA 3S99A 4AWXA 4BWVA 2JGDA 3FG9A 4FYPA 4PIPA 4HTFB 1L4FA 1NTOA 3PVZA 2PXXA 3URMA 3C1UA 3HCBA 2X0IA 1TRKA 2BFDB 3O8DA 4GWKA 5F2EA 3WGLA 5CFLA 3AVVA 3TL6A 1JXMA 1RWBA 1XA3A 5A4AA 1EVZA 2X7JA 3Q3VA 1C9DB 1S96A 2YFKA 1SNYA 4KL8S 1TEXA 3Q5DA 2BMVA 2D5AA 5G2OA 5DTEA 3WL8A 1R6DA 2V4UA 1XA0A 4LSZA 4QREA 1F7VA 4ILKA 2CLDX 4LV5B 2XMRA 4MRMA 4IGIA 2GEDA 2NTEA 1I2CA 5AMXA 1I6KA 1VPDA 4UU7A 3JQ9C 5BR8B 3M6LA 1NW6A 1SU4A 2GYVA 2I7TA 1CW2B 5T67A 1XTRA 1VM6A 2ZBDA 3CIFA 5LOVF 3T9FA 5E9AA 1CHDA 2ZYIA 3EGOA 2EV9A 4PPYA 3FOZA 1F6BA 2VPYA 4LDQA 1WF6A 4ZVQA 5IXJA 3PEWA 3U3RA 4JUCA 3GIDA 4IICA 1X1BA 4EELA 5K0ZA 3IOEA 3C6ZA 3Q3IA 5C3YA 4O2AB 4X84A 3QLEA 2PUTA 3VPDA 2XCLA 3FCAA 3TRJA 4M6WA 4P80A 3L4BA 1NJFA 4QPZA 4D6PA 4M54A 4IVNA 5LCXA 3DDCA 5ESWA 3IIJA 2Z8YM 1E7QA 3ESQA 5HE8A 3RFTA 3TUJC 3ZV6A 4E0BA 4E08A 4DV7B 3B1NA 2XTZA 3ZHSA 1A5TA 1W0KA 2BFFB 1FTSA 3VV2A 2Y1CA 3E4DA 4JQYA 1NNSA 2DHRA 4CMGA 1B23P 3LUPA 2FDXA 2N42A 4PN3A 3BZWA 2I87A 3HL4A 4UUNA 2PZAA 4B84A 2PUHA 2WMDA 2H5EA 4F8EA 3T3DA 2FZ4A 2W70A 4AZTA 3DB2A 3FOCA 1MGOA 3N2KB 3OX3A 2GPAA 5CVVA 1XDGA 2C04A 3REOA 3GV0A 1DADA 3B52X 3T35A 4Q15A 4C0AC 5E8JA 4DXDA 1C3OB 3TQTA 4YJDA 5TB5A 2Q9BA 2Q07A 3GW8A 4PNHA 2PGJA 4LVOA 3CZQA 5I8PA 4UCQA 2W83A 4E6PA 4RVDA 4TSRA 4AZ0A 2ZWMA 1F2VA 4U4AA 1M7BA 2X2PA 3A6ZA 2BMJA 4P4NA 3UXYA 4YYEA 2G83A 3ZHYA 1D0IA 1LIOA 1DJLA 1LPSA 2ZM5A 1GG9A 3ENNA 4CL0A 4JBXA 1IBRA 2HWKA 3O8QB 2HLHA 2XB8A 3B6KA 1B0AA 4WL0A 3H86A 3V33A 2GC5A 2JIQA 2E37A 1ESZA 2HCBA 3OQIB 3EMDA 5EJGA 3STXA 4OX9Y 1FBTA 3D59A 1TAUA 1RIIA 4EH1A 3G6WA 1Y3DE 4OH7A 4DILA 3SX4A 1QPBA 5EPEA 2VTBA 1DMRA 1PS8A 3NHPA 4JAVC 1NFFA 4GYKA 1L5KA 3EC7A 3KFVA 4FHDA 4EKEA 4KXQA 1EDZA 3RJMA 2WKQA 2VQSA 4TMZA 3PD1A 4WBNB 1A5BB 4IEIA 3HUFA 1KP3A 3GJ3A 4C5CA 2Y77A 1L4YA 1WZUA 2GXSA 3IPAA 1Z63A 4HGNA 3A8TA 3GYBA 1YMQA 3OLVA 1R4MB 3CUSA 3QV2A 3IDZA 5F51A 2C2KA 2ZSIA 3B7WA 3K8YA 2ZJZA 2R1UA 3QUSA 5EXEA 4HLUA 3V2UA 4ABYA 2R97A 1ZM3A 3WX0A 3UCXA 2NVUB 1JKXA 1VL6A 1YBHA 2RONA 4BV8A 3B1WA 1KY4A 1M1YB 3EPRA 4IY1A 1ORIA 5LXTB 1M6HA 1WSAA 3AP3A 3FLBA 5ALFA 1EHYA 1N1DA 1MIHA 4UEOA 3DE7X 3H5NA 3K1JA 4IBOA 4YECA 2G06A 1BW9B 2X0JA 4OHUA 4P2BA 1B0UA 2A1TR 2PWAA 5LJIA 2ZRMA 4BNKA 2EAUA 1RZVA 3PC3A 2IUTA 2GZ2A 5A62A 3NBFA 3BOSA 3RBVA 4YHHB 2AJRA 2JIPA 4F9FA 3UM9A 1WBDA 1FQOA 2NWQA 5LKRA 2PD6A 2VKQA 3E15A 1MENA 2JGVA 2CXOA 1HWYA 4FINA 5ALOA 3V7FA 4L9AA 5AK3A 3VJMA 2REXB 3BBPA 1H22A 4MJXA 5H1YA 4ENSA 2ZRFA 3BE4A 4WADA 5CM2Z 3VC3A 5AVSA 3W5BA 1VI9A 5FNVF 4JYCA 1PR1A 5JJIA 1JFSA 1QYVA 3HQ4O 4L2IA 3DFUA 2FHPA 1OXVA 2H11A 2I78A 3H6HA 2A0XA 3QXCA 1ZIOA 2YMMA 4FHEA 4X1KB 3DBIA 3SR4A 1YTUA 2P6NA 3D2AA 2C2GA 3N39C 5BMOA 2P27A 4EUFA 1VHLA 3UXEA 4EQZA 4CQLA 1Q1BA 3PV0A 1MB9A 4X1YA 1H2ZA 1ML3A 4GX1A 1NXWA 4N48A 2HMUA 1WB5A 1Z4IA 3KQUA 3AVXA 4EP1A 4PC7A 3OOWA 4FT2A 1U4OA 4C5BA 1QRDA 2EWMA 4C01A 2HHJA 4OXQA 4K9PA 1U31A 2HRBA 2AFBA 3A6FA 1O94A 4DPKA 1SVMA 2PLWA 4QHYA 3RAPR 3FRJA 4D96A 1QOQB 1T6ZA 3C70A 4HLQB 1GAWA 4Q19A 2R48A 1VE7A 2E49A 2EQBA 1JSXA 4MDFA 4F1JA 1BHO1 1Z5OA 1ZD1A 3D8UA 4QTUB 2YY5A 1LWOA 1V1BA 4YREA 3VFDA 4ARCA 2F1OA 4F93B 4PPFA 2CXNA 3NM5A 4DC1A 3P9PA 4MYCA 3VOBA 3OY2A 1KJIA 2IOFA 1Q6ZA 4R98A 3OAAA 2KWIA 3SZGA 3IP7A 4ETIA 1VHQA 1N4DA 3GK3A 1WY7A 1UAYA 3PC8A 2J9GA 1NXVA 3Q7QA 1WZ2A 4HH1A 3TX2A 3MD9A 2CDBA 4NQZA 1TEZA 2H1HA 1FNSA 1FUYB 1Q7RA 2AQHA 2XCUA 5JAQA 3D8NA 3EZFA 3K71B 1IQRA 3W90A 3SVTA 4JBYA 4ZP1A 3HSYA 5EUMA 4WKNA 4Y6OA 5ITSA 4IRUB 5CCBA 3UUEA 2HMSA 3DZ8A 3WZ2A 4G5GA 1ZZEA 3FAKA 3GHHA 1VL1A 1E1MA 2GQ0A 4IO1A 3P9YA 3PGLA 1BS1A 4G81A 1P7CA 1T3SA 1C9MA 1P4HA 2P9QA 4OATA 2OV4A 3I2FA 1MJNA 1XLUA 2W6PA 4OQMA 3RS5A 2IHJA 2X6QA 4ZVPA 3PJFA 4LNUA 3IXLA 5TX7A 1FBNA 5HRUA 1HZJA 4MUFA 2WD9A 2NU9B 3LT4A 1JZQA 3AEZA 3FKJA 4IWNA 3GDFA 2X5JO 1NC1A 4KQMA 5IUNC 4B2PA 4DR7B 2WHQA 1TE2A 2DPLA 1YUBA 3JASB 3V8EA 1JIXA 3M81A 3DZGA 3Q15C 4Y0NA 2DCMA 3EXEB 3BMNA 4HXGA 4D92A 4CMJA 5FBWB 1BN6A 1ND5A 4JCCA 4GI7A 2ENWA 1MRZA 1JXIA 1KEPA 2VDUE 4M7RA 1TD1A 4X9XA 4ZEVA 5A06A 1X77A 5BNWA 1ZVVA 5EZQA 4GP9A 3DUWA 2XIJA 2GKSA 4RKRA 4KSBA 1FVHA 2UUBB 2C1ZA 2JZOA 2UZ1A 2H65A 1LQ2A 2YRXA 5K4GA 2ZIAA 1Y9AA 1BDHA 3GN1A 3F7TA 4G8CA 1XMQB 2A0FA 4X71A 1G1MA 1KDZA 1PZNA 5FUMA 4K0KB 1ZCZA 2WKSA 3GJ6A 1QR2A 2FXIA 1KDPA 1GKKA 4HWKA 2ZBFA 4M49A 3LE8A 1QFYA 3VSDA 2XWPA 1TD9A 1CUIA 3FFTA 4DA6A 1J25A 1J8QA 2DT5A 2G1AA 2PBLA 2ZIGA 5EKXA 5BVGB 5JUWA 4WKBA 5KQLA 3F5QA 5H81A 1KAMA 2QN8A 3G9TA 3KUDA 2XE7A 3L0SA 4DLRA 1XQXA 4YCCA 2D1QA 5C35A 2Q3CA 1YT5A 1NVGA 1Z5UA 1K6JA 2UDPA 3M1LA 4FMDB 2BE7A 4MROA 2H3HA 2ADOA 2ONCA 1KK3A 2QS9A 5EUBA 2QG4A 3STTA 3T95A 4BLWA 3KLOA 3TGLA 1NQAO 2VXOA 3RQXA 4C5LA 3E9MA 1S02A 3ML1A 4ZOLF 4Y7DA 2HRQA 4TL6A 5FTLA 1SCDA 3FZYA 3T5AA 1UPXA 4OVKA 1ECPA 3COZA 4U5QA 3JQFC 4ZREA 5EZ6B 1Z5GA 2AYZA 2EWWA 2P40A 4BOYA 1NLZA 1SBHA 2HRCA 2Z1DA 3A58B 1QBKC 1RLUA 1WA5A 1I1HA 4KZPA 1SH7A 4OGLA 2AEEA 1E69A 3MT7A 1CQIA 2BTEA 2H1FA 2YZNA 1BCRB 2I1LA 4TS1A 2VQEB 2KX7A 2OHJA 3ETLA 1P4JA 2AMLA 4I5EA 5EMMA 4I55B 4DPLA 3B1QA 5FDFA 4QDUA 3LDGA 3IAAA 3L4BC 4G4SO 1CHNA 3EAQA 4K9KA 3X2FA 1VIVA 4JLSA 1F3LA 4Y2RA 5BSEA 3STUA 3QZUA 1XUOA 4QELA 4QSMA 3U09A 4OA8A 4FM9A 4I1UA 3DEIA 3F6RA 2NPFA 1BA2A 3NCHA 4J0KA 5IJXA 5DO9A 3WGUA 3N8DA 4UM8B 2XUPA 5I7AA 4B82A 3IILA 5C32A 5EJ6A 4TX1A 4B2IA 2QWXA 2H8KA 1PBTA 4N18A 2BGWA 5CP8A 2P6MA 2R85A 2ZXFA 1HLPA 4CF4A 1EB9A 3GCWA 4BLPA 1U0LA 1Z06A 2IF2A 3JU3A 4HKTA 3TR0A 2ZVDA 3WNBA 2F6RA 5BQ5A 1NAIA 3EH1A 1HDGO 3RRFA 3W5VA 2IZ1A 2V1XA 2JARA 1UMDB 5ITVA 4KOEC 2F1KA 3NTUA 1FTQA 4OMDA 4NFYA 5THKA 3GQBA 4LBVA 4IJQA 2V55B 1U7PA 4KFSA 4BASA 4A15A 1T5OA 3GT4A 1HTBA 4N5DA 5K2MA 2DQSA 1DBRA 1YFKA 1K5DA 1KVRA 2P62A 3ZXIA 2FE4A 4NJMB 1IBCA 1X3SA 1SVLA 1UM9B 3E9RA 4O0LA 521PA 3UBMA 3FZNA 4S1IA 1Z82A 3VR4D 1FFYA 4BZXA 4AMGA 2BP7B 2HNKA 4X00A 2WM3A 3BAFA 3O90A 2AMFA 1XPOA 5FL3A 3WQBA 2HLZA 2OLKA 1KJ9A 1O77A 3RPEA 1D09A 3AFOA 2X13A 3OSUA 3ZS7A 2PM8A 4H6XA 3DZVA 4PG7A 4FDTA 1G8JA 1X7WA 1UOOA 2A1UA 3PITA 1RHMA 1CNEA 1WBJB 2QYHA 5KSPA 5I7EA 4JOBA 1O4WA 4P3YA 1MFPA 2FK7A 3DEYX 3ROPA 4B4VA 3ZV4A 4HPXB 3BHMA 1YC2A 3OPYI 3FF1A 2VH1A 3D7SA 3NDPA 1A4RA 1FB5A 4B85A 5C4IA 3OH8A 1ZGGA 1JGTA 2D1FA 2ODBA 1I01A 2Q4RA 2HCRA 1OI4A 4QHTA 1BQ4A 5JXIA 5EIXA 3K72B 2DBQA 1BH6A 3LO8A 2G8NA 1N2HA 4IGKA 4BFWA 1GIAA 3GJSA 4KR2A 1DC5A 2PKCA 2C99A 5TQ2A 1E0DA 1XEWY 1ECLA 4CQMD 4HAWA 1JDZA 4IH9A 4DYVA 1GM5A 2ECPA 3AJ9A 3NTLA 3DZFA 5I6DA 4RPGA 4BNFA 4MUMA 2QD5A 4REQA 4BMNA 4K6KA 3H4IA 5ES4B 4LF7B 2XUDA 1EXWA 2IPXA 3KE8A 3TCNA 2IHNA 5K8CA 3DL4A 2A9VA 2PUVA 16PKA 1QWOA 3NW9A 4PAMA 1J9EA 4LF4B 3CEJA 1Q19A 2QBYA 2JHFA 2V7TA 5CYOA 1C4WA 1IN8A 3P9SA 4JX8A 4ZOQI 3T54A 2ZZMA 2HLDD 1KOGA 3PGJA 4FS8A 4XB1A 4U9HS 3VI4B 1A9RA 1MV5A 2NUTB 5EKSA 4RH3A 4B8RA 1I51A 2C9ZA 3R20A 1DX4A 1BGVA 1DU4A 3HN7A 1AGRA 2EFHB 4RVOA 3LBYA 1RYMA 3FHLA 4Q02A 5DW0A 4YJ2A 2QRLA 2Y27A 3G68A 4D9BA 4ZYZA 4GEGA 3KO8A 5JCXA 3UK1A 1AU9A 5T3UA 2QA5A 3WYFA 1DXHA 1XDWA 1XIVA 3O91A 4LHEA 1ZMTA 4D0LB 2WMYA 5BUQA 2SICE 4LWPA 1RYBA 2ZVPX 2GRAA 2Y71A 3GCGA 2YJ6A 1DAHA 4OBBA 2IYRA 1OWLA 3OHSX 3CF4G 1X3LA 3KYBA 2DH5A 3GGSA 3ZQUA 4RTRA 3TMYA 1AQUA 5F78A 4WCVA 3X1JA 1CZKA 1XZCA 1TZMA 2XTAA 5H16A 2A67A 1JKJB 1WMEA 2QZ9A 3DP9A 1NMQA 2I33A 3HEBA 1Z15A 1U1CA 5EIAA 3SMQA 5F1OA 5JS1A 2R1VB 3IAM1 3KUUA 4NZOA 5DSTA 2JGDB 3W8DA 4IUDS 1I14A 1YB1A 3G89A 4CM8A 4HN4B 1O94C 2ZUFA 4JJGA 4RTNA 2YWFA 4RYDA 3VBCA 2P7IA 3D8SA 3UJCA 2EZTA 1W94A 4KO2S 1TYZA 2FWAA 3CZMA 1C1HA 3KJFA 1HYEA 3L6CA 4HZGA 4I5IA 3RQIA 1U7WA 2KB0A 4FR5A 4YLGA 2W2VA 3CLHA 3JQRA 3OOJA 4P7FA 2NOAA 3EQZA 4WJKB 3HXPA 3KCNA 3BDIA 1GN9A 1H05A 3ICVA 1CZNA 4FCTA 1DTWA 4URVR 4Q21A 5BYJA 4M83A 4BWFB 1V26A 4OLHA 2D6FA 4DT1A 4YXWA 4BC1A 4G1BA 5EVJA 2FPLA 4W99A 4MR9A 1EP3B 1GZUA 1HM5A 3W2TA 4B43A 1UFKA 4YEDA 5EQDA 2A6PA 5LZ7A 1P8AA 4Q7KA 2YMPA 1PTKA 1ML4A 4HNQA 3L8GA 4K6MA 3P0EA 4ZAXA 3D7MA 2PNJA 4KQFA 1T5HX 5E4JA 1OLSA 4CM9D 1C3LA 2OESA 4Y6LA 5LBIA 1N9ZA 2GM9A 2ZI5A 4M6WB 5HKOA 1IPFA 3LCRA 1VG9B 2V0CA 3LW8A 3BRCA 1Q16A 2QD4A 3PHLA 3TEMA 2WVHA 5DIFA 5DXFA 4MVJP 4QVGA 4G56A 5H9VA 5KVCA 4FUQA 2WUVA 3WLHA 4I50A 1B41A 3AHEA 4X41A 1AS2A 4BYGA 4C29A 3K5PA 5B4VA 3J81k 2JLVA 3C8UA 5JSZA 3BF5A 4IGFA 2IKQA 4QOJA 3FGOA 3IP1A 3VOSA 2BKVA 5AKKA 1PJSA 3M2PA 3MLAA 3PDWA 2QQFA 1FYDA 2B99A 2FNAA 3HSSA 3QUBA 2C3PA 3WLLA 2H1LA 4ETMA 3SSMA 5DJ5A 2GB4A 1GFSA 1XXHE 2AJTA 1Q0RA 2R5WA 1DOAA 1F8GA 4YRPA 2PQ6A 4LWZA 2WDZA 4I9FA 4A7PA 1X42A 4MULA 5JROA 4CVMA 2Q2QA 4ER0A 3KSAC 5MDHA 1OOEA 1OU0A 2WIDA 3HEAA 3KPJA 1LDYA 2QLNA 3I9NA 2RGGA 3TTSA 2VRWA 3C4JA 2GTPA 4AZ0B 1ADJA 1B00A 1UT5A 3GRKA 1U9JA 3CRVA 4R1MA 5A4KA 2J0UB 3ILVA 1ID8A 1JSCA 1SHKA 1IZ8A 3LBFA 2QN2A 1I5EA 2Z6VA 3AEUA 5BP7A 4ENRA 2HAEA 4ZPJA 4UW9A 4PHTA 4DE5A 2O2XA 1E2QA 4DMKA 3DB1A 3FRHA 4MCHA 1P1JA 4RHTA 1A8HA 2Y6UA 4IIXA 4QPNA 3HDHA 1GZ3A 3CEHA 5DTIA 5DT9A 1CYDA 5K0TA 3B9RA 2VTBB 3OOYA 2I1VB 3K16A 4RTJA 1LGYA 3OJCA 4U6QA 1XROA 3EFBA 4CV3A 5D3KA 1GQ2A 3DNPA 3SVLA 2C95A 1ZU5A 2R44A 4C0SA 1E0JA 2YTZA 4I5FA 3WB9A 1NW3A 1OT5A 3UGJA 4BN0A 3R0QA 4DXHA 1P80A 2Y3IA 1V4BA 4ZHQA 2JFVA 4FGSA 1U7XA 1Y3HA 1P6QA 1Z6GA 3KKLA 4L5YA 3DGFC 4OBXA 3TIIA 5JECA 1M1UA 3BREA 3QU9A 2FSFA 4JNKA 5ALSA 1TAHA 1JXAA 1AZLA 4UQOA 4PYJA 3KVYA 5TDHA 2A1IA 4DMFA 3HI4A 4FXPA 2B2XA 5DM1A 5FQNA 5CLIA 1H42A 3ITKA 4UE3S 3ZU6A 5ICCA 4GPAA 1XCBA 5IVKA 1ONBA 3P71T 1NLMA 3M33A 1LZLA 3ZR4B 1P6XA 2O3QA 4DPMA 2QRMA 1A71A 1YJQA 3P9IA 2IYTA 1UJ6A 2B7CA 4WN3A 3L5OA 4JJIA 3EA0A 4E30A 4XPIA 4K8CA 5TRWA 3CUYA 3IDSA 4JT4A 4TKLA 4DRYA 1RRFA 1YCFA 1KGSA 3J7TA 4JD5A 1JVBA 1W2WB 3OA2A 4O1MA 1Z75A 2XQGA 3GD7A 3GDWA 1N2ZA 3A3PA 3GF4A 3PQDA 1UFQA 4E07A 2ONKA 2VP3A 4U7GA 4MV1A 3GPLA 1XDZA 3IVCA 3WWPA 1O0SA 1OREA 1HE4A 1UXOA 1XZGA 4CIWA 4ZQCB 4BEJA 4F71A 4BRZA 2RMKA 4K6HA 4Q3KA 1UOEA 4QNNA 3WP0A 3QFSA 4L2IB 1IY2A 4XQGA 3TGWA 4A3SA 1EI9A 3O2NA 4CRWB 1S3IA 5KYUA 5C81A 1XTJA 2DWCA 4KYVA 3RTAA 4CL3A 1L5VA 3FX2A 4G0VA 3EASA 3PKZA 4MR8A 1I0LA 3ND5A 1X7DA 3QE4A 3QENA 1N92A 4X1YB 2XNKA 4OHOA 5AVKA 4YWHA 2VP5A 2ZS7A 3WB0A 4EFKA 4I4CA 4G5QA 3W2EA 4AN0A 3DV9A 3R5JA 4FI3C 3QPBA 2H7CA 4ZU6X 3EGVA 3A14A 3R8CA 3RS0A 3E03A 3KSZO 2I4MA 2GHTA 2QGFA 3LY8A 2PZBA 4S0ZA 5JZOA 3N2GA 5C1BA 1O7JA 4ND4A 1Y98A 2W37A 3ZHVA 1XRPA 3N0TA 5K3EA 2BV3A 1JTFA 3X44A 1C8VB 1JEJA 2JGJA 3DMRA 1SK8A 4KWIA 4P38A 5IM5A 4AG6A 4UDXX 4E69A 1QIKA 1VI5A 4RDIA 3NAZA 5GV8A 3IULA 4G37A 2WFAA 1ISSA 4ZV9A 1CUAA 2IGTA 2IP2A 4PAOA 5HFJA 1XDDA 2HSGA 3EXFA 3ZWBA 4KR3A 1NDUA 4QAQA 1KWGA 3OE7D 5CJPA 1W48A 2RDMA 3JWJA 3T5PA 1UOPA 2PMCA 1BHJA 2Q5IA 4NG5A 1A9YA 5LA6A 3LECA 1VSBA 3WNZA 2Q8NA 2WP8J 4XEHA 3CUVA 4IZIA 4G07A 1PWHA 4AUNA 3PSHA 1II0A 4RXTA 4OHBA 2CCGA 3REGA 1TF7A 1EWQA 2ZJYA 2PX0A 3T7CA 2QDKA 1B7GO 4UQPA 1M10A 1NBME 4FFOA 9MHTA 2J9XB 1AMNA 1FMLA 4KRYA 1IBMB 3ICCA 4ZA2A 1M2VA 2AEMA 2P0AA 4G4GA 1MO5A 4MVWA 4TYQA 1AGYA 3PF8A 1P4GA 1SUFA 2AXEA 3AEKA 3EA4A 3KTOA 4G0QA 3ZBPA 1LTQA 4F46A 1CB0A 3A31A 4M1KA 1MIOA 3MS7A 1FW6A 1I3CA 5CVDA 3ZZMA 4GAEA 5GQSA 5TEWA 3DOIA 1T34A 4LNUB 1QGUA 5DGDA 3AJEA 1VIYA 4I5DA 2GF2A 2BMFA 3A4LA 1EHCA 1ECCA 1L5FA 1Z13A 2BHRA 3F5FA 1N0UA 1DG9A 1M2OA 1RKUA 1KFJB 2GK7A 2I67A 3EBLA 3EWSA 3IA7A 2OQVA 4F86A 5TV2A 4NOLA 2P68A 2VH5R 2BRUC 2DVMA 2D2XA 3EFHA 1DPGA 2HT6A 4E5VA 3BMNB 4GU5A 1KH3A 2X9QA 3N8NA 3UT5A 5B7QA 4JB0A 3O9VA 3KQKA 5K0FA 1W0KD 4PYMA 2XR1A 4UHEA 4LXQA 2WILA 2V45A 1QTNA 2FCAA 2P9TA 2WTEA 4ZVUA 3OJEA 2HJGA 3PFHA 3TTTA 2ZYVX 2UZ1B 3O4FA 5NLLA 5HW0A 2K2QB 2RGNA 2E4VA 1ZIXA 3TW0A 2QVYX 1R8YA 2G9ZA 2F1IA 3DTNA 1G19A 3HKBA 3T0FA 1QS0A 4HMOA 3TZEA 1HO3A 1XLVA 5K51A 4HDRA 2Q50A 6Q21A 2ZKLA 1BE6A 3GH1A 4J3FA 1S2IA 4PYKA 3AF4A 3JPYA 5DASA 4ZVSA 2FW1A 4O2BB 4XSHA 5F5LA 4F5ZA 2XXBA 5UKDA 5KU1A 3I01A 4I1YA 1QMPA 1GTRA 3N0XA 2XMSA 2O8CA 3MXOA 3W9YA 5C8XA 1FRNA 1M8KA 2QM7A 5B57C 2CDCA 1XTQA 2GM5A 1JDBB 2J33A 4DANA 2VJPA 3LU1A 4IQGA 3BUSA 1XZNA 3G9QA 2IZOA 2NT3A 1ULTA 4YP5A 1NG9A 1KQ3A 3C1TA 3T9BA 4BPBA 2BHNA 3RJ5A 1GUZA 4MEBA 4RHCA 4LF8B 2IZ5A 2VCYA 3AQIA 4KACA 3ZH2A 3GPBA 3Q4GA 1EE9A 1P1IA 1P0MA 3OD1A 3JARA 3FVWA 1JQLB 2DUMA 3PXDA 5IYZF 3RFFA 4F4UA 2D2IA 1RRCA 1IN1A 1VRWA 2QLLA 3UWPA 2I54A 2J48A 3WWZA 3IVGA 1V1RA 3ILYA 1OA0A 1CQIB 2X40A 4MGIR 1RCTE 1T9AA 3K2EA 4FYIA 4K9LA 1QZZA 1MEOA 4CFZA 5DSXA 2NAPA 4AZVA 5FLEX 4DIKA 3MAAC 3C2QA 3B70A 4YMIA 1T2VA 2XGJA 1KYZA 2DQKA 2VYQA 5ENVA 3CNQS 3ZHQA 2O19A 2DE0X 2WHXA 2XUGA 4G4IA 4QECA 1CCWA 3LFTA 3B8EA 4RD6A 4BNJA 1FS6A 3A9VA 1WZCA 3MBKA 3OUUA 4X8FA 3RTEA 1CR2A 3S2IA 4WT7A 1VP9A 4JQSA 4KXVA 1CDZA 1WMBA 4NARA 3FLAA 2YHBA 4F3NA 2GTHA 1D6SA 1B6GA 4C88A 1FYVA 1GZSA 1YSCA 1NXSA 2FAXA 2QZ4A 4FDMA 4YV1A 4BHTA 4UC0A 3HBFA 4B8SA 4KJZA 4KAAA 2QE6A 1QRSA 5D87A 1U0TA 3L4SO 2ZAIA 1MB2A 2ZTUA 4QUDA 5EQFA 2TRSB 2XE6A 3MTBA 2Z2YA 4G26A 2D2EA 3GRUA 4TN1A 4UFOA 1W30A 1D4ZA 4OK5A 4EG6A 1UAAA 3EDOA 3QH4A 3GQBB 5K3AA 4Z4GA 1NNI1 1Y4SA 2ZIVB 4XGKA 1BKSB 1YZNA 2LW7A 2V5AA 2ZSBA 2YXEA 3TZQA 4PHCA 1RABA 1P7ZA 2DSNA 3L0BA 3OQ6A 5AJUA 3UMFA 2QTBA 2IS6A 1UB0A 2WMNB 1KO7A 1HDRA 2QTRA 3C1AA 3GT7A 5J58A 4NC9A 3VAAA 5BXQC 4D80A 4YAIA 1QQ6A 2WTMA 1XU4A 4QRHA 2OFFA 3HGMA 2EP5A 4LCJA 3RSLA 3RRNA 5BRAA 3V4FA 1LA2A 4ZYLA 5EIBD 5FAXA 1MF7A 1X7WB 2A1UB 3IESA 1OUMA 4EYEA 4XTCS 1OVGA 2HF9A 4HDMA 2NXCA 4RH1A 3D0KA 3UWKA 2FZ5A 4MV8A 1YD7A 3MNFA 1WLYA 1ZNXA 4AUMA 2NQ2C 5F4BA 5BSWA 1VKHA 4YUAA 3ONDA 1KDVA 4J0QA 3IVRA 1XHFA 1AF7A 3ANLA 1DC3A 2J32A 1EJ0A 2R8PA 4CTMA 1ZH2A 3C5EA 3NBVA 2V3CC 2RI6A 2XRFA 3D4PA 3S29A 5AJVB 3E9EA 2IHKA 3PNQA 3QGMA 4TV8A 4KTVE 2JG5A 4LDNA 3PR1A 3JQGA 4G67A 4I2VA 4RQTA 4UPDA 1K4MA 3TNFA 1KTIA 3A70A 5CXQA 1T25A 1HQKA 5TQ2B 3DFZA 4X66B 3SZOA 3ZDAA 2OSBA 3KDAA 1FUKA 1NUAA 2X3FA 3PU6A 4QX6A 4ES6A 3G2IA 1XZEA 1VFNA 2R60A 4JXZA 4U7TB 4YPVA 3OAAD 4REQB 4G9EA 3WA7A 1RP7A 1GA1A 3HPQA 4X8MA 1VOTA 4WVLA 1YA8A 4KDFA 5TY0A 3DKKA 2BR5A 2CJPA 4UARA 1SUDA 1YZLA 3WDKA 2FSHA 4NENA 1SPXA 3D0OA 2AFHA 2QBYB 4HRXA 3FI0A 5H7XA 2AVDA 3A11A 3HVKA 5KQPA 1BWPA 1E5XA 3G2QA 4BV9A 1A5AB 2CXHA 5CDGA 1EVKA 3BMQA 2FX5A 2QAGC 5TC4A 1SCUA 2DFLA 1H5UA 1XD8A 4RPJA 4ID9A 1XZ8A 3S6JA 3GRFA 3VTFA 2RG1A 3JXEA 4XOIA 4YJ2B 4LJYA 2Q5EA 1JJVA 3F8WA 3JRNA 1T2FA 1YVDA 3DMTC 3L0PA 3P0FA 3RKRA 4TVSA 2QZSA 2JD0A 4MS4A 5C7YA 1D6MA 2R5FA 2P9JA 3DQZA 1RQNA 2F1HA 4DGQA 4RJJA 3W5JA 3FZEA 2WICA 4L07A 3LOPA 1GC5A 4TXHA 3AH8A 1TF5A 3GFBA 4G6ZA 4DWWA 2JB9A 4LGCA 3DFIA 3F1KA 1Y3BE 3GPCA 3JVIA 1VA4A 1J7KA 3DPUA 4DM7A 1PHRA 3CPHA 4IIHA 1FP6A 1YBMA 2Z30A 2JIZD 5JWRA 4B3FX 3MT0A 2GKOA 2JBHA 2QVCA 2WWIA 3KWJA 4WY8A 4RHUA 3SOZA 4M2LA 4CM8B 4EUNA 4I2NA 2X2EA 3VR0A 2D4HA 2C0QA 2O2EA 1P77A 2WTAA 3HJNA 3GRRA 1L3CA 1NA5A 1Y6ZA 3BX1A 4C7MA 1TAGA 2UVQA 4WDQA 1HMYA 4L5IA 4YAFA 4ZVMA 3M6WA 3SIWA 1YA4A 2WF5A 3ABSB 3GGCA 4KYIB 3HCRA 2ZIZA 4QPPA 3NT2A 2C00A 4LG1A 4X8HA 3LZ6A 4Z8YA 2NZ8A 3QJGA 3NKFA 4B6SA 1DTWB 4C13A 3OZ7A 2JI4A 4F4JA 4KADA 4K93A 1Z45A 3GVCA 2II6A 3I6IA 2IV3A 3AUYA 5IN5A 4DT1B 1LIKA 3ND8A 1SUAA 1WD7A 2ZYUX 3ENKA 2DX7A 3I9FA 4HVAA 1N34B 4OYHA 4ALKA 1J4AA 4MR9B 1WP4A 4QU5A 4TXJA 3IBCA 3AK4A 2SHKA 2WYIA 2XQJA 2JL1A 3NB0A 1JQDA 5AKXA 4DQ0A 2DQYA 4DV5B 4HN2A 1DQRA 1JI3A 1M1XB 4FIZA 1UZUA 4AMYA 4PX3A 4OUKX 2O5CA 2VP9A 3DXXA 4KO1S 2W9XA 3ZWOA 1OLSB 4LYAA 4ZCIA 4US2R 5KOIA 1MAHA 1IIRA 1QHHA 3B1PA 3NHRA 4IHJA 4MO2A 1JH9A 4OJNA 3T4EA 4YCLA 3ROMA 4I50B 4NVRA 3A06A 1T2NA 5LSAA 1T5DX 4W5RA 2PGXA 2DFVA 5JSZB 1RT9A 5C4GB 4DV6B 1Y3IA 3SEZA 2Q27A 1N4AA 3TX6A 2BBSA 1E6UA 1YIAA 3DFKA 4ZVRA 1FSFA 2WKRA 1O5OA 3NTXA 4CIXA 3D0QA 3ZUPA 4FCWA 4GFDA 2RBCA 2DDWA 1V8ZA 1DP4A 1O08A 2JIBA 1QIJA 4ASUD 5L7TA 1S6YA 1NJ5A 3QKUA 3TPZA 1T0HB 1A77A 3C0KA 2A5DA 2YVLA 4JI4B 3BBLA 1NRIA 1NQ5A 2JAOA 2MSEB 3BDVA 2GZDA 2RAPA 2QX4A 4WBXC 2J07A 1T3LA 3KTDA 3OCUA 5JNWA 3D3QA 5FOVA 1GGJA 3NTQA 1P1BA 4IMRA 1XMOB 1YQXA 1H0SA 1NP3A 2HSEA 3M7IA 1DRJA 1SAYA 1UK9A 3GT0A 2RI0A 4YJKA 1NQTA 4J29A 2RARA 4JB8A 2VT6A 3O38A 1XZIA 3B3LA 3WICA 1POXA 1EK6A 2NN3C 4M86A 1I4TD 2B1IA 2QU8A 2ZBEA 2FMIA 2YOGA 3AEUB 3KOUA 4B6QA 4IDOA 4RTMA 3H49A 2PZFA 4LXUA 1DJPA 4L8FA 1I7NA 4J7UA 5KYWA 4OG2A 4IYJA 4MIOA 1E1QA 2OFOA 8LDHA 5IRCD 2EFYA 2OQIA 4MWCA 3MOGA 4JHLA 4F9EA 1KJQA 3A4NA 3T3HA 3W06A 1DHTA 2H0QA 1QJ4A 4ZFNA 1U94A 1DV1A 1RKAA 3KSRA 1U8ZA 5KAMA 1KP2A 3O93A 4PNPA 3WLIA 5IC4A 1XHEA 2PMDA 3B6MA 2EFCB 3GJYA 3T7TA 4C0KA 3DZDA 1DJMA 4AURA 4MI9A 3ZHBA 4JZYA 2V7QD 2AN3A 4XYMA 1FU4A 5EWLA 2XJ4A 4FS3A 2PX6A 1GLNA 4EY7A 1HDYA 1UMBA 1YS6A 5FD8A 4HMQA 1AY0A 4MVJH 4DCGA 3RT1A 2PEYA 4MIYA 3RUPA 4ZHQB 1ZWKA 1HKUA 4FGKA 1ZGCA 4F11A 2QAJA 1ZD4A 3WB1A 2FX3A 1T43A 2IYZA 1L4EA 1HQCA 3QTBA 3ZCVA 1OX5A 3BF8A 2MYPA 4KUGA 1GNPA 4UBMA 1XZJA 2GPJA 4FBMA 1ZMOA 2FE1A 4WUTA 4MCIA 5K0GA 1L8AA 1G8HA 4KEAA 4QFMA 3RUFA 1GO2A 3L8CA 1ZICA 4GKAA 4LDAA 1H0KA 2A94A 1JHOA 3N6RA 4IDAA 2P9CA 1L8OA 3C7KA 2JIDA 2BW0A 1KK1A 1U8AA 3C7AA 3F3YA 4CKWA 4CKYA 1LI5A 1I36A 2Y92A 3C3MA 4HQFA 4XPIB 1M8PA 3K0FA 1ISJA 4YFVA 1M67A 2X0NA 3UG6A 3UH1A 4EA7A 5L3QA 3QP9A 4LYFA 1ZEMA 2M6SA 2J5KA 4P53A 4CMCA 2H4HA 3L1KA 5F52A 5AM3A 3HB9A