3RSSA

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima soaked with nadp
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
494
structure length
494
Chain Sequence
HHHHHMKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords Putative uncharacterized protein
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 182
structure length 494
sequence length 494
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rssA01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3rssA02
4KANA 3LOOA 1TZ3A 3RREA 3RQXA 3LJSA 4O1LA 3RU3A 4JKUA 2I6BA 3ROGA 2ABQA 4C5NA 5C40A 2PKFA 4K8KA 3RTCA 2PKKA 4YL5A 3RTEA 2C49A 3CQDA 3GO7A 5TQIA 3GBUA 3JULA 2ABSA 2F7KA 3K5WA 1YGJA 4E8WA 5BYEA 4LBXA 2A9ZA 3RY7A 5F0ZA 3VAQA 1VK4A 5COJA 1GC5A 1RK2A 2C4EA 3B1QA 5C3YA 2YXTA 3ROEA 4DC3A 5C41A 1C3QA 2VARA 1RKAA 1VI9A 5BYDA 4LC4A 1JZTA 5CGAA 4EUMA 3KTNA 1LIKA 2QCVA 4KALA 1BX4A 1UA4A 2XTBA 4UBEA 4PVVA 2QHPA 3QAIA 4K9CA 3MBHA 3UMOA 4S1HA 2AJRA 3LHXA 3RO4A 2NWHA 3RRFA 3RTAA 3PL2A 4KADA 2DDOA 3RQ2A 3VASA 1WYEA 1LHPA 1V1BA 2JG1A 3RPHA 3K9EA 4EN4A 4XDAA 4JKSA 3IBQA 3B1NA 2Q5RA 3MBJA 5EY7A 1RFUA 2R3BA 3KEUA 3RTGA 2DG2A 1DGMA 1U2XA 2HLZA 3NC9A 1RKSA 3PZSA 4U7XA 4XCKA 3RSSA 4K8CA 3RQQA 3NBVA 2RBCA 3RM5A 3ZS7A 3FHXA 3RRJA 1ESQA 3OTXA 4XF7A 4B8SA 4X8FA 3RQ8A 1V1AA 3UQ9A 1RKDA 3RQ6A 4JJPA 4WJMA 1LHRA 2JG5A 3KD6A 1LIJA 4E84A 1RFTA 2DDWA 3RQ5A 3RPZA 5EYNA 3IN1A 4YWRA 2AA0A 5BYFA 3UQEA 1VM7A 1KYHA 3D3JA 1V19A 2I6AA 3NBWA 2DCNA 3NC2A 3B1PA 3B1RA 3H74A 4S1MA 4EOHA 4C5MA 2FV7A 3RU2A 2F02A 4O1GA 1LIIA 4S1IA 5TRWA 2A9YA 2HQQA 3DRWA 5F11A 3H49A 3KZHA 3RT7A 3I3YA 4N08A 5B6AA 3EWMA 1ESJA 5CGEA 2YXUA 3RTBA 1L2LA 1LIOA 3B1OA 1YGKA 3LKIA 3UBOA 2AWDA 3RTDA 2AFBA 3HPDA 3NL6A 4GM6A 2I5BA 4E3AA 3NM1A 3FHYA 3RQHA 4E8YA 4KBEA 2O8NA 4K9IA 3Q1YA 1TYYA 2JGVA 3ROZA 3NCAA 3UMPA 1JXHA 2V78A 3RO7A 3RS9A 3RSFA 3RNOA 3BF5A 4K93A 4K8TA 2PKMA 2DDMA 4EBUA 4XF6A 3UQ6A 3N1CA 4LBGA 2AX3A 1UB0A 3IQ0A 3UQDA 3QA2A 4E8ZA 2PKNA 2AB8A 3RRBA 4C5JA 5C3ZA 1EKQA 1TZ6A 3NL5A 3HYOA 3RSQA 1V1SA 3Q92A 4LCAA 3HICA 1YHJA 3IE7A 3B3LA 3NL2A 2HW1A 5BYCA 3NM3A 1RFVA 4KAHA 4S1IB 3RS8A 1TD2A 3NL3A 4B8RA 4DU5A 3RT9A 2AJPA 1JXIA 2R3EA 3GO6A 3IKHA 3W4SA 3DZVA 3IH0A 4K8PA 3ROXA 3RSGA 4C5KA 4C5LA 5CM5A 4E69A 4N09A 1GQTA 1EKKA 3D3KA 3BGKA
chains in the Genus database with same CATH superfamily
3AR4A 4J16A 5TPZA 3I62A 3Q9LA 2HPHA 1JYSA 3PXBA 2PH7A 2BJWA 2OV6A 3MQ4A 4CMHA 4E3ZA 1E7SA 2MMGA 3Q3GE 4ALMA 1QNFA 1UR5A 4N7MA 1IK4A 1J21A 3LC2O 4QQRA 3UW1A 3WLNA 3X44A 4A8HA 1T1JA 4FIDA 1XBTA 1HO3A 2AEFA 4JBGA 4RV9A 4ZQEA 5B1DA 4IIVA 3WFIA 1XNRB 2NTJA 1WSAA 3FUWA 4J4BA 5CURA 7YASA 1ZC3A 4XQGA 4BFCA 3FHTA 3SF8A 4MAMA 4YQZA 2GCIA 5CG1A 3LCCA 4F5WA 1M73E 2JLCA 3MJVA 2NVOA 3QNUA 4RV4A 3UMMA 4PQFA 4QU5A 4Q66C 5TQ0A 5FPHA 4G0WA 1L1FA 1BC5A 3BL5A 1HT2E 2CVQA 2GGSA 3DKRA 3CUVA 3KQTA 3STVA 2FX3A 4BMPB 5JAOA 5IAOA 2YVLA 1H4TA 4RF2A 2PY6A 3KKEA 2PYZA 4MYDA 3UHAA 4Z3OA 1BDHA 5EKSA 1H9CA 2R87A 5KWVA 1HOXA 4OJYA 1Z75A 4IO1A 5AW5A 5EPEA 1CQIA 5EFOA 1W73A 1E2UA 1Y80A 3PDIB 4TS3A 3RTAA 2NTVA 2QZJA 2PO7A 2JCSA 2EP5A 1JKIA 4TMYA 2JIRA 3FIUA 4MRNA 5A02A 1T36B 1TF2A 2X8LA 1XDZA 3PX7A 1UBMS 1ZJYA 1LVHA 2XRYA 3C97A 3IDOA 2ZITA 1X9GA 2I34A 3TSOA 1EAMA 3TSCA 2A6PA 1RAFA 1R5JA 2AK3A 3KJQA 3D43A 5F5NA 2YXPX 4U7JA 4XVHA 2BM0A 4DMCA 2QVBA 3L6CA 2HTFA 2XJ9A 3GR6A 4MW0A 3VO9A 4MYTA 5LA6A 4DLZA 3KOZA 5AVJA 6REQA 3MOSA 1E20A 2HOQA 4HF7A 1QS0A 3H1BA 5SZJA 3IAFA 2CMHA 1PWEA 4KQHA 1ORDA 4DT1A 4JROA 3B70A 3ZLUA 4F3TA 4BNKA 1L5WA 2G1PA 2XB8A 5DWDA 1QIEA 2CXPA 3MYRA 3NIDB 3J7AC 4IIUA 4QD3A 3BJIC 4UUMA 2LCQA 2G08A 4OI0A 1U8XX 5EJAA 1O96A 3V6MA 4M87A 2JGNA 1OLUB 1QH1A 4I1RA 4FCWA 3VR6D 3ZNQA 1PT8A 1A9ZA 4V1CA 2AUMA 3HL4A 4PFKA 3TQSA 5K0BA 5EMMA 5K03A 1L2LA 1U0FA 2W6QA 2QRVA 1NUAA 1XDUA 1CRLA 1SUBA 2J87A 1RACA 2Q07A 1YA8A 2ST1A 3G23A 3HPQA 3AGPA 5LZ7A 3WGOA 5FWYA 2FMTA 2ENUA 2PLNA 1N2CB 1HNXB 4V38A 3O1LA 2FSGA 2PKQO 4P4SB 4TKVA 5EJ6A 2PL3A 4BLRA 5CHYA 5BO5A 3T7JA 3HBNA 3HFJA 1D6MA 1P2SA 1HLFA 2PZMA 1SKYB 2Q41A 1P7ZA 4HUJA 4ENUA 3ICEA 3RRBA 1Q6YA 5GGXA 4CFYA 2FVXA 2PH5A 4N7RA 4FZJA 5PGMA 1XA0A 3PUZA 2CF5A 5F51A 1JG3A 4IS2A 1KMHB 2GFQA 2HRBA 2N3ZA 3JVEA 3OT1B 1NVXQ 4D5GA 4RD2A 3RAPR 2QENA 4JJ4A 4BMCA 1E3LA 3NUQA 2JIMA 1KJ9A 1QQ6A 3TZKA 3NLLA 1DQNA 3VR0A 5JHHB 4RCZA 5KX5A 1E4EB 4KX5A 4LSZA 1CERA 4AJJA 3U56A 2XT9A 1SA0B 2QG6A 3WS7A 3RJ5A 3CZAA 1B16A 4NATA 2WIFA 3CE9A 4YDQA 3ADKA 1JDBC 2VHWA 4C0WA 1I4DD 3AG5A 2ZJYA 1MB9A 3B36A 3GFPA 4QUIA 4F4HA 4PFSA 1NP7A 3VPSA 5J9FA 1NXTA 2WE8A 3M6AA 4AP9A 5TGTA 4OLJA 1G8PA 5DOZA 2FJPA 3V3KA 3D0RA 2CB9A 4PHTA 3TAXA 5KJCA 3EH1A 1T9ZA 3TFOA 2OLEA 2O8FB 2JIZD 4JC0A 5B2ZA 2Y68A 3KOUA 4DQXA 1FJHA 4UUAA 4W6ZA 2FSFA 5C3YA 5IXYA 4B71A 2VLBA 3MB5A 3CKKA 4JSTA 3SDZA 2IH5A 5B1HA 4ECAA 4IDDA 4WNAB 4ASUD 4P36A 3ZX4A 3GT4A 4ZHQB 5KYTA 1JIXA 1HK7A 3NDBB 1CUEA 1XCGB 2CJPA 3M9WA 4G6ZA 5BRAA 5THXA 1TAQA 1FX0B 2NSLA 1UBLS 3I34X 1Y3DE 3ZLBA 4PZ0A 3H84A 4KH0A 3I8SA 4OBEA 1CNMA 2J9GA 1RYMA 2HLHA 1TJ3A 3URKA 4ZVNA 3SVZA 3N2KA 3U40A 4FNGA 1V4NA 3OEHA 5JS8A 1QH9A 2X7JA 3QLVA 3LKVA 3ZLTA 2G5TA 3DOJA 5K0JA 4Q3DA 3TLYA 3SR0A 3ZX5A 1VL5A 1ZRSA 4NMXB 4A8TA 3CUTA 3LUFA 3PNOA 2ONCA 3E9YA 3C6MA 3W3AA 3BQ9A 4MTLA 4OJQA 3U9TA 1BFDA 1CUWA 2A0UA 5I9TA 1QDEA 2PVSA 5JT1A 4AJIA 1E7YA 2AOXA 3ICCA 4WINA 4Z8XA 5JO9A 1TAUA 1K6EA 3T8YA 3I6MA 2YOHA 3ND5A 1CZHA 5SZIA 2WMDA 1DKLA 4TV8B 4GLLA 4DNPA 1T0UA 2EVWX 1QTNA 1X7GA 4DIEA 1QOZA 3TE6A 4CIXA 2DR3A 1SVOA 3ZGZA 1HKHA 4IICA 2BGLA 1BU8A 3MHTA 1B6GA 4OUDB 1AMNA 1XLTA 1HQDA 3OCVA 4NZPA 4JZYA 1WUTA 3MK31 4LTMA 4DYVA 3E2PA 3NL6A 5E6UB 4IXWA 3I1YA 4K6OA 3C8MA 4N3BA 5G4LA 3V97A 2PWZA 4DSAA 5IN4A 2X86A 3OX1A 4EFNA 1L8LA 1ODJA 3RS9A 4QT4A 4HGZA 4L72A 3TCKA 2DDMA 2R4TA 3CZRA 4YROA 4RYLA 3PNMA 4ZYZA 4ARVA 4KC0A 5FFFA 5C1BA 3U4QA 1D4FA 4OOFA 1CQPA 4ML3A 2Y8EA 1US8A 3AKYA 4ANFA 3NL5A 4TWJA 1G7CA 2IPNA 3EVTA 5EINA 4DADA 1ETHA 1OR8A 4UTZA 1B00A 1XZGA 4WAUA 5L3ZA 1PZMA 3K0KA 3L0SA 3NASA 1NP3A 2EL7A 3L7NA 3OCUA 4NYIQ 4ZCMA 1ZU5A 1I13A 2OXEA 4RDHA 1NMXA 2P3QA 1RXWA 3H6GA 4N03A 2IDMA 5CLGA 3RT9A 4R2JA 1AXRA 4IIXA 1JMYA 3NWEA 1CY2A 5BYBA 1O5ZA 5EEHA 1KDRA 3SICE 3QX8A 1MO6A 3OOJA 4HTFB 5CCXA 4HNVA 1N4DA 4P2BA 3LXXA 3D4PA 1DKRA 3T15A 1GQTA 5E4YA 1WHSB 1J2JA 4N0PA 2V7BA 3KLPX 1GRNA 4OGGA 5F9HA 1HEYA 1RABA 2CVFA 2GCOA 4IYRA 2FSUA 5HEKA 3G2NA 3RSCA 1DBPA 4XE5A 3SJAA 4JQOA 3KOXA 3VNAA 1XB2A 3N0RA 4M6WA 2NO1A 5FBLB 1F06A 3OPYA 4TZKA 2VYND 4J7XA 1A2KC 4BQFA 3IEKA 4HXYA 1RQ2A 2WTBA 3F2VA 1IXYA 4EP1A 2BGKA 4KB5A 3QSGA 3MCVA 4AMYA 5BUZA 2PUCA 1SG6A 4QJ5A 2GEFA 4N5NA 1JRLA 1AE1A 4M8NE 5IFKA 1XVIA 3ZZMA 3L3BA 1DLIA 5L7TA 3IAXA 3R24A 4U2BA 3WAGA 3RWOA 2NTEA 2VYFA 5HKAA 1UEIA 1VCIA 3DDHA 3OPQA 4JLBA 3TLJA 3DHVA 4RTJA 2ODNA 3M70A 5L4SA 5B4UA 1JLMA 1GG8A 3GRZA 3Q88A 4UHBA 3TPZA 4MNTA 1D0VA 2BGUA 3AI1A 1GPH1 4N49A 3WIOA 3BH0A 3C45A 3NEJA 3CURA 2WIJA 2NXJA 1ZY2A 3H86A 4UM8B 5CK5A 3RAJA 5JRDS 5KTPA 1PG2A 1YCHA 4AKEA 3OTGA 2P11A 4YMUA 2CJWA 4O2BA 2Z6AA 3PGKA 3QWAA 3M6XA 2ALJA 2WF6A 4J94A 1W8DA 3U3KA 3QWFA 4KR3A 2C42A 3A9VA 2FPKA 5CA0A 3FHXA 3BZWA 1IHDA 3KKLA 1QGDA 2P9BA 1NYQA 2ADOA 3P32A 5JAUA 2G0NA 1G55A 4JBYA 4LJSA 3K0FB 3PD1A 1C8BA 2QM7A 3EJWA 5FR1A 3OZTA 4FFNA 5F5XA 3ZUGA 2QTWB 4HDNA 3FYUC 4Z6KA 3FAZA 2WTAA 2IOYA 2JCYA 3FCSB 1F2TA 1WL8A 3SY8A 3EOZA 4LXQA 3G79A 5K51A 4S1MA 3TZCA 4Y2RA 3T38A 1IC6A 4GP9A 4XCXA 4A10A 2QN8A 1JMKC 4IWYA 4IPTA 4EGFA 3G7NA 1FDIA 5B6PA 4XB2A 4DZRA 4OK6A 3O94A 4DMMA 4YECA 3QVUA 3RTBA 3SYTA 5DIFA 2WWTA 3A2LA 4HYQA 5CIQA 3ASVA 5ILOA 5IASA 3H5VA 5DXFA 1CNFA 2QM8A 5ITZA 1TD1A 2CYAA 3LTEA 3LX6A 4R1TA 4V2UA 5ETJA 1A7JA 4DBLE 4GBED 1JEOA 5IANA 1K5DA 3DDOA 4GXTA 4X64B 4BHTA 3LLSA 1DEXA 3E53A 4QOJA 1JEJA 3ZI4A 3GPBA 1QK5A 1SCIA 3IUJA 3L0PA 5CX1A 1FP4B 4NV3A 1JEAA 1QRSA 3HICA 5K8LA 4NQZA 1OI4A 1YU9A 5CH3A 4WTOA 3SEQA 3UYLA 3PXDA 1VE5A 2HWKA 3EG9B 5DP2A 1YCDA 3LUPA 5AJXA 2FEXA 4LBYA 3WK5A 4LJRA 1GUFA 4GKJB 4GECA 5B7QA 1H2HA 1NWCA 1W6UA 1R0RE 4KTVE 3V8EA 5IYZA 5LZ9A 1XSEA 3BBLA 3TOVA 1K89A 4ZTBA 1K8RA 4B48A 4BAUA 3PGXA 1BXKA 1X7ZB 2GYWA 3GB9A 1VJ1A 1YDFA 5JNUA 5D84A 3TLGB 1GPWB 1XWIA 3KQLA 1FJ2A 1IBRA 1K6JA 1PR2A 3MGAA 4MWEA 1ZH0A 2VT3A 2QOEA 1SULA 1RZUA 3OQBA 2WJHA 1E1RD 3SD7A 3WTBA 1SAYA 1FSSA 1QCCA 5ESXA 4PAGA 2RAPA 3VO1A 3KEMA 3HUDA 3UFXB 3JAMA 5ERGB 2EG9A 4L02A 2HGZA 1ZNWA 5GZ6A 3THXB 2OC9A 4YVFA 2GJ9A 3IPCA 4NE9A 4TQUS 1QJCA 3ETDA 3OURA 4QPDA 3A6EA 4E12A 2XMQA 1RWOA 4MW5A 3X1ZA 1M1NB 1KR2A 4BWFB 2VYQA 3QWBA 3BSWA 4FN5A 3O3MB 5EZ6B 5AVKA 1IB6A 4RD1A 3TW6A 2VARA 2IJGX 3WFJA 4JQCA 4I9GA 3IQXA 3T7TA 5A6SA 1F0PA 2VOEA 3EY9A 1EUYA 1LIKA 1THGA 1T5DX 2V3VA 2ZRQA 2VXOA 1HEUA 3HCEA 3EA0A 3IOBA 1CLEA 1EX7A 4AKSA 4BVBA 3DAHA 1CR6A 2OO7A 1SU6A 3KQWA 4PO9A 4PWZA 4I5IA 1MJ5A 2FN4A 4G1BA 1PR9A 1XQ9A 4BU1A 1VMEA 5CNJA 1D1TA 1Z26A 3EIWA 3VPCA 1KP2A 2ETXA 2DWCA 3Q4GA 4FN4A 4HO1X 3ER9A 1RJ9A 1ML3A 3KTFA 4DJEC 3CF6R 3RCBA 3IR5A 1QM5A 3IQWA 1GV1A 4YUAA 3T7CA 3BTVA 2ZAIA 3UBMA 3EMVA 1SFRA 2CNWA 2ICAA 2BP7A 4XWTA 2ATXA 3OLZA 4J0DA 3PNBA 4GMKA 1GTL1 2C61A 1V1MB 3HY6A 3QUCA 1QYIA 4HUTA 3K4QA 5LNK1 1C0LA 5G02A 1P3Y1 3ZU4A 1L1EA 1QORA 4I4TB 1ISPA 2P4SA 4JA0A 5CVEA 3V8RA 4AWBA 1N3BA 2C97A 1JQ5A 1S7GA 2IOFA 1EH5A 4L0MA 2NOAA 3ANNA 4H3HB 3ZDQA 4DA8A 1CWUA 4Z4FA 1FY2A 2XGOA 1V3QE 3MTAA 4G0UA 4M0FA 2OBMA 3OA0A 2WAYA 1U9IA 2UZ1A 3OUTA 3UG7A 4BEBA 3MINB 1H0RA 2K2WA 3VYSB 4E0BA 1QP0A 3LDFA 4LYFA 1DKNA 1TPYA 3C3WA 3BPSA 4B75A 2EHJA 2ZRAA 5I48A 4DCVA 5A5GA 2I3BA 1U4SA 2AXQA 3PJGA 4TLBA 2VZ0A 4EMTA 3QM1A 1MOSA 4R83A 4DR6B 2LR0A 3IILA 1EFPA 1HE1C 3O4VA 4OBXA 3NHLA 5BOVA 4MWSA 2PSHA 1JIIA 2N46A 2VI5A 3C3CA 3FLAA 3INNA 3PUXA 4WKBA 3RRXA 3PWZA 2D5AA 5JBQA 1WF6A 3BK1A 3LHKA 1Z28A 4P7BA 3K8QA 2ZYGA 4L0CA 4YRGA 4L4ZA 2WG2A 3TTWA 2P77A 2ZRIA 4G37A 1QIDA 4PZAA 3UK0A 5KNBH 3AWIA 4X20B 2QRMA 2QUBA 4OPMA 3EXFB 4WD3A 4WV3A 4BKRA 3OIWA 1R8SA 3RSZA 1DO0A 1AQLA 2D1YA 2O6LA 3I9KA 4NHOA 4BKOA 3UPTA 4IDGA 4CM8A 1NUSA 1P9NA 2IODA 1HSZA 5G2OA 1GY8A 2COEA 3MOGA 4ZDJA 2ZB7A 5CA1A 2C9CA 3E8MA 2QXUA 4M1TA 5D6OA 1NVTA 3PRJA 1PL8A 4KQCA 4MS1B 5T64A 1HDCA 3L4JA 5ALVA 3PX2A 2QJOA 4UW9A 1KOLA 1L5NA 4DIUA 3AI2A 3HKDB 2DE0X 4ZGBA 1YQ9A 3LQFA 4D4LA 1NN5A 3EDMA 2LKDA 2A33A 3RTEA 2PKKA 2FXIA 1O94D 1BU5A 4N3NA 1T1IA 4C4AA 3A37A 3NBYC 4Q4JA 1P1RA 3ELDA 4XW2A 1SQ5A 3BAFA 4P86A 4ZV4A 1UDCA 2N42A 3FCUB 3RFFA 3AR8A 3I52A 2PUDA 3AF2A 1AQIA 4R2KA 3CZ4A 3NHAA 4K5QA 2XQKA 3KSUA 3OLXA 3SXUB 5CXXA 1EM8B 3I04M 1QH8B 3K9WA 3OBIA 4KUGA 4AZTA 5GTDA 4DLWA 1ZZEA 3QEAZ 4KR7A 3CZPA 1UEXC 1II8A 3WMWA 5LP6A 3WGNA 2O1WA 3RVOA 2A4MA 4J0IA 1OAAA 4LN1A 1CJSA 2X4DA 3NFYA 3QKSA 4IJMA 3S44A 2CUNA 4KXWA 2FPGB 1VE7A 2B4TO 4FYHA 3TR0A 4ARZB 2ZBUA 4JSRA 1M2HA 4MKGA 1Z6QA 4PLVA 4D4MA 2C2HA 5IXJA 1JHVA 1C3OA 1KARA 1UPFA 3B38A 3C7DB 3FOBA 4CG2A 5H81A 3PR1A 2J30A 2J4FA 2WUEA 5GVSA 2AF3C 1P73A 2OM2A 2Z8YM 3Q6NA 4PRYA 3AV0B 4KEAA 4EPVA 2ZJ3A 2H1OA 4BRWA 1QU3A 2VWPA 2E6KA 3S3TA 2NUPB 4Z51A 4D9MA 4IQFA 1ZUWA 2MSEB 5E7MA 3R76A 3RFCA 3GY0A 4ZEVA 4FHZA 1P4AA 4LC0A 2PUVA 3AGQA 4LRXA 2PRJA 1HNNA 1R1DA 4XKJA 1DAOA 4HY3A 3EHEA 1U2ZA 4RIFA 4P34A 5WRFA 2H18A 4X1OA 1A7KA 3ZQKA 3OSZA 4R01A 1T3ZA 5C8YF 2O8DB 1G66A 1GNRA 2D2XA 3PWKA 2FW7A 5KVQA 6Q21A 3QX9A 4LBWA 4TS4A 2GARA 1N5MA 3W3ZB 2AXNA 2JD2A 4DR4B 1E8CA 2YWJA 4E7OA 3U4MA 4L50A 1XXLA 4BN0A 2V55B 5EZYB 3W4IA 1P2GA 2XWPA 3TYXA 3B6MA 5KS2A 2C58A 1HXHA 2FWNA 2HJWA 3LZDA 4Q4AB 3S1AB 3WZLA 1IBLB 4JLMA 1USIA 3MMZA 1BXZA 3A9TA 4C7VA 1KAQA 2X41A 4EHKA 3EGDA 4UD2A 2QQ0A 3COWA 2FW1A 4G65A 4PHCA 3DUFA 4RYDA 5ENDA 5CDYA 3GJ3A 1TIKA 4I5FA 3RNOA 4JP2A 2GM3A 1D5WA 1EKXA 3UKOA 3ESDA 3ZJ4A 4C0JA 3ZE8A 1LDGA 1KO1A 1QYVA 3I04A 1RW4A 1CSEE 3AIOA 3GCXA 4YFVA 2CEKA 2WJWA 3FKJA 4JBWA 2FQQA 4WK4B 4JA2A 3E5NA 4X1IB 3ZY3A 5JQWA 1HYHA 4DR1B 4FYVA 4P38A 4BAZA 2QTVB 2FQYA 4X41A 4BWYA 3FNQA 1YXMA 1DKMA 2NMVA 3BH7A 4P5EA 2CDBA 3S2IA 3AM5A 3DVAB 3L0CA 3RRZA 2HMUA 3ESYA 3IDFA 4DBVO 3ROKA 3Q8KA 1Z0ZA 2ZSAA 5BN3A 3ROXA 6GPBA 1B6SA 3UA4A 1H3EA 2Z8YA 2Y1WA 2A84A 4PPYA 5KU7A 3FKQA 1V6AA 3PHJA 3THWB 1R4AA 4Y98A 5KNCD 1EUZA 4C4RA 4A36A 3KT0A 3IPRA 5C40A 2YRWA 5EUCA 4L5IA 1RC1A 3NUZA 2CL5A 4EG4A 2Q3FA 4RF4A 3TIIA 4OB8A 3AHJA 1IN6A 3KB1A 2A0KA 3T3HA 1JB9A 2ARKA 3DLBA 3T3IA 4JVSB 4X6XA 5FOVA 1W4RA 4ZRDA 1ES9A 4RHYA 2I87A 3HVUA 2VPWA 1NOKA 1PJ8A 2QMQA 4L6AA 5DVZA 2ZLBA 3FWZA 3HUTA 4YGXB 4EHLA 2V0NA 4EHDA 2O50A 3EXIB 5I7AA 2CY0A 4A1FA 2A1TR 1IEQA 1CF9A 1E2FA 1V5FA 4P7GA 4CQJA 2AN5A 1PP4A 4MA5A 1EBUA 1U8ZA 1EE9A 1QGED 4KV7A 4ZQFA 1N3YA 3M89A 2Q0HA 3BGOS 4ZAWA 1PQ4A 4CM4B 5AQEA 3R3JA 3TRFA 3TTSA 2YJ6A 1P72A 2DYKA 1JAHA 3KT8A 1TM2A 4P32A 4X71A 3WIVA 2VQSA 3P9NA 3H2GA 5IMBA 4AQ7A 2H3EA 4HDRA 3ZGVA 2Y0BA 3AW9A 4LJLA 3VISA 2AOUB 1PX2A 4WOCA 4QYIB 5T57A 1ZHHA 1UM8A 3TAHA 1K63A 2GEJA 4WESA 5F12A 3D7KA 4YBRA 1W2WB 3NGXA 3CEJA 1W88A 3VI3B 5TX7A 4TMXA 3VDXA 1MEOA 4M86A 5KYVA 1FW6A 4CLDA 1RQGA 2Q4BA 5KDOA 1O0CA 4J0KA 3GEPA 3A26A 3UQEA 1UKYA 1FDVA 3IUBA 3LK6A 2I6AA 1OLSB 2XNDA 3BTUA 4WNYA 4YIHA 4CW7A 4HEA1 2QEQA 3QI7A 4YJFB 3B1PA 4KPUA 2FV7A 1X8KA 3QFTA 3LAWA 3R09A 4BMZA 5H8WA 2W58A 4JKYA 4OGLA 3W34A 2X5XA 1HF3A 3HYRA 1DC7A 4NHEA 4AG3A 5IF9A 3CBGA 2C4NA 1PG0A 4YLGA 1DXOA 1DLJA 4XWYA 1X3LA 2EG5A 2IU4A 1NI5A 2QYSA 3FZEA 3PUJA 3V4OA 3ZWXA 1OSNA 5E4JA 4H77A 2GXSA 2UYOA 4ZJZA 2GTIA 2GA9A 2QRUA 3EAFA 4ZU3A 3U49A 1SOWA 4K9IA 2NUAB 4X7PA 2CJYA 1EK6A 4KN8A 3GZNB 4IL5A 5K3CA 3V4FA 1WM1A 1V37A 4NMWA 2E6UX 1TC1A 5K3DA 3BB4A 2W71A 2K7ZA 1DFIA 4E51A 2ZYWX 3L0IB 3PLNA 2FU5C 2H7CA 3AHGA 2OESA 1HT3A 2AFIA 4YI5A 1ZXXA 3L43A 4U3JA 4B3TB 3OIFA 1GDTA 3NKLA 2XE8A 1MB4A 1TFUA 2AI1A 2H2IA 1DHTA 3DMNA 4RK0A 2PD3A 4YJ3A 4FW9A 2G5GX 5KSOA 5K8TA 1TGVA 1E9FA 3PKIA 3AP1A 2QAJA 3WFZA 4X00A 1MNQA 4KX3A 3QKRB 4FD2A 1DIRA 4EM6A 1FK8A 2RE8A 1USWA 4C5LA 1DELA 4PTZA 1GL7A 4KI0A 2QD5A 3HA7A 4JT2A 5HYVA 2UUCB 2NV2B 2OGWA 1QG4A 5JZSA 3H5WA 2QJRA 4GX2A 1V0JA 1ZPDA 3UKDA 2QKYA 1UFVA 2P5TB 2JANA 1NHWA 3E3LA 2QUIA 5B6IA 4F5DA 3GBUA 4N4AA 1PEAA 1A97A 2HSZA 2GPBA 4J7AA 4LDZA 2QU8A 4YMHA 3WRWA 5F98A 1QR6A 1MH1A 1X7WB 2N75A 3IDQA 3TPCA 4EATA 1BDBA 2GPJA 2OKGA 2VR1A 5JVDA 2BDTA 1RRFA 1DRWA 2V6MA 4QJIA 4XJSA 2QU7A 5HILA 4JIGA 2HCFA 4YCCA 5JPCA 1SBZA 2O19A 2W6NA 3OU2A 1GSHA 5H9WA 1E3WB 1Y5LA 4AN4A 4W4TA 3KQVA 1GZUA 4JLPA 4M9UA 4JI1B 4BJHB 1PX0A 4LCBA 3H9JA 3OLCX 4PFJA 1OZFA 1VSTA 1RHMA 4GOJA 4EFLA 4DDWA 4G4JA 4ZO8A 1G3UA 3IUYA 1CQZA 4MUAA 2BEUB 2JHGA 3QKWA 3G85A 1UMDA 1Y7HA 4YS6A 3O75A 2K5UA 1BWRA 1FUEA 1VFNA 4K6MA 4WW0A 5EEGA 4US2R 5ALRA 3VTZA 3ESBA 1E69A 1M6EX 1T34A 4AX4A 1IDN1 4NU6A 5I7FA 2X9VA 1M1YA 4K7JA 5L3QA 3AY6A 3N28A 5CPBA 4WJMA 2DWOA 2ZSUA 2II6A 3GDGA 3HGMA 4TV8F 2HU5A 1J7JA 1X13A 1Z5ZA 2GHRA 3CEMA 1HQYE 1QF9A 2AZDA 2ZJ0A 1LBHA 3GROA 3H8WA 3OJFA 4Y7DA 1N2XA 5GVRA 3C85A 4KE6A 5LQDA 4KHZA 3MNFA 1GA6A 4MGHA 5ALPA 4E5SA 3BK7A 2CUTA 3N07A 4BLPA 1DV1A 3TGWA 3OU6A 4KMOA 7ADHA 4LZLA 3K5IA 1Z2CA 2FP4A 4FONA 2Y6UA 3TNDA 3UMVA 2P68A 1X7XB 1VYHA 2WWWA 4P3PA 2D00A 5DI3A 4XYEA 1R5OA 2DMRA 2DJ5A 4HG2A 4Y2GA 1TCAA 4EQ6B 1RE1A 3ROPA 1E8MA 2H59A 4AG5A 4PFQA 2OYRA 3U16A 1DAMA 3FSEA 2P75A 1JQEA 1ZIOA 4IF6A 1N33B 1DX6A 4DWVA 4JT9A 4KMMA 5IVDA 2J9YB 3AIKA 4EW6A 1PR0A 2ZREA 4J2TA 3EVBA 4C4OA 3GG2A 1DBSA 1ZOIA 4MJ7A 2H54A 3RARA 4RAQA 2XKKA 1MIHA 3AV3A 2DWPA 2WQ6A 4MP8A 5JNWA 4P4GA 5EE1A 3HLTA 3V7NA 4ALJA 4JMLA 5AOCA 1UBRS 1S1MA 3JVIA 5CYFA 2PO5A 3LBAA 4ESOA 3NL2A 3X3HA 1OW3B 2P0AA 1QVWA 4DQUA 2DR2A 3QF4A 1GPLA 1W5FA 3JTEA 4H3SA 1UEJA 2PANA 5BSKA 4FBMA 2G1UA 2OCKA 4POAA 4CBVA 3Q0IA 2R1UA 4LQLA 1ZMTA 4W82A 3DF9A 4HX5A 2BI7A 2CHQA 4IKOA 2GBPA 3IH0A 4S1VA 4E69A 2FSSA 5BV0A 1W5AA 2EF0A 3CM0A 3DCNA 2D1TA 3JWHA 1S3FA 1ZONA 2H1VA 3GFRA 3PGMA 1FIUA 4COOA 4BCBA 4PO1A 4K26A 4U63A 2PEZA 4BDSA 4EBFA 1IBKB 2J3KA 2OEPA 4PGAA 4F91B 5DW0A 2ZIGA 2WFMA 3TBKA 3E3OA 1I1NA 4RHFA 1U31A 2PDAA 3CWQA 1JU4A 1LNZA 2P4QA 4YCMA 4YIKA 3PPVA 3R20A 2C4VA 3LQQA 3NM4A 1EIWA 2VKQA 1HT0A 1JR6A 5CFQA 1C4OA 5LQCA 1EUDA 4JBIA 3HB0A 2RCYA 2OXFA 3EXEA 1V5EA 2H1CA 1XR3A 4QUEA 1RFLA 1SUEA 5C41A 2WHEA 4FMBB 4B9AA 3R8CA 1T1SA 2GCAA 3L6DA 1XP8A 3R5JA 1HETA 4KXNA 1KDYA 2H07A 1E3JA 1NPYA 2QAGC 2XI4A 3LFTA 1H9BA 2VAPA 3LQ1A 1UA4A 4U7PB 1AC5A 1Z7YA 2PPVA 4UU7A 4Z86A 3TJZA 4Z4HA 1HY3A 2AYYA 1NFRA 4JVMA 4XWKA 4YAFA 1YB7A 1NM5C 2DDOA 3EVEA 4C78A 3GGCA 3AONB 2H57A 3D6UA 4A2PA 3Q8LA 3E84A 1HLGA 1HPLA 1RIFA 1O2DA 1O6BA 3AR3A 2E0IA 3FPKA 3X1XA 1G59A 2QPTA 1DCMA 4RPHA 4MICA 1OXVA 1W59A 3ZEIA 2D5LA 4EVRA 1OX4B 4QWWA 3GOQA 4CMBA 3QVSA 5CXUA 3CX4A 3F7TA 5JS2A 2ZSHA 1CUUA 1O03A 4RXMA 2CXSA 2I3DA 4JVNA 4YXWA 4RPJA 2YWEA 3UK2A 3N86A 1LJLA 1VI2A 2C3OA 1T9GS 2CUKA 1S2MA 2WOOA 3FWHA 4LE0A 3EXHB 1UINA 4R1PA 4XSGA 1HDOA 4RZXA 2Y77A 4WOBA 2A9VA 2IK8A 2NADA 3INTA 3GJ4A 3S55A 2IUFA 3H2SA 2Y27A 4EB6B 3IT3A 1NQ5A 5JYEA 3B85A 5K6AA 1ZL0A 1HTWA 3E61A 2REQB 2V6IA 2HU8A 3AOGA 3DV9A 2BDUA 4Z9FA 3B52X 5AKYA 2JI6A 1LF5A 2SKDA 1W5BA 3WSWA 5CLFA 1Y4ZA 2B3DA 2HA4A 1JKFA 2ORVA 2Z2XA 2PG3A 3GBPA 4DIKA 4QYTA 4Z7OB 5TIIA 2XXAA 4RPLA 5EFZA 3I12A 1O94C 3LDGA 3K32A 4HWRA 3JWGA 2OZLA 4M9CA 3IAM1 1UDWA 4E4RA 4RVGA 1QHXA 2Q4TA 2C84A 1RWNA 1SK8A 4M1YA 3GUUA 4F3CA 1Y1KE 3ENWA 1SIBE 5AHRA 2YDYA 1NJ1A 2ZJ7A 4TLMB 1E9AA 2V7UA 4RGYA 3F74A 4J90A 1XMJA 2R48A 3OCCA 4QBGB 2HLDD 5IX8A 1K9SA 2H3HA 4YR9A 4CEHA 4YBZA 2AV6A 3L7YA 1KSJA 3BAZA 4EGJA 3IIIA 2I76A 2QY6A 2VPPA 5JI3E 1KGSA 2YZNA 2ZP1A 1DOHA 1XV5A 3CW8X 3ESCA 4BFSA 2PUJA 3RSOA 1BGXT 4NMMA 3R4CA 2GLUA 3CS3A 2P78A 2XWQA 4J43A 4LHYA 3UAYA 3GHHA 1GR0A 3GO4A 4YACA 4E46A 1CD5A 2EGGA 3W8EA 3DEIA 5MFPA 1XEWX 3LCMA 4PYMA 4E6EA 1FPQA 1FTWA 4ONEA 4LFAB 2DPHA 2YJTD 4C5KA 3W3AH 2I3GA 2ZEJA 2KYRA 5KOJA 3EC1A 2PCJA 4Q05A 3O8RA 1X87A 4GXRA 1V1RA 1XG5A 4DUGD 1SVKA 2RBEA 4W1QA 1UBKS 3G02A 4KQ2A 1KNXA 1F38A 1I0ZA 1ZNYA 4UMEA 2C4HA 2RMKA 1KK1A 2RHWA 4ND8A 3TIXB 3SWWA 4DV1B 3EQ9A 1LPNA 4F4FA 4EHBA 3VV3A 2DUJA 1JDTA 3ZDCA 3OJWA 1WOMA 1FP7A 2X6QA 3PP8A 4DRZA 4QUAA 4DB2A 4HB3A 3USES 3WLTA 3CH7A 4N6NA 1GRVA 2L82A 2QSJA 4FUQA 3GPIA 5BVGB 5ALWA 4ISBA 4Z3DA 3ZGLA 1QP8A 2GERA 4JJZA 1CHDA 4R5MA 4F4JA 1OU0A 3AM3A 3CZQA 2Q6LA 2QMZA 4KXFB 2BKXA 3TRIA 3C3BA 3W9BA 2XMZA 1KZYC 5B57C 4GOKA 4BN4A 5AQ1A 3ZM6A 3KZVA 4XWAA 4DDHA 4NMHA 4PY2A 3MLEA 2QN6A 4R0NA 4RA6B 2OCGA 1UMKA 2WSSA 3NU1A 4TUYA 4UM5A 4W5JA 3X1JA 5HKOA 2BVNA 4D2IA 4LY3A 1B74A 3AG6A 3TPFA 3I09A 3S7ZA 5CEJA 4QTXA 2MT9A 2WMOB 5EIWA 2FWRA 3ZWKA 3F67A 4P7KA 3AO0B 4PQGA 4I4TF 3WGLA 2CE7A 1AB6A 3DXZA 4RANA 1ULTA 3RW9A 3A14A 5F2OA 3HJRA 1P0MA 2HDHA 4G5RA 4ZCRA 4FYMA 4KO3S 1HRDA 3A3NA 1VG8A 3OEEA 1MB3A 4KPGA 3IX7A 4L95C 1KI9A 3DJYA 3NH9A 5LYYA 4BO9A 2RKOA 2TYSB 3LDAA 1VGRA 2CVPA 5KMGB 1V19A 1WO8A 1MAVA 2JATA 3AETB 3NORA 2G28A 4LY6A 5H7XA 2O8BB 2R62A 1KEEA 1DE0A 2IYYA 4GMXA 1UP7A 2R66A 5SYMA 2V74B 1JR3E 1D4OA 1Y4DE 3A04A 1ESDA 3A6HA 3PDJA 2H2AA 2OK8A 3FNIA 3L07A 1BRMA 3MCZA 5DYGA 4C4YA 2CE2X 3NFRA 4YV1A 3KVNA 4D8YA 1C1DA 1QHHA 3GMIA 4L8LA 1YGKA 4LDQA 4M60A 5LWHA 3M4YA 3NM1A 1RLTA 1UK7A 1Y5RA 3MS4A 3GP3A 3JD2A 4GW3A 2HRQA 1JVSA 5FOWA 5TF0A 2IZ5A 3VAYA 4UUQA 1G16A 2QTMA 4U2KA 4N76A 4DBLC 4I1UA 3AZPA 1U28C 3KSBC 2IRWA 1GL3A 2A92A 3DFUA 4HN9A 3HKBB 4RE6A 3WJAA 1OBCA 3H5IA 2VPYA 1GVNB 3GEBA 3OCJA 4OLFA 5DBIA 4BFTA 5L7YA 2H4XA 2AC7A 2I55A 4MQLA 4MRVA 2I65A 4NFSA 4F5EA 4RCYA 3TD9A 3ZBQA 4LQDA 4ZK2A 4EIWA 1PO7A 5DH9A 1YT5A 1QAMA 1KWGA 1FSFA 3BJRA 1P2DA 5HZKA 4AMVA 5EP4A 2VTBB 1XZHA 3F6CA 1NNLA 3IE2A 5JMTA 2O3UA 2VQDA 5E9QA 1AXEA 3PNPA 4TM8A 4JI3B 4BTEA 4WCFC 1JDUA 2YFHA 1OPRA 3PENA 4D3FA 2QTCA 2R6FA 3DMRA 4AUMA 4BEWA 3RV3A 1BCSB 4KMRA 3PJRA 1I5RA 1CY4A 1B6TA 2HQBA 5ALXA 5FXMA 1KI6B 3UHFA 4DLYA 1BHQ1 3LGSA 4AZ0A 3C3PA 4V0LA 2HN9A 2HWYA 2WWIA 4I4CA 5FRDA 3J81A 3GO7A 1BHJA 3DWFA 5DBGA 2CXRA 4M7OA 2D6FA 4REMA 1NZFA 5COBA 4R8KA 3UJPA 5JROA 4K8OA 2CJFA 3G6KA 4BVFA 3IKHA 1JL3A 1G2PA 4PR0A 1E2QA 2D0PB 3M8KA 3CTMA 3NETA 3NC0C 3PQFA 1J9GA 5ECYA 3K70B 4DG8A 1PSZA 2BMEA 2QPAA 3F9IA 4G5FA 4LXYA 3ZGOA 4B3HA 3MWDB 4C4XA 4PZLA 4HRYA 1N32B 4MULA 4LX0A 3VBEA 2VTEA 4K3UA 1FRNA 1IDOA 4OIMA 4BNGA 1NI4A 5JXJA 1UQUA 3VOTA 3HDVA 2C9OA 4D0NA 4E2XA 1BX4A 4R3NA 1CP3A 1JHOA 3PRKE 4J1NA 2ZCJA 4F97A 3TTTA 4XQ9A 3PFFA 1OE0A 2IS4A 1XZ8A 2RK6A 1TYEB 2H9AA 2ISQA 4F7WA 2GLTA 3JD4A 2I6SA 3C6QA 4EHJA 5K09A 3RQ2A 4DWOA 1X0VA 2JH9A 2A4KA 1CJBA 2X5OA 3OZDA 2LBPA 4OY3A 3PZSA 4E70A 3Q1LA 4LV5B 1N7JA 4DLVA 3A3PA 4O4IA 1U3FA 3DAOA 2ZRBA 3W9UA 1Z6YA 3H2YA 3HP4A 4BC1A 2UVQA 1T2CA 5KVAA 1ITZA 2BMDA 3T95A 4GVLA 4L8YA 1OCEA 4DA9A 4YJHA 2F1OA 5JWHA 1U2QA 2ZM6B 4INAA 3TVYA 1NNSA 4OQLA 2QM3A 1NLYA 5YASA 2D8MA 3D31A 5A04A 3RSLA 1UCFA 5J4HA 2YWHA 5EIAA 4FOSA 4LRSB 3BJMA 2G9QA 1A71A 3PF8A 3DC2A 4N6OA 4HEHA 4R9UC 1QGOA 3IUEA 1BROA 5EZYF 3U39A 2WHPA 4ZAZA 5KYUB 5L8VA 1PDOA 1CJMA 3N2IA 3GLGA 3VYWA 3AR7A 3JQFA 1R0ZA 1ST3A 1JP7A 3OJCA 4IIGA 3UK7A 4DW8A 3CVVA 4ZOQI 1M66A 1U65A 1GN9A 3D0QA 1V16A 3D8NA 4PG5A 3ZXUB 3ZCTA 2CD7A 4MDYA 1N7IA 3KSDO 1DIGA 2IT1A 2W2MA 4R7ZA 1BS9A 1DSSG 2E37A 2NUTB 3AESA 1T4MA 3PUWA 3PQ2A 4KOEC 1WZ2A 1F0KA 5BN5A 5KNLA 1LDMA 3N0VA 3U48A 2WJZB 2AMYA 4B47A 2E55A 4H15A 1ORHA 2HRRA 4URFA 1U5BA 4Y18A 4J0HA 4DNOA 3DTVB 1A5BB 1YJBA 4FT2A 4L4RA 4ARCA 4AY2A 1ABFA 4D4GA 4UMDA 4CRWB 1A8SA 2FFAA 3D7LA 1GLNA 3EC7A 3K05A 4GYWA 5DRYA 3RYHA 1TZMA 5TLSA 2FTKE 3AR5A 4XX0A 1OB5A 1FVOA 2J3JA 1R6TA 3UJDA 4GGOA 4U7GA 3QEMA 2V7XA 5DASA 2IYPA 1CQJA 2PN1A 1QTRA 3LDHA 4ZJUA 2J5KA 5J2TA 3ZDBA 5JAIA 1I2CA 1WTAA 1DIHA 3S2GA 13PKA 1LPMA 1SKAA 3R5FA 3T7IA 4EKGA 4YRNA 2CFSA 2YJ4A 3GJRA 2G4VA 5FOQA 2YUIA 2V98A 1CCWA 4UE6A 4X61A 3GGGA 4HNUA 5ALKA 4WPGA 1Q74A 5JSQA 1MH9A 1D3AA 2Q5IA 1FSPA 3THRA 1EKKA 4CKEA 5JRZA 2ECOA 3TKYA 1G18A 3FFXA 4UULA 2W70A 1EFLA 1IBCA 2BFEB 5ELXA 1Y9DA 3STTA 2HK7A 2VEOA 3QITA 4ZO6A 2QUKA 2I67A 2C49A 4E4YA 1QHNA 4F60A 4C01A 3GLIE 3DV0A 1Z29A 3UXEA 4B83A 1QO9A 1N0UA 3HDJA 3JAWA 4RD0A 5IM4A 4BC0A 1TM5E 3A27A 1CE8B 4JGIA 1U8CB 3TSZA 3A4VA 1PYDA 4LWQA 4H27A 2IZZA 4UAGA 3ZGXA 1RJWA 3H9UA 3QENA 3OZXA 1JYEA 1XF1A 1OH6A 3KKPA 3VSAA 1PSWA 1XK7A 3IQGX 5B3LA 1GXSB 5I51A 1KAMA 4KDFA 2DKNA 4CQMB 1PW7A 1IVSA 4AG6A 4AYWA 4IGIA 4NZMA 3W9YA 4CT5A 3IP1A 2WEKA 5KHLB 3I58A 1H0HA 1YMUA 1MX3A 3UB4A 1Q91A 3IBTA 3PPYA 2YW9A 1KZ7B 1BXGA 4I9HA 5ITWA 3QUTA 4Q39A 4B3RB 3MWKA 1EE2A 3KWLA 4GX1A 3RVNA 3MBJA 3OTHA 2EATA 2GKGA 4PPFA 1IQ0A 2ZT7A 4UVGA 4QGSA 4OYHA 2NLOA 3HRHA 3T9BA 1RQ7A 2QT1A 2V3CC 5FPKA 5JXGA 1KIFA 4KXLA 1A2QA 4XIGS 3S40A 1C9EA 3EOBI 4ZRNA 3D4IA 3G6WA 3L6OO 2GRUA 2X77A 3PGLA 1MV8A 3DMTC 3GJ6A 2I4RA 3DT6A 1F0NA 4ZYWA 4P93A 2PSSA 3RVMA 4XQ0A 3WWEA 4C30A 5FBZA 1C7FA 2PKYX 5B3JA 3MWFA 1EGMB 1ESNA 2L0XA 2Z6QA 1GFZA 2WIBA 3BMNB 4D44A 1NBMD 2FNAA 2R6GA 2VSOA 3I53A 3PF9A 2DQYA 2HBYA 4IFIA 1R50A 1YB4A 1Q15A 5IZ4A 1SURA 2FP3A 2QG9A 3N75A 3NQ41 3Q12A 1WP4A 2CF6A 4HXEB 1GUAA 1XZMA 5THQA 5K20A 3C3KA 4RQBA 3O9MA 2ZS7A 3H19A 1IWPB 2J6BA 4R31A 4C3UA 1HV8A 2Q3CA 2H65A 4NAVA 1P0FA 3ZE0B 4TTVA 3UQZA 3D6HA 4JL5A 1EJ2A 3HYSA 2JD1A 1Q5PA 2XNHA 3C3AA 3GQBB 1NY6A 3NJ8A 3RIXA 4AXXA 4B7CA 5LD2C 1GCAA 3OF2A 4NFLA 3VHXB 2A9RA 4DM3A 3BWVA 5HF8A 3ER8A 1CUBA 2DQZA 2HK9A 5DTIA 3SC3A 1TZKA 1H3NA 4HWOA 4JIMA 2I2AA 1OIXA 3FZQA 4MWOA 4AP6A 2Y2UA 4BYGA 5JNTA 5DLEA 3LZCA 3ZR4B 3GLHB 1T4BA 3ND6A 2Z6VA 4LMRA 3TVTA 5IMSA 1YHJA 4QJBA 1A9RA 1E1MA 1RKQA 1MA3A 3IQIX 4PQYA 1NVFA 2BFFB 3QBEA 4V3BA 3VI4B 4YMGA 1Q1ZA 3T94A 1G8AA 2P6UA 1ENZA 4NZOA 3ZHZA 1W46A 3GCZA 2EFJA 4L76A 5CVJA 1JSXA 1WB6A 2JAUA 1LVGA 5JS7A 1BQ3A 2YVAA 2YCLA 1E0KA 4TL6A 2ZSJA 2WG1A 5DM4A 3UK6A 4LQ4A 3IRUA 3NBQA 2XLCA 3QFSA 2BAGA 3HCDA 2HIGA 5BW8A 2H52A 3FFTA 3FDIA 3IAHA 4V0ME 2FEKA 4V0NA 3VOSA 5LZ4A 1Y8CA 4KGVA 3FFBA 4YJGB 3RUCA 4EL5A 2POQX 4ZMBA 2JGMA 2D1FA 2V59A 3P0RA 2V7PA 1NC1A 3DR3A 3HKEB 3K6JA 3RYCA 1LF0A 2WVGA 5AJUA 4IJWA 5BSUA 3V8MA 3PC3A 3HYTA 4ERXA 4IINA 3GEEA 3FHLA 3WRYA 2EZ8A 4RACA 1RHJA 2IDKA 1WUJS 2PXHA 1TADA 2RONA 3RC8A 4ND4A 1RFGE 2FZVA 3JQEA 4Q47A 4OM7A 1DKPA 1YMQA 4HGNA 5FOSA 3GBVA 4KIWA 1YBVA 4RK5A 4BVEA 2P7HA 4NOMA 1NZJA 4DR3B 4WZBB 1DTWB 1ICIA 2XNSA 4FMCB 4HP8A 2JASA 3TG2A 1XRJA 3THYA 2IEZA 1P2TA 3DDNA 2H0QA 3ZCRA 3G2IA 3UFBA 4F9FA 3ZWAA 1NF9A 3OIYA 1MIOA 5BSTA 1JMVA 1LPAB 4GE3A 5IKEA 4A6DA 1UBNA 2XEDA 3GMDA 4DV2B 4DXHA 1ACMA 2IPOA 4NZYA 2GD6A 3R9KA 4XYGA 3DLAA 1Z6GA 3R77A 3DUWA 5HBGA 2YNMD 3W5SA 1SKUA 1KL7A 1UANA 1WPRA 4WXHA 3M4JA 3WYBA 5T3UA 2L2QA 2QBYA 4KRYA 1YIAA 2FUCA 4P5DA 5D1HA 4M21A 5BSWA 2NACA 1OT3A 2V6BA 3IS3A 2A14A 1H1DA 5L3SA 1DC8A 3UT5A 3IN1A 3EEFA 1JJAA 3R1IA 3AY7A 1MXHA 4M1KA 4B31A 2R4QA 3BHNA 1LBEA 3ETEA 1BMTA 3OUZA 5AKKA 4UM9B 1JE1A 2CHGA 2AQHA 2IIPA 3A8TA 1Q7CA 4Z2YA 1J42A 4AO7A 5JNSA 4CGZA 4H17A 1OAOA 5AK4A 8OHMA 2R3SA 3KLBA 2C5AA 3WLQA 1XU7A 4D0SA 5ALDA 3KZHA 1VBKA 1SEPA 2HHAA 3HYCA 4ITVA 2GCNA 1A1VA 4K2AA 2JAXA 1XMSA 2W2OA 4CF4A 3LKIA 4GUAA 3QFHA 5FBHA 1MGOA 4PAWA 1E1QA 4D0LB 2HCTA 3GRVA 1UMCB 3B7PA 1T13A 2ZROA 3UUEA 1QK4A 2R00C 5BQOA 2ZJZA 3S81A 3H9BA 4G26A 1HE4A 3QCZA 4LC1A 4Q9HA 1NXOA 1W48A 3ACDA 1FRQA 3IC5A 3DYBA 5HE9A 4HVCA 4EBUA 3GCDA 2GBCA 1AQNA 1FUUA 5L6LB 2BFCA 1T4CB 1ZMOA 1M2JA 3K73O 3HWSA 4FC7A 3U26A 4BQOA 5J43A 3CLSD 5KJ6A 3G0OA 3BBPA 3GEGA 1D2NA 2IP1A 1Z83A 3NVMB 1SWWA 1O7JA 1Q7GA 4BGIA 3L7AA 1QZZA 2J8ZA 2HM7A 4DIMA 3AEQB 3UO8B 1Z7WA 5CEFA 4KPEC 1VKHA 1WW3A 2GD2A 4ARIA 2MSWA 3A4TA 5GPBA 3GFOA 3MOIA 1O6CA 3MJCA 5KTRA 2QYOA 4IKEA 2ZTVA 1H22A 10MHA 4NL4H 3NPAA 4PAOA 4CLOA 3IEMA 4XA8A 1GL9B 2DHRA 2FEPA 2Y1FA 3VNRA 1TZ3A 2RG7A 3DWEX 1OTXA 1TM4E 1XD2B 4HNAA 4NFHA 4XSVA 3WL4A 1TU3A 4BX3A 4JY7A 2I6BA 4LHZA 3O3NB 2J0EA 4GP7A 1QUFA 2I4LA 5DM70 2B0CA 1NE7A 2ZJFA 4PC1A 3K0CC 1ZK0A 1KAGA 4CF7A 3ROMA 5C53B 1LEHA 3WV4A 5HUJA 2CV1A 2WAMA 3IAS6 3W2HA 3A9WA 1Q3HA 1UXIA 2BFNA 3ORRA 4DNQA 5AW2A 1H8EA 1AY0A 3DMPA 1T2FA 1RK2A 1O6FA 1J8FA 1X0XA 3I28A 4LQCA 4PPQA 3GEHA 5M04A 1QMPA 2ZYSA 1D2MA 2GB4A 2IHJA 1B2LA 3B5JA 3V9AA 3WJ7A 4IVRA 3JYNA 4RWEA 5IJ9A 5K8IA 2UVPB 4LJ7A 2DERA 3G5AA 1CP2A 2QLFA 1SQ6A 1V3VA 2DUWA 5A4IS 4PINA 1TM7E 1W7AA 2HTEA 4KUHA 1V9SA 2QT9A 1UPXA 4PV7A 1UJ6A 5JCOA 3RD5A 4B7UA 1WSDA 3SMQA 5JJKA 2VK1A 3UGQA 3VHLB 1KY3A 2AJBA 1G4HA 1JKJA 4H35A 1ZJ4A 4LBZA 5ALMA 2OXTA 3BRCA 4MVJM 4JKOA 4DR5B 1ZGCA 4K9SA 4RVHA 1ZK2A 4N01A 2WY2D 1J6UA 1GGHA 1YJ5A 3DZHA 1NIJA 2QUAA 4NOJA 3G9ZA 2PIAA 3QVOA 3IR7A 2HJGA 4P0TA 4X6UA 2FHSA 4M9ZA 3CCFA 1RKDA 2QGFA 5BV7A 1JB1A 3WLKX 1VP9A 2PKXA 1EFUA 5AXBA 3K70C 2NP6A 1T26A 3FBWA 3IMEA 1YUMA 1BW9A 1NKTA 1HFWA 1BMFD 2NG1A 3IOMA 1ZD5A 2XTNA 3PYMA 5G0VA 2YRFA 3SGLA 1VHJA 2D0DA 1JLRA 4LCEA 5K3FA 3ZCPA 4MZXA 3EGWA 3WLRA 2XCRB 2HA0A 5CVDA 2IEBA 2NW6A 3B1WA 1LNQA 2QL6A 1C9YA 3C2QA 4P58A 3TUIC 5HKLA 4TTAA 1T15A 3COVA 2WTUA 3BZBA 2J59A 2QAIA 5HOEA 2QNIA 2FPRA 4B84A 2CSUA 3QRWA 1Z25A 5AK6A 4IRUB 2LW7A 5JH7B 1KK0A 2GKSA 4WFJA 1GQRA 2PXAA 2H06A 2ZSBA 1E2NA 4IWXA 2OCDA 4KAAA 2BGMA 2ZYIA 5LMUB 4PS1A 2X15A 2DQSA 2XVAA 4R6WA 4UEJA 1E2DA 2BL4A 1F2DA 2J7PA 2YHAA 3VDNB 1GAEO 3AVYA 4U2GA 3GLIB 3F3KA 3CLRD 1E3QA 3FUCA 3D0OA 1NUPA 4NF2A 5LDGA 3N2YA 3NHJA 4GC9A 1DC6A 1E6WA 1OQAA 1G42A 1I2DA 3OZAA 1ENPA 3EBLA 1P2FA 3NWPA 4IKPA 4L1KA 5BYCA 4JJFA 1F5SA 2G8NA 3T1TA 2K7FA 3GJ5A 4O33A 4WGFA 2VNJA 3IV9A 3QYJA 2N47A 2PGAA 4RDCA 3OFVA 2WD9A 2GAJA 1PI3A 1W30A 4L22A 4AMBA 5K4GA 2HIMA 2P4EA 3PR2B 1I7NA 4YT4A 4EO7A 2XT0A 5JNVA 3LLCA 1PUXA 4MWZA 3GRFA 1L3IA 2VDVE 3D4BA 2HCBA 2BHSA 4HN4B 4Q34A 2XOEA 2XY4A 2AI2A 1FUKA 2W8BB 5TRTA 4KRXA 1Z4QA 5MN5A 4LNAA 3UPDA 4EENA 2C7BA 3B6KA 4RQTA 3KKOA 3AERA 2EXXA 2G1AA 2GZSA 3KUUA 4XCVA 5CCEA 4G8DA 3K0HA 3BD9A 3K0AA 1DAKA 3N70A 3PEFA 4HCJA 2FWMX 1H9AA 4RBNA 1E6EA 2ZIFA 3TIVA 2JA1A 3D7RA 3GH1A 2HJSA 4XVQA 2AW3A 4QBIA 3WAKA 4CT4B 2O8VA 3I37X 2C5GA 3A6KA 3KDPA 3BMQB 2Q9BA 4RETA 1A1SA 2QN2A 3PX3A 3X1DA 4NU8X 4KVGA 4PN7A 121PA 1OXXK 1CEYA 2EJWA 4HAVA 1ST2A 1QK3A 4US0R 2R9VA 4INZA 5AVSA 2P30A 1K8QA 2R6AA 4US1R 3GBSA 2X2EA 2WAXA 2JBWA 3QUAA 1M6VB 3QA3E 1QHEA 2VNKA 5ADVA 1KH3A 4JVLA 3SF0A 1QGUB 1GAQA 1MD9A 2PX5A 3VYUB 1L1RA 2JG1A 2BWJA 2VIIA 4TVOA 1QP4A 1DCTA 3GJ7A 1SXIA 3NHWA 2YY7A 3O4JA 4WXPA 4M0EA 1L5HA 4CLHA 5JXIA 2E48A 4R2LA 2W6CX 2GEVA 2WABA 1TVMA 2Y1KA 1KMCA 2NZJA 1UPAA 1E1CB 1LY1A 2J3HA 2J7KA 2MU1A 1YQXA 2WFAA 2H4YA 2R5WA 1T4DA 1JHYA 3FRHA 2NO6A 3TUZC 1XAGA 4Q82A 1PE0A 3CNHA 3HRIA 3O74A 4XARA 4PAMA 4W7IA 5FPYA 3RODA 2HJ9A 4D9BA 5IVPA 1Q3TA 2XMDA 4IR7A 4RTRA 2JKYA 1CZUA 2UZ3A 1EGVB 4BO1A 5I9IA 5LVAA 5KO2A 3JD1A 4X1KB 1OZ0A 2OO5A 5IAGA 2NU9B 4LJKA 4TYMA 3B1FA 5CEEA 2EZ4A 4X1YB 5CIWA 2GYUA 1V3UA 3F7OA 1EVEA 3Q7QA 3E9NA 3C43A 1QIGA 1YE5A 2RARA 3F5SA 4UFNA 5HF6A 2PVPA 3KWFA 5C9ZA 4O2RA 1O54A 3C98A 3K9FC 5FD8A 2QW8A 1U3DA 2UZ4A 1SXJE 4FCVA 2JK0A 2O23A 2V4UA 2JIPA 3VR2D 4XEUA 3HKCB 3L82B 4G0OA 1SCBA 3KE8A 4DILA 3T3DA 3LQKA 1YO6A 4O59O 2X4GA 3CH4B 1L3CA 4RMIA 1KRWA 3W77A 2YQ5A 2J0UA 1Q0SA 5COQA 2D54A 3WRXA 3F6YA 1V95A 1I6WA 2F7SA 2IYUA 4B9EA 1GVHA 1RJDA 2AR0A 4TVSA 4CETA 5ICSA 3WWYA 4EG1A 3CINA 4RGBA 2E5FA 7REQA 3FGNA 1T8TA 4I8XA 3V7YA 2VF2A 5JYDA 3FF1A 1EIZA 1PJSA 3P0JA 2BBTA 2ZZKA 4F72A 5HZHA 1QIHA 3EDCA 4DCUA 4GL2A 4RHXA 3ZY6A 5B55A 4S1IB 3GUCA 1FXSA 3EE6A 1N2IA 5EJ5A 5CM9C 3UAVA 2X3FA 4PR3A 2F2TA 1TW2A 3GEDA 4BVKA 2I03A 3OM0A 4I9UA 3ZK9A 3AVQA 4IVPA 4O2LA 3LPCA 2C7GA 2QI9C 3LY8A 3JYPA 4EGSA 2SHKA 3IOYA 4MUEA 4AIRA 3F46A 4JYPA 3INYA 2QQGA 1JILA 1GTG1 2M2IA 2PX8A 2QYHA 3BWMA 3I0NA 3QU7A 4HPJB 4CN9A 1EP9A 1SBTA 5E3IA 1JHUA 3UMYA 2PRIA 3EGOA 2NTNA 5JFOA 2HYIC 1U81A 2VP9A 2SKEA 5CNMA 1U1IA 3USZA 2ZBFA 2UXBB 2W42A 2BLLA 3FNEA 4P84A 3WXBA 4CDMA 2PT7A 4Y2VA 3TQOA 5CDGA 5EN4A 5EMKA 4GF5A 3UCFA 4ZMRA 2X6TA 2QF7A 1B23P 4E94A 5K8CA 1Z0IA 3IO3A 3OD5A 2FPIB 2H48A 2ZYTX 4Z4IA 1WZEA 2H1RA 2VHUA 3QLUA 5LQUA 5FI3A 2OZEA 3LBNA 5K3OA 5HIKA 1UJ5A 4B3MB 4G3XA 1XPJA 3GXBA 3NB0A 2C8KA 4I4LA 2LWIA 4M55A 1L7XA 4ZI7A 3PWSA 4XQEA 3MS2A 1MLDA 3WLSA 3WGVA 1YWGO 3MILA 4P3NA 1TUBA 5CITA 5CB6A 4FFSA 2D2VA 3WI7A 4A16A 4OLBA 3PGJA 1Z9BA 3MD0A 3DFMA 2RGBA 2B3TA 1SHTX 1M5UA 4C5AA 1KERA 2YJGA 1BXRA 4A82A 4B8YA 5H9VA 3VASA 2CHEA 1IPEA 1H0KA 1YKSA 4L3OA 1NKVA 1FTNA 3H3FA 4M0CA 3TM4A 3T1QA 3UZUA 4G8JA 2DFNA 4BO6A 1MEEA 2H17A 2XMSA 1R0BA 2IYFA 3NR2A 2R65A 4QSHA 5FNVF 2BGGA 3WLOA 2UUAB 1I01A 1M3SA 3ABIA 2FPPB 4A8JB 3BERA 3EFOB 4Y1RA 4WBXC 2VPXA 3H8SA 1Q0RA 3W8RA 5LQNA 4AZVA 3F1KA 5C4IA 1WVIA 1KQOA 1P6XA 4HDKB 5CYGA 4GVPA 3NWBA 1SG0A 3WYDA 1T8PA 1WBJB 1YE8A 2FH5B 1TU4A 4B44A 3ES9A 2HV8A 3C16C 1F8FA 4AKTA 1GPDG 1ID1A 3UB2A 1JBEA 4JC8A 4M0LA 4TWAA 2AQKA 2TMDA 4QGFA 2FW0A 3K2EA 1O5IA 3EMDA 3TCXB 4KQFA 1BMQA 3Q3EA 5AVYA 5F11A 4GUDA 4H7KA 2X40A 3A4MA 1TCVA 1SZPA 1G20B 3C7TA 3V2HA 3DZBA 5BMVB 1W4AA 1MOZA 4MOWA 4ZC8A 3W5AA 2OBNA 3OX2A 4LKOA 1XZJA 5LCXA 3DMHA 1CUJA 4PW0A 3WL6A 3N76A 1H2AS 1JAYA 5EUMA 4WDQA 4LXGA 2VJOA 4HDMA 4NYJR 1XZBA 1EK1A 4Q1BA 5BV8A 4PGMA 2C03A 1E99A 5JJBA 3Q6IA 1Z47A 4KAXA 5C3ZA 4I7EA 2PGXA 3W05A 4CKWA 5JXWA 1DKUA 1P29A 4MR9A 1MBZA 4LWPA 4QREA 3Q92A 1GPYA 2NSHA 4GM4A 3L01A 2ZJ2A 4Z0TA 5HQJA 3QPVA 5BSVA 3OWHA 1LA2A 3MWLA 3NL3A 1ZSYA 4D99A 3GEMA 4UXJA 2JAHA 2F00A 2JKVA 2PFGA 5H5JA 5I4CA 1WE2A 4L07A 2ZKLA 4PYLA 1KRHA 1MORA 1T9BA 2BFBA 3LQYA 1ZR2A 3KYCB 3BCSA 2QROA 2Y0DA 3I42A 3Q1KA 5I9NA 4Q16A 1UJNA 3ICWA 3DP9A 3KYDB 1RYBA 2QP9X 2YBEA 1MFPA 1BNCA 3LOOA 1E58A 2ZWOA 3O1JC 3SP1A 2L19A 4G2NA 2PSEA 2JJ2A 3ENNA 3H0EA 3IV6A 5KTMA 1JG6A 3OZFA 3PQ5A 4I99A 4D4IA 2RAFA 1NW6A 5EL0A 5L3RA 5EE5B 4BGDA 2YV4A 2YN4A 5CDUA 1LWNA 3HCOA 2FZCA 2GCPA 2OQRA 4PLYA 3ZZ1A 3K6SA 2MMCA 1U6KA 3IULA 2JDID 3BE4A 3BIFA 4RNCA 1JYFA 2C1XA 4QYXA 1YQUA 2B25A 1D0SA 2QP4A 1DJOA 2OORC 4REQB 4PRZA 1W36B 3CCBA 1LK7A 1X2BA 4I6JA 4QOSA 1P5HA 3DKIA 2NU8A 5FX2A 2CL6X 4MPRA 1EZ1A 3A3OA 1H2FA 2QMEA 2OP0A 3EZLA 4QATA 3ZH2A 3CH5A 1QH0A 5IJWA 4QWMA 1VHDA 1ZRHA 1JEYB 4RSHA 1XHLA 1MO2A 4FNAA 4X63A 3BXGA 5JSKA 4TSFD 4EKEA 2ODAA 1XTUA 3VX3A 1SHKA 5E0OA 4YT8A 1Q0ZA 2OQ2A 3OQ6A 1OU4A 1EJBA 4IUCS 3DVQX 4IXTA 1IZYA 3HEBA 1R8QA 1VHTA 3DZJA 3F6SA 4AB1A 4CL3A 2AF4C 4G9EA 1HORA 2XGGA 4XXHA 4OXRA 5A4FS 5KJ1A 1TVCA 1LH0A 2ZOSA 1FFEA 3V8PA 1KEUA 3CIFA 4PNHA 1T6NA 3R0ZA 5ALUA 4GBMA 1SY7A 1XZEA 2DFPA 4MW9A 5EZSA 4CKBB 3DMGA 3LSTA 1EINA 3I39X 1T3HA 2VJBA 5DV9A 3AFGA 3JQGB 3ZE6A 1O4WA 1W0JD 1XAHA 1AUPA 2ERXA 4RSGA 1O89A 5AXAA 1SPBS 3ZZ0A 2HO4A 2PH1A 3H7IA 5IP5A 4M0KA 1EX9A 4HWPA 3I83A 1IXRC 1BSVA 4EOHA 1TF5A 1C0PA 1PSDA 3JZDA 3LHDA 4KN9S 4UE2A 3KRTA 3AKZA 5CLJA 4DUYB 2OBXA 3DS8A 2QI9F 2WILA 1JA0A 3JV7A 3KL2A 1FNBA 3NOXA 4LPSA 1AV6A 3SQMA 2NVUB 3H2HA 3IUPA 3L7KA 4OHWA 3T7AA 3ZHYA 3UJNA 3ZNPA 4EW1A 3CH6A 2IXFA 2CLMB 4X0EA 3ZKWA 4OYYA 3RRMA 4A5OA 1PDVA 1PJRA 1PG5A 1S4QA 2OGSA 2QVCA 3RASA 2J5RA 5ISMA 4EAQA 1ZW6A 4RKQA 1ZD3A 4HSEA 1VSBA 1F60A 1LSUA 3PVCA 3DEAA 1Y3FE 2W2LA 4ZT4A 1XVLA 4JASB 3SZGA 4B2IA 4DF3A 3HY3A 1N9GA 4ICIA 1Y3BE 1OI3A 1Q1QA 3ZBPA 3ZVNA 4PXSA 4E8ZA 1SQSA 1PYGA 1YS1X 2WWXA 3OLQA 3DBRA 4PVDA 2PQMA 3Q5EA 4B6FA 2VP2A 5FORA 2E4UA 1DMRA 3WLLA 3JWEA 1IONA 1K3UB 1VPVA 2CBXA 4L51A 2X2OA 3GFBA 4HDOB 4JNKA 1M34E 4QLOA 3ETJA 3GFQA 5AK3A 2AG5A 2EHDA 4WXYB 3M5PA 4EO9A 2OOKA 2ODEA 3FUUA 3H2BA 3NM3A 2PSFA 9LDBA 4UNPA 1ML4A 4GLBA 3FYUA 2P9QA 5HWSA 2OXRA 3MCWA 4P82A 4TZTA 4BMOB 3L7JA 2E4WA 3GXOA 4UNRA 1YS9A 2DPGA 3OZUA 4C7XA 1J8YF 2B4RO 3U5ZB 3RVJA 3A1TA 3KU4A 1W96A 2JLAA 2Z2IA 4BZPA 3UV3A 3UHOA 2IOHA 5EPUA 4IX1A 5LDHA 3GJXC 1HZZC 2PLWA 4TRRA 2R5FA 4JJ6A 4WUTA 2QSYA 4LSGA 3SYMA 1EVIA 1UAAA 1U2RA 7MHTA 4QQ8A 3EVAA 4MQMA 4KNYA 4TRJA 3GH3A 2NO5A 4FQ5A 2O7VA 1QLJA 2F3SA 2HYDA 2ZJ4A 4NIMA 1E3EA 2YZ2A 2EYUA 1U2TA 1XVVA 3ESXA 3M9LA 5AO9A 3VU9B 3LUAA 2QRQA 2W93A 2RGXA 4L5YA 3WQRA 4X65B 1NJ8A 1HYQA 5F52A 4R4JA 4ZYVA 3TLEA 4C9BA 5AK0A 2QHXA 4CMEC 3TOCA 1R4MA 1FYFA 3SHFA 3QWIA 3P9ZA 2Z08A 1KO8A 3G5UA 3KTOA 4B4VA 1YQWA 5JCXA 2GAAA 3H5AA 4FMCF 4IP0A 1QE0A 2AD5A 1E94E 2P9ZA 4WXRA 1DO2A 3PBKA 2LXNA 4NSNA 3C7AA 1RZVA 3FSJX 1DDIA 2FR8A 3P27A 4MRSA 4TTJA 5KWJA 5CFNA 4LOKA 3D81A 4JUAA 5C8YA 1AQUA 2OD7A 5IKPA 5EIOA 1SXJB 3EGCA 2DLCX 4NCIA 1J0BA 4GR5A 3PCXA 1QF7A 3JPWA 2LKCA 4OJNA 4YCSA 4JJKA 3U5TA 4IRMA 1QYWA 1X1QA 3CZ9A 3C70A 5CLHA 3IT2A 5TQ2B 4CVMA 2ZU6A 4D02A 1BVHA 4GZMA 1TAGA 2Z5FA 2PH3A 1PR6A 1QLHA 5EWMB 3ZW7A 1L5RA 4GP6A 4D43A 1AS2A 5HCUA 1Z5PA 5AVRA 3D6TB 3ASUA 3VPFA 1O5OA 3SJBA 1WQ4A 2HA3A 2O8EB 1G19A 1L4YA 4CTKA 2AUNA 2FEWB 4PG7A 1FE8A 4YN3A 3G5TA 1P19A 2JFZA 5BR8B 4DCNA 2Z83A 2ZBDA 3JQAB 3LFHA 1ECBA 3ZHUA 2WNSA 2UYHA 4DTCA 1LPPA 3JSAA 3Q3HA 3WLFA 3ZGNA 4O08A 3E9ZA 1WVMA 3H05A 1QC5A 3RYFB 1N6IA 4J8PA 3QW4B 1A9QA 3NG1A 4QU0A 1R0SA 1F2VA 5J5AA 1ARZA 1OGIA 1Z8HA 3RUAA 3PZRA 4IJKA 4RZ2A 3T7EA 1U0JA 1CUIA 4OHPA 4Y2SA 4Z0PA 2PGIA 3G88A 3KQMA 4KITB 1O58A 4TMKA 2FGKA 1Z18A 1JZSA 1MZPA 1G4AE 2Y2VA 2XMCA 4Y9UA 2OOSA 4JQYA 1UKBA 1DRVA 3O9ZA 3UEOA 2X1VA 2G7MC 4C0HA 3R2JA 4N18A 3MT9A 3OM1A 3QI2A 3TQIA 4X85A 1PNRA 4BKMA 2X3UA 2QB5A 3E0QA 2Q2OA 3G8AA 2C2ZA 2ZIUB 4GNRA 4RHEA 5AM4A 1E7WA 5JCPA 5LP1A 5B6JA 3FRIA 1N2JA 4ZARA 16PKA 1CEEA 3P2KA 1GR1A 1CB0A 3T12A 1Y9AA 4C2TA 1JIQA 4E5VA 3ZHQA 4EHFA 2W0SA 2XCTB 2G67A 1FMLA 3NBZC 3ZS9A 2A1UB 2CFIA 2DXIA 4LXXA 4NBRA 1TD2A 5HF5A 3TR6A 2ZULA 2O0MA 3LVRE 4JC5A 3TZ6A 2HPVA 5I7OA 4CNBA 3OMLA 3TEFA 1K3FA 3E2MA 3GGOA 2OT3B 1H42A 2XYVA 4IV0A 3L84A 3WK8A 2WJ3A 1EFHA 2PR7A 4W5QA 1JH8A 2X5NA 4RL6A 1MVLA 2VSQA 3ZOKA 4JYZA 3L6BA 2G4CA 2KBEA 1XTRA 3PDIA 4HBGA 2PKFA 1GZ5A 4GRAA 4J1TA 1Z0AA 3M5CA 5KDDA 1SBQA 3B1JA 4F2DA 1RYYA 1T36A 1ZM3A 4YEDA 5AKJA 4RABA 4X8OA 4X84A 5SYAA 4QA9A 3TTUA 5C5EA 2FPLA 1KEZA 4H3VA 3WL7A 4EG6A 2IYAA 4BFZA 3BIJA 2WQ7A 1RS0A 3MT8A 4LDRA 5DEOA 2CNOA 3GFFA 3FB4A 1U6JA 2H1IA 2AQIA 4IH4A 3N8KA 2HZBA 4NBNA 3EWIA 2B9EA 1IUKA 1PTKA 4BO7A 1SCDA 4MJ3A 4CM9D 3FTFA 3SQLA 2O5EA 1MQ8B 2NNWB 5HJ7A 4YRIA 1E6LA 2R7AA 2ZTSA 1R18A 4RKWA 2PS9A 1DKOA 4I2NA 4JLWA 3UJBA 3AFHA 1N7GA 2QR3A 3W2GA 2OV1A 2X9LA 3F71A 4RVSA 3VDQA 2Q6KA 1OLUA 1K5PA 1DTEA 3J7TA 4RO0A 3HXOA 3I9MA 2VQ3A 4F1JA 1J0CA 3LZ6A 5F64A 3U7GA 4MQUA 4RJ2A 3OD1A 2XIJA 2HT6A 4PYOA 4YDHB 5EI5A 5BWBA 3AFOA 4HADA 3A6LA 1EAYA 3NGMA 1N2CA 3CRMA 1P1FA 5FUQA 1C7IA 5E7QA 1EDDA 3ABQB 4P4SA 4FJ1A 4FFLA 3O93A 3N5CA 3BJEA 3ENZA 2QTBA 4RKRA 1LHRA 4MMYB 2JLQA 1X1SA 3PDCA 4KKXB 5KAMA 2R6R1 1RPAA 5EMHA 3RAGA 4CMCA 1G8GA 4UCFA 4Y6SA 3GN1A 3P96A 4N6GA 1W4LA 1BS1A 2JEOA 5FA5A 4DV0B 1CZOA 2ZE6A 3WK9A 3H1PA 2ZRPA 4EDHA 1KMHA 4WLNA 2WZBA 3IVXA 4C5MA 3GNQA 2ZZNA 3OT1A 1T5HX 4YALA 4WFIA 1UPUA 5A62A 3MXOA 5KNBD 2VUIB 3O4IA 3OP4A 1OZHA 2AEMA 4OXQA 5GZ1A 1CULC 2CWWA 2VBGA 5JH7F 1P33A 5DK6A 1E4EA 1HKUA 3COPA 3UWSA 4B80A 2QM0A 1SA0A 2W90A 1FXWA 3IERA 4GI7A 3IP5A 2NZYA 3CC8A 1TJPB 4A8JC 4DG5A 4QEDA 4TWRA 2WDZA 1QLWA 2FG7C 2DKOA 3A1CA 3BWBA 3H9GA 3LYLA 4MUXA 4PQEA 4ROSA 5D86A 4CU2A 1ZMBA 4CFSA 1FLNA 2EWMA 1L4GA 3M6MD 1D1PA 4J4TA 4PYKA 3LPNA 1QV7A 3RLIA 2BM9A 3V33A 4O63O 2OGTA 3OTIA 4ZEOA 2AUTA 2NZWA 2Q8NA 4YRDA 2O8FA 2QE7D 5E3HA 1XTJA 1GZ3A 2XDWA 5A3QA 1J5PA 1KHTA 2YNMA 3QPCA 1T8WA 1Y6ZA 1J0DA 4JVOA 3WBBA 5CFLA 5KQSA 4WNAA 3EZ6A 5G53C 4RWZA 1JQ3A 3T1OA 3VPHA 1MB2A 3EF0A 1XZQA 4Q1VA 3U7HB 4AZSA 2PKCA 1B0UA 4R0VA 1FX0A 1E6KA 5AR1A 1PF7E 3E05A 3ILXA 4JEUA 3FDFA 3KBBA 3QFCA 3PQ6A 3O8QB 4IDNA 1FZQA 4QXPA 5KQPA 4RVNA 2FGJA 3RJ9A 3T5MA 4MW2A 4MX8A 4YAIA 3JRWA 3DO8A 3I1IA 1KSGA 3VR3A 5BR4A 3FI9A 3OE7A 1N2HA 1XMIA 1KU0A 4RTNA 4LYEA 2D1QA 2HXYA 3S99A 4CZ2A 4YREA 2JAPA 4F8YA 5EUQB 2IS6A 2WP0A 1FMTA 1U1EA 2WV7A 2IE0A 4KIJA 5BRNA 1CBUA 1ZISA 1SVNA 2ONYA 3SYKA 3SVTA 4KREA 2OFXA 4B3DA 3ROEA 2BT4A 1E77A 4X8MA 4ZD6A 2VBFA 3ADPA 3LD9A 2O8CB 2LUOA 1X19A 1Z37A 1GGFA 1KKUA 2FUNB 2X0RA 3DZCA 3DBHB 2JIBA 1GITA 2I3ZA 1OBFO 4TV8A 4H4DA 5F1YA 1XJQA 2D74A 5ICMA 4C04A 3GAAA 1Q0PA 3Q3VA 5JECA 2UYCA 3QAIA 1KKMA 1OUMA 2WF7A 1SRRA 2GHTA 3RBXA 3OCWA 2G72A 4NEQA 4DQ0A 1IAVA 3JYHA 1CY0A 2AWNA 2RH5A 3LRXA 3N6XA 4OUDA 4C3VA 4EJSB 5TDHA 4DEVA 4MVJI 2PJUA 1C4XA 2G5PA 3IIEA 3E03A 4Z9XA 5E6UA 3VZQA 1CQXA 4K8CA 1ZI9A 1N2BA 2ZIVB 1FRZA 3I72A 2EQ5A 2JJ1D 2O3RA 3KJIA 2AMFA 1AV7A 2YYYA 2V3WA 1LGYA 2W6PA 3AUKA 1GG2A 1EG7A 3CT6A 3NYWA 5AI9A 3ZHRA 4DDUA 3QWHA 1Z6TA 1GRRA 3DD5A 4D7AA 2ZIAA 5CCDA 3WIUA 1ILWA 5KQRA 1DXQA 1VIYA 1GCIA 1W36C 2OHIA 2R25B 5KNDD 3UOWA 1DWQA 3A28A 3R40A 1M34B 3A0RB 2GTPA 3IEIA 1AKWA 1YHNA 4I1VA 4BFYA 3S4YA 3Q41A 1JPUA 4X97A 2DH5A 3SLKA 1F1JA 2PLFA 3PDWA 4BNJA 1LI5A 5KVVA 1QO0D 1CUFA 1L0BA 2VNHA 5DN9A 3SOPA 6ADHA 3IIJA 2AWOA 1G6OA 4W9NC 1NUTA 1GGEA 4Y6GB 1NVVR 1YRQA 2HJHA 4FFVA 3B1OA 4FMPA 4D8VA 3KSAC 3DBLB 4HTFA 4CKCB 3TSAA 2QPLA 3CUUA 1EA7A 1WHSA 2C29D 1IZ7A 1JHRA 2VSYA 1P61B 1KZ6A 4OMFG 4J29A 2VXYA 3X1WA 2QIOA 3OI7A 1U1FA 4BKPA 4CM7A 2EGUA 2DH6A 4L4UA 3VUFA 1IWBB 5EERA 1S9DA 1UOEA 4O4LB 3VDRA 4ILKA 4YMWA 5MFZA 5D3QA 4DS3A 2JCXA 1B93A 4JUDX 4MLPA 5B2FA 1J9EA 3HVJA 2AHOA 3OE1A 1NC3A 5GJCA 2CD9A 3Q3JB 1EVYA 1Z73A 2OFWA 2VATA 4HC4A 1PV1A 1XVAA 5NLLA 4LFBB 3GA7A 3C3JA 5CDFE 3FLEA 1UP6A 3OX3A 3WLHA 5I8WA 2HWXA 5JNRA 1WD5A 4IUYA 2R3EA 1NG1A 2CKMA 3CIOA 5FH9A 2RHRA 4ZOLB 4RZHA 1U4OA 1DOZA 1THZA 3AOEC 3DC7A 3G9TA 2WIKA 4KIFA 3VVCA 4F9GA 4K1LA 1D9XA 4BMDA 1NVDA 4NBTA 4EY6A 2B34A 2WD7B 1KS2A 3OZRA 2VZ8A 1K2WA 1YR2A 3P9CA 2NM0A 1IJFA 2F67A 2PZLA 4GSLA 2B1QA 4I9NA 4OHRA 4B34A 4DABA 4I3FA 4KSBA 5F33A 2G6TA 4IJVA 3Q72A 4M1MA 1DT3A 4Q1AA 4MIYA 3KL4A 1QFSA 1PJZA 1V25A 2WSLA 3QK7A 4MW1A 2O9JA 1EB8A 1M8FA 1FFWA 4ZA2A 2R86A 3ED1A 1U7DA 4WIAA 1J0AA 1NKSA 3EISA 3OO0A 1DQSA 3D6FA 3I2YX 2WB2A 4ABTA 2V7GA 1VK4A 5COJA 3BK2A 3HCFA 4JI5B 3BD6A 2J5BA 3N2GB 3D8SA 3N5KA 4RA9B 4RCVA 3LVFO 3BD7A 3TF5A 3DE6X 2V8BA 2QMYA 1TU0A 1DUVG 1I3NA 1MFZA 1KJJA 1WUHS 4PRKA 5AM2A 1UF9A 1ADGA 3REQB 1RWWA 4TXLA 3L05A 1D09A 1YDHA 3QPWA 4K1XA 2O20A 1NLFA 3TZHA 3MSCA 4D4HA 4Z1MD 2YX1A 2PFSA 2DT8A 2GVNA 3A2MA 4U9HS 2P6MA 5GJVC 1WD7A 3V1TC 3NALA 3OZSA 3EXAA 3OKFA 3D3EA 1L5QA 3JQ9C 1EDZA 1G7SA 4RMNA 4XD7A 3HM9A 3ROFA 3RPHA 4I8DA 5FO0A 3A4NA 2M1ZA 2XDQB 2VDQB 1DHRA 4UVEA 3IXQA 2Q3HA 1CY1A 4OQZA 2W2VA 3A7DA 3ROQA 1C9KA 1HG0A 2QTRA 3QVTA 4FLFA 2Q62A 4HAIA 1KQFA 4A0HA 1CY8A 4PU0A 4ZICA 4MS3B 3ZDYB 4MDEA 1TD9A 2CFRA 2ZAGA 3LC0A 1YI1A 3I0ZA 1DOAA 4HGOA 4X24A 3MUNA 4F21A 4ZKEA 3DE4X 3VKHA 1KYXA 2VWHA 2DBQA 1TYDE 4IDPA 4MUJA 4MWDA 3R0JA 4PGGA 4MVJH 2D13A 3AB8A 3VZCA 4P0QB 1OKKA 1VJCA 2NZ8A 3TOXA 1Z88A 1P74A 1FP4A 1XN1A 2P5UA 4K40A 4RDIA 2GXQA 4EA8A 2BGJA 3QG5A 2R2GA 2O0JA 3GRRA 3GIDA 4HB0A 4ND7A 4WHMA 4D9GA 3DPSA 3EG9A 4HWTA 2ACWA 4CLRB 3EIEA 2OHHA 2OGUA 2X1LA 1SXJC 4GSYA 3NC4A 3KT3A 4XFDA 4X92A 5BMVF 2Q2VA 1T0IA 3SM9A 6AT1A 5LQMA 2Q3EA 1B73A 3LPLA 5FBWB 2GZHA 4EGCB 3DEHA 4QF5A 2FZGA 5DDIP 1X7ZA 3D4LA 3KOWA 3PNLA 1X1AA 3IHWA 3LPDA 5AM5A 3TLGA 3HB7A 2DVMA 1GCGA 1C2TA 1D0IA 4Q4LA 3R3WA 2IW3A 3TW8B 1U11A 3BF5A 4K8TA 1EFRD 3WA7A 1V8BA 4UCQA 1V11B 4MO9A 2A78A 2CMDA 3NP7A 4ZU1X 3EVDA 1W52X 2AX3A 3UFXA 1LV8A 3WIEA 1TX4B 2PXXA 5BMOA 3SHTA 3THXA 1Y5MA 3RS2A 2QNBA 1SOUA 2GQ0A 3RSQA 1W4ZA 2BEWB 1B3RA 2HIHA 4Q12A 5IHXA 2AM1A 3IOCA 4ND6A 4ZDIA 3OQVA 1XA4A 2VLIA 4X7RA 1U0NA 2QRHA 1N0IA 4NV1A 3ZH9B 1XKTA 4IFEA 4DU5A 1E5VA 2W2NA 3AFMA 2PBFA 4S0XA 4XOUA 3BREA 2HEGA 5KYXB 1LBIA 3QXXA 1ANKA 4B6JA 2YJ5A