3RTBA

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima soaked with adenosine-3'-5'-diphosphate
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
490
structure length
490
Chain Sequence
b'HMKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
molecule tags Lyase
source organism Thermotoga maritima
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
total genus 179
structure length 490
sequence length 490
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rtbA01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3rtbA02
1RKDA 3I3YA 2PKKA 3KEUA 3LJSA 1LIOA 3Q92A 4GM6A 3NCAA 4KAHA 3UBOA 3OTXA 3RTCA 1GC5A 3GO6A 3IBQA 3NBWA 4JKUA 3Q1YA 4S1HA 4K8PA 3UQEA 3RSQA 1L2LA 2C49A 4S1IA 1RKSA 2HW1A 2I6BA 2A9ZA 3NC9A 3RQHA 3RTAA 1RK2A 4E69A 3DZVA 3HICA 4DC3A 3UQ6A 3IN1A 1ESJA 1UB0A 3NL5A 4LCAA 4U7XA 5CM5A 3RPZA 4S1IB 4K8TA 3KTNA 5BYEA 4B8RA 3GBUA 4E8YA 2AWDA 1UA4A 4O1LA 1U2XA 2DDOA 3NM1A 2AJPA 4E84A 2DG2A 3RQ8A 3ROXA 1JXIA 3RSFA 1RFUA 1RKAA 3RY7A 3KD6A 5BYCA 1VM7A 3UQDA 4PVVA 3RTEA 4C5KA 5EYNA 3RU2A 3HPDA 3PZSA 3RU3A 4K9IA 3RSGA 1LHRA 2JG5A 3D3KA 1TYYA 1V1BA 3QA2A 4K8CA 3B1QA 4LBXA 3UMPA 1BX4A 3RO7A 3NBVA 2AB8A 4WJMA 4KBEA 5BYFA 4O1GA 5C3YA 3B3LA 5F0ZA 3RTBA 1V1AA 2C4EA 4KANA 2JG1A 2AX3A 5CGAA 4E3AA 4YWRA 2PKNA 3UQ9A 4XDAA 4S1MA 3IE7A 2QCVA 1LIJA 3NC2A 3RPHA 4C5MA 3PL2A 3IH0A 3RSSA 3RNOA 1KYHA 3D3JA 5C40A 2ABQA 3RTDA 1LIIA 1VI9A 2F7KA 3W4SA 3NM3A 3BGKA 1V19A 1YHJA 4N08A 3GO7A 3LOOA 1VK4A 2R3BA 3ROZA 3VAQA 3RQXA 3H49A 5C41A 2DDWA 3EWMA 3JULA 4B8SA 4X8FA 3B1PA 2NWHA 1YGKA 4XF7A 1TD2A 3RQ6A 5TRWA 2DCNA 4C5JA 2PKFA 3MBHA 1C3QA 3NL2A 3RT9A 1V1SA 3FHYA 3CQDA 2Q5RA 1TZ3A 1EKKA 1ESQA 3RM5A 1YGJA 3RTGA 4K93A 1WYEA 1LHPA 3ROEA 3RS8A 2A9YA 4EOHA 4DU5A 3QAIA 3RQQA 5TQIA 2YXTA 4LBGA 2VARA 4N09A 2DDMA 5CGEA 2I5BA 3LKIA 5B6AA 3B1OA 1LIKA 4XCKA 3HYOA 4C5NA 3RRFA 2QHPA 2R3EA 3FHXA 4K8KA 3IKHA 5C3ZA 2HQQA 3B1NA 2O8NA 3RRJA 2HLZA 1GQTA 3RREA 2PKMA 3RT7A 4C5LA 4EUMA 5BYDA 4YL5A 3BF5A 4KALA 2ABSA 4JKSA 3N1CA 1TZ6A 4KADA 3VASA 4UBEA 2F02A 5F11A 3RQ5A 1DGMA 2XTBA 3DRWA 3ROGA 3ZS7A 3B1RA 3RS9A 2JGVA 1RFVA 3NL3A 4XF6A 2YXUA 1EKQA 4E8ZA 3NL6A 2AFBA 2AJRA 3MBJA 1JZTA 4LC4A 4E8WA 1RFTA 3RRBA 2AA0A 1JXHA 2FV7A 2V78A 3RO4A 5EY7A 3K5WA 4JJPA 3K9EA 3RQ2A 3LHXA 5COJA 2RBCA 4EN4A 2I6AA 4K9CA 3UMOA 3IQ0A 3KZHA 4EBUA 3H74A
chains in the Genus database with same CATH superfamily
2GXSA 3S2ZA 2ZUVA 5DBOA 1M2VA 1OV4A 1M8KA 1NJ2A 1Q15A 2R97A 4E12A 4JEIA 2J8ZA 3H4TA 3UGTA 2Q6TA 4IIBA 3FPHA 1KOGA 2C9ZA 4H3HB 4D81A 5C4GB 5DYTA 4AP9A 4R1OA 1C9MA 2QGFA 1ZHOA 1NXVA 3QVJA 4EHIA 1DJLA 4BMXA 3NC0C 2CXTA 5D84A 4KPEC 1XD8A 1Z0FA 2GK7A 3NTUA 4Q7JB 1UFVA 1KY5A 4HMOA 3EPLA 4B9EA 2Q5JA 4ER6A 1X7YA 5EEGA 1CBUA 5L53A 4IDFA 3AVXA 4WHMA 4I55F 2QRKA 1FFYA 4E4TA 4B6GA 2P3LA 4M1TA 2IXFA 3KD3A 3OTOB 1Y7IA 2YBEA 2GO1A 2SHKA 1UOQA 1DI0A 3IBTA 1G0OA 3OMLA 3JQ6A 3P9ZA 3R20A 5DHUA 2VK8A 4KV7A 3K4PA 4F3CA 5B6JA 4MHOA 2JGLA 1E5QA 4QJ3A 1J42A 2XITA 2ZK7A 3P9YA 4KXXA 3GWGA 3ZQUA 4K6CA 1IZ0A 4RHTA 3KBBA 4RIGA 5H81A 3MMXA 4M0LA 2B8TA 4NOJA 3B3LA 1T6NA 3I2JA 4N5LA 3CEMA 3JQEA 4JVMA 1XT6A 3HP4A 1JFRA 5IVIA 1YBVA 5DM70 1MIHA 2NU6B 3OZWA 5G3ZA 3ZQKA 4BLQA 4X61A 2ONJA 3G8BA 4GE0A 1QVVA 1CX9B 1VYHA 1WD5A 3LX4A 2IU4A 1FXSA 1E1QD 4ALNA 1C8VB 1ULAA 2XI4A 3FJ1A 4E5KA 4Y0AA 4RZ2A 3ERCA 1U2DC 4GHWA 1AUVA 2EQ5A 3AHHA 3OI7A 4P54A 1J5XA 3CX6A 3B5EA 5F9FA 2XCSB 2PFGA 5B7PA 4L6IA 4M0UA 4XKJA 1ZR4A 2ZJ2A 4F2DA 2QL9A 1GIAA 1QB7A 4RACA 4UAGA 2OP0A 5SV2A 4TYNA 3KOOA 1GQ2A 1NYQA 4LE2A 3D0KA 1CDEA 3AL3A 5EPEA 1AQLA 1WV1A 2DHQA 3NIGB 4HDSA 4RCZA 4Q9LA 2X86A 1GV1A 2C31A 2JFQA 4BFYA 4V0SA 4O4IA 4H77A 1C7RA 2H1VA 3E9YA 4KQKA 1L5LA 4D0LB 3UKDA 4CM8A 5ALEA 2BZGA 1UMCB 4ZTBA 1I5RA 3OX3A 2V59A 3A6HA 1SEPA 3S2SA 1PN3A 4UCQA 1RLJA 4Q82A 2ZT8A 4DJFC 5EJ7A 5DRTA 5L95A 5LN1A 3PUXA 1E0JA 2V7UA 1Y3DE 2B69A 4RADA 2OAP1 4C5LA 4AMGA 4QOSA 4Y6QA 1W96A 3HDYA 3S29A 5DRYA 4BV8A 4TZTA 2TS1A 4PGFA 4NJMB 2J87A 2JIZA 3G8DA 3IQDB 4FYYA 3WB9A 1NMQA 4IXNA 1I6KA 2YJTD 2H65A 3C48A 3C6KA 3F3SA 2AS0A 2QNRA 2PRSA 4BCCA 2I29A 3UJDA 1HNXB 4LYGA 3TQTA 3X3HA 1WVMA 2CSXA 3RWBA 1U28C 4OSOA 4W5HA 1AA6A 2AHRA 2ISCA 2NYVA 5FBKA 4FS3A 4XSGA 4CMAA 1L3IA 5EYPB 5FWNA 4EN4A 1O94A 3ZWMA 2QY9A 2XWSA 5BR7A 3UJNA 2BBTA 1T0HB 4HNAB 3I5XA 1GG8A 2P90A 2R11A 3VZRA 4GM6A 5BURA 3OEHA 3K9BA 2O2CA 3EPJA 1DTWB 1K86A 3HDHA 5DNAA 1CQIA 1ISPA 1N0WA 8MHTA 2P40A 2PZEA 1IBKB 2GFHA 4K8PA 2DPLA 2XUGA 1DG9A 4ZDIA 4E31A 5I5EA 4NU5A 1L2LA 1MC4A 2HK9A 3KVRA 3HVRA 5E2AA 3GJ0A 3KWJA 4D2IA 4EH1A 3RQHA 4R51A 3R5TA 4YONB 1Z8FA 4Z49A 1E2QA 1CDZA 1ZUNB 2IV3A 3R23A 1P4SA 1T8SA 1XRPA 2VRNA 1R0YA 5LMUB 2XF2A 5EIHA 1L4MA 5CJJA 3VHRA 4COOA 3HDQA 5ITWA 4QT4A 3KTNA 1CJSA 4GBMA 4HLDA 1SQ0A 5BN3B 4BNJA 4CKBA 4GI2A 3WOHA 4IYRA 2NXWA 3W3AH 5JZMA 1VGVA 2XAUA 1V3VA 1XKQA 3A4LA 1JG2A 3AKEA 4G5FA 4S1NA 3SYLA 4RFVA 2B98A 1Z4KA 3JD1A 1IY0A 5K6AC 5JATA 3JWJA 3C43A 3H19A 4R8RA 4OLAA 3TXAA 3B60A 2EQAA 1ZMXA 4M22A 4BNTA 4RWEA 3QE9Y 3D2CA 2C5SA 3KHSA 1USVA 3Q15C 3I1YA 3ZC3A 3ETEA 3FR7A 3UMPA 1WNFA 1N2BA 2GZ1A 4B34A 5ALQA 2D5AA 1IIRA 4HVLA 5FTLA 3L7KA 4WK6A 4OXNA 4KC0A 2UYGA 5ARDA 3H17A 3GQBB 1HQDA 2VJCA 2NSYA 5CLGA 4YS6A 3MBKA 1O5OA 4KG7A 5JH7F 4DKJA 2CJFA 1CUHA 3FPJA 4HUQA 5F4BA 3V8VA 4BTLA 2ZIFA 4LYFA 3EIOA 4C76A 4YRMA 1ZGAA 2B4QA 2A9KA 3V4LA 3X1XA 1W5TA 4PYJA 2BL4A 1M66A 3UJCA 3HY3A 3AHEA 3T38A 3G0HA 1AIPA 2WF6A 3AL2A 3BXZA 4Q3LA 2DEUA 3FVRA 3X1YA 3R40A 4PAMA 1ZGGA 1EWTA 1YZUA 5HOEA 1PZGA 1UKYA 5IANA 3RT9A 1D2AA 3K8OE 3U5TA 4YV2A 3NTXA 1ESQA 2IS6A 5AOAA 1R0CA 1KVRA 3DZHA 2VDQB 4TQGA 4XWOA 5ITZA 2CWWA 1EYZA 1NQTA 2JVJA 1JXQA 3DVQX 3HYTA 2Z09A 3KKQA 4QJ4A 2OGUA 3QX7A 3THWB 4YWJA 4B45A 4OMCA 4F0JA 2XZLA 4GH5A 4Z4EA 1LIKA 4O4JA 3ILYA 2Q1UA 3AEXA 1BXZA 5E7QA 1E58A 1S8FA 4UVHA 3NBMA 3EARA 4G0QA 4I5DA 4WW0A 1YWGO 2BRUA 1DELA 1VOTA 1YMUA 1MFZA 4LRUA 4CLHA 4TN1A 4ZCLA 5K0GA 3L8EA 2B61A 4UM5A 1E1CA 5CK4A 3LFHA 1PCXA 4QQFA 2UU9B 4PC7A 1DKMA 2FV8A 1AHIA 5A5FA 3X2EA 2AMFA 3RS4A 4W5TA 3AZPA 2VZ9A 2Y0CA 3IVRA 1BXGA 1OLXA 2FV7A 5JFGA 4S24A 3GEMA 2PD3A 4Q03A 1P0IA 4B4OA 3IPRA 1AUXA 3NM5A 4BFTA 4PC1A 1DEOA 5TX7A 3I9NA 3C74A 1OT5A 3AB8A 3F67A 5E7IA 3X0DA 1A71A 1X74A 4WNCA 1UR5A 3TRHA 2ANBA 3RASA 4R1LA 4R7GA 6ADHA 5KB3A 3TZLA 2GASA 1OBVA 2IYSA 4BC0A 3E3NA 2AD5A 4DY4A 4ZOAA 2ZT6A 3MB8A 5AHOA 1UC9A 2ZATA 4Q9KA 5L6MB 2FETA 1TO1E 1XZ8A 3DEIA 4GQAA 5CFQA 1M5RA 1KAQA 3O95A 4O2AB 1QIFA 1LWOA 5DM1A 3SYRA 1H65A 3AILA 2WR8A 4NQZA 3S2YA 4N7BA 5T8KA 5IYZB 1CYEA 5EUCA 1J2YA 3SJAA 2OFPA 4FC6A 2PUCA 5IDXA 1UCFA 1CNFA 4E84A 2QBYB 2JGKA 4OQPA 4J0GA 3DE7X 4OQNA 4RF3A 2HIGA 4EY3A 1BX1A 3BAFA 3IAUA 4W7SA 1WZIA 1RHUA 1CUVA 4M37A 4URFA 5BYCA 1NLMA 3VA7A 3M6FA 1XLWA 3F9RA 4IIFA 4WKPA 5BOSA 3OESA 1C3OB 1XFAA 3M6AA 1M73E 5LB2A 3VC3A 3R9XA 3EEIA 3QLUC 4IF6A 1WQ3A 4Q0MA 4DA0A 3KYBA 2QM7A 1N5LA 3GBPA 2E6KA 3QUCA 4RE6A 2QTVB 4EA7A 4YRNA 1NVUQ 4Q3DA 1V47A 1AUOA 2BEVA 1X77A 3OOJA 3IQIX 4UARA 1IZ7A 1L7RA 4JU8A 5LDHA 4I9UA 3OTGA 4ZRNA 1ONOA 3U44A 1EVKA 2DHEA 5E4YA 2K2QB 2P5SA 4OM8A 4BKOA 4YFVA 4BUJA 4II2A 4WZBE 3MQ4A 5DGCA 3T0GA 5JXGA 4I5FA 5FLXA 3ILSA 4Z9BA 3U7JA 3L0PA 3CZPA 1RRCA 1Z15A 4FDVA 1BHSA 1WMSA 2ECKA 2VAXA 2RD2A 1TL7C 3ENWA 1M6VB 1WBJB 4TRMA 5HE9A 3SJUA 1KZ7B 1GV0A 1K6MA 2BR5A 3RFFA 3KB2A 3MC1A 1U98A 3D4PA 1Q7RA 1KDTA 5FWYA 3B1PA 2QVGA 3LF2A 3PD1A 4C4TA 3DLCA 2CLMB 1ZMTA 4P4SB 4MW7A 1YNOA 5DNEA 1HRKA 1IUNA 5EIXA 1JFFB 3C8DA 1UQRA 4Q24A 3VUEA 5TT1A 2IC5A 1GQRA 4I6JA 3TTYA 2KHZA 2NO0A 3M6MD 3LOOA 3KAPA 1RCFA 3ROEA 5B1DA 5EP4A 3TTWA 1W36D 3U0BA 1DOHA 4WECA 1F2DA 3M1YA 4ARZA 5DJ5A 4H7JA 1I24A 3SGLA 1CF9A 4E14A 4EJSC 2HU8A 3NDJA 4AF6A 3IB3A 1NI4B 3SVLA 2JJQA 2I2WA 3KV3O 1NLYA 3I9MA 3RT7A 3ZDDA 4EMUA 4D45A 3GVHA 2A58A 5ETJA 1SVSA 5FWDA 4CLOB 4EW3A 1AKWA 2FW1A 3DEAA 5EHQA 2W8BA 3NO4A 1N8KA 2PX3A 2W7TA 4MUYA 4NZPA 2QGNA 4MKIA 3AJ8A 5FBVB 1T1RA 2R1VB 2ZSEA 3EJ6A 1X19A 1P17A 3K1YA 1ORDA 3UJBA 1CY6A 1MO4A 2G9ZA 4K6HA 1NYLA 5DF1A 1K4YA 2BGUA 2OD9A 1SK9A 2JIMA 4XWTA 4GAEA 1JDVA 3I73A 2GD0A 3CLVA 3G0DA 3LDHA 5JMPA 4ZYWA 4HNVA 4ZK2A 4S1PA 2PU7A 2HEGA 3G49A 3BGIA 3ZVNA 5HKKA 4JB8A 3AHGA 4QATA 5AM0A 1LIOA 3LJSA 3TG8A 2JPDA 3K9WA 2PKWA 3KYDB 3A26A 2F9FA 3AM1A 3V8BA 4LMRA 4I55B 2WIFA 1VRCA 1K92A 2ZRHA 1WB4A 1DARA 3I0NA 3IHWA 3NEYA 4HDMA 4OUDA 3V46A 4DDWA 1OXKB 1H9CA 3DKPA 3D7SA 4UMDA 1QHFA 1ZXBA 4E5YA 4Q9IA 4KPYA 4YRPA 3WX0A 1LK5A 5DN9A 5KYTA 1J6UA 3UBMA 1ILEA 1CY1A 1TEZA 1H1LB 3D6UA 4JLWA 4RLHA 3ZHCA 1JAHA 6PFKA 3ICQB 5E9QA 1SXPA 1U80A 4DC9A 1A72A 1SULA 2J3QA 3HUFA 1KXJA 4HY3A 3HA7A 4ND4A 2HL6A 3FF4A 4NDNE 4R0NA 4TXHA 4ZCSA 5J2TF 1MJHA 3LLVA 3L02A 4WA7A 4RNDB 2AJPA 3AP2A 4H1TA 5FRDA 4XOIA 3D8NA 4DV2B 4HGYA 2O48X 1WF6A 2F67A 1XTRA 4P3KA 1K5GA 1YU6A 1MOZA 3U2QA 3N2YA 4YH1A 4AY4A 4IRXA 1EUCA 4YMIA 3VMFA 3PQCA 4RCVA 1G4AE 5AQ1A 8OHMA 3RU2A 1JLMA 3OZDA 4J2HA 4YDHB 2ZYAA 3K2EA 2QSYA 3RVJA 2BISA 2GPBA 3DFUA 1R0RE 4HJRA 4BASA 3BRWD 4E30A 4YX9A 3OETA 5JG7A 3B1XA 3ZDAA 3SC4A 1I4DD 2FG5A 5IMBA 3PLAE 4GXNA 5BR1A 3ZHVA 4QLAA 1GQYA 1N5RA 3MTBA 4JQZA 4ZMRA 1YRQA 1GOTA 2IKSA 2ID9A 4ISBA 4Y1GA 4LKOA 4C5MA 3A7EA 1QQTA 1KY2A 3L93A 4AZ0B 2OBYA 2WI8A 3BJRA 3RYIB 2QI9F 4JGBA 2FPRA 2DFPA 2IYWA 1LIIA 2FJUA 3O73A 2NO7A 3HJGA 2Y99A 1RHMA 2EJWA 1P7VA 3GUYA 2HREA 5CLFA 2R6R1 3RVMA 1DMRA 1T26A 2BFCA 1NJ1A 3R3YA 3HXQA 1PEDA 2NXEA 4Y8VA 2OHHA 2Y1OA 1WXGA 3JRNA 3NKLA 5A5DA 5LU8A 2HI0A 4FILA 5AJHA 5JCZA 4PSDA 4AAYA 3EBOA 4UNSA 1TZCA 4FC7A 5CFLA 3ICEA 1GAJA 4YCBA 2CLSA 4DM7A 3VNUA 3UB4A 2Q5EA 3BQ9A 4KGZA 3NNDA 5CMLA 1UP4A 3CY6A 4XDZA 5CGQB 3EIQA 4N3AA 4W7HA 3R7FA 1KFJB 5JY6A 4OLBA 2H16A 2SNIE 2XWQA 1AO0A 4Z4CA 3KKLA 3DB1A 3F5QA 3BDVA 3PFGA 3DDNA 1RWQA 3THRA 4D8VA 2C8KA 3REFA 4AJIA 3AF3A 3OD5A 4OLFA 1FLDA 3MBOA 2JJ1D 4KHZA 1XX6A 4G1MB 1TCCA 4KE6A 3N8NA 2R68A 3BH6A 2OQIA 3V3TA 2C00A 3DOIA 1UT5A 1AQYA 4NH0A 3RS9A 3VTAA 3C4QA 1GGFA 2C1ZA 4QPDA 3MBJA 2ZSKA 3L7DA 4WV3A 2XCQA 4HHEA 3IP6A 4NV3A 4P82A 3M2PA 3PHGA 4P5PA 4JJPA 3GNQA 5BQPA 3RYCB 3UG6A 3QFTA 4QD3A 1GITA 4XH9B 2WPNA 1ZVVA 1DINA 4OOEA 1M2WA 2QPLA 4EGCB 4KI0A 3GXBA 1B15A 1NVAA 3KC2A 3AU8A 3A8TA 3C5CA 5DSTA 4ZEWA 2WYWA 1V35A 4Q19A 2ZYGA 2ORIA 4DLAA 4RK4A 2C49A 1V43A 3GAFA 2GNOA 3KETA 1ZW6A 4XX0A 1ML4A 2CJPA 4JBYA 3OLWA 2VQ6A 3JAWA 1MC5A 3IE1A 5ESWA 2V5VA 1SQSA 4BN4A 4XWGA 1NNSA 2RB5A 4X7PA 1N9KA 4D9BA 1ZEJA 3WXMA 4DBVO 5C81A 1I01A 2VPXA 1RC8A 3BL8A 4HGZA 2I34A 2R1ZA 3DQPA 2IIPA 3C16C 1T35A 3GLGA 5ELMA 4BECA 3EZ7A 4MMXB 2ZJ7A 1G17A 3UCXA 2GEVA 2X5KO 1DKNA 1YR9A 2P2YA 4QTXA 2X4LA 2BE7A 1PV1A 2ZBEA 4MP6A 5CLHA 2O5EA 2RJ3A 5IC4A 2VJDA 2GJ4A 1NSFA 3DE4X 4JSYA 5D51S 5FI1B 3IBGA 3GIDA 2HBQA 2ATIA 4BQNA 2G72A 3OP1A 2HRCA 2LW7A 3GRKA 3QJ5A 1LVHA 1TA0A 2EWMA 1T8YA 4HEHA 4HMPA 3IBCA 4KYVA 3BMCA 4I9NA 1BMTA 4U7PB 3WYNA 1CW2B 3O8LA 4CIXA 3D1LA 1DX4A 2V45A 3EF0A 3WJAA 4DKXA 5E4JA 2WJ6A 3G2HA 1DFIA 4ND3A 2OORA 3RIMA 1KZHA 3E9RA 4ND6A 4KR7A 4AQ7A 3UUGA 1XCPA 1K5PA 4CE6A 4IFEA 4WOPA 1X6VA 3C3KA 3OQMA 1R10A 1EHCA 3KAQA 3L46A 3KSAC 3OF5A 3G59A 1QK3A 5KKNB 1DAFA 1NPTO 2WUFA 3HR4A 3TQHA 4DRZA 1Q19A 1GQFA 3R7NA 2IVZA 1KS9A 4IG4A 3JZMA 4LXQA 1N0HA 3IOEA 1P2DA 4K9NA 3HCCA 3GT0A 3LCVB 4IHJA 3BWDD 2XLCA 3EVDA 3NAMA 4E88A 3TTVA 4RGBA 2QX6A 5IJWA 3BT7A 1V1SA 3VH4A 1XQYA 4WXEA 2JAOA 3HKCA 3PXEA 4C20A 1UQUA 2WKRA 1KMMA 3LHFA 3OKAA 3LY9A 4HYEA 4CF6A 4IDBA 5FOUA 1FTWA 3SDSA 8LDHA 3ZWYA 1EFTA 2O7SA 3X43A 3DMRA 3KYIB 4WNIA 3N8KA 3U3JA 1IM2A 3C8ZA 3A3NA 3CKMA 4UCXA 4P31A 1ICIA 1KPHA 1M67A 2XX3A 3CTPA 5AVJA 4YYEA 4BNUA 3GQBA 1BE1A 1I3LA 1MORA 2IZ5A 2WAXA 3NTQA 3OX2A 4KAXA 4YXWD 1XLUA 1CIVA 4UQOA 3H5LA 4ND2A 3CF4A 1NC3A 3OLQA 4FKMA 4RNCA 4JCCA 4L51A 5C7OO 3IEUA 4PX5A 5FOQA 5ICEA 3DONA 4GQBA 2W6ID 5C5IA 2WZCA 3R3UA 2FH5B 4ZI3A 4YIHA 3CW9A 3PZRA 4FGZA 3SQOA 3FHLA 4YQZA 1HMYA 2WZQA 3BM5A 4ZQGA 4ZA2A 2FN4A 1A4IA 3I42A 1YZ3A 5BNFA 3IQZA 4RJKA 5AW2A 5BYBA 1Q1NA 1JG1A 3OPYB 1AS2A 3CLTC 2YHBA 5A1TA 2ZWAA 1J9ZA 1PJBA 2VQDA 3DGEC 4G81A 1GUYA 1HL3A 3ABSB 4NCNA 4NCXA 1C3VA 1BKYA 3OTXA 5H82A 4GZMA 1ZUNA 1KZGB 1O6FA 1KE1A 1E5XA 5K0BA 4UUAA 1A7KA 4B6JA 3GFRA 2JB9A 4BUZA 4BVJA 1NG1A 4TWJA 1RQNA 1T6YA 2E2WA 2I4NA 2AYZA 3ECAA 2E82A 3W3AA 2AL7A 3I9LA 2A8YA 1K6IA 4B6EA 4GYJA 1IBLB 1TM3E 2GNPA 2P3QA 3TIIA 3R8FA 4CTMA 2E5WA 3K35A 2IHTA 4HX5A 1G38A 3SHQA 3KQQA 3CU5A 3V2UA 1K3UB 2MSEB 1VPVA 4L85A 2NU8B 2G7MC 2Z58A 2QG9A 2W6PA 4LJ7A 2Z08A 2G06A 3HO6A 2HZBA 4JT2A 1DAGA 1XKXA 2BHNA 3CB2A 4N40A 1JHXA 2RBGA 5KNBA 1LF5A 2NAFA 3RY7A 2YS7A 4L28A 3W2TA 4RK5A 2I7TA 4A03A 4G07A 1BH2A 2Y05A 5M2QA 1IZ8A 2C88A 1NW3A 1BDBA 1SUPA 4NAHA 2V6JA 3IESA 2XMGA 5TEWA 4Y2JA 2WUGA 2VSOA 4LDNA 1PD0A 3LLUA 4KLRA 1TA4A 1RM3A 3DBRB 2VF5X 5K3EA 1AS0A 4J6EA 4P5DA 3WJ7A 1CS0B 3UJ8A 1Z2PX 3DO5A 5AVUA 3PHBE 3P32A 4R2LA 5A6VA 2CY0A 3TW6A 3ASZA 1DWQA 3DE3X 1QH1B 1BWSA 5JSHA 2RARA 3BWYA 4RTJA 2OCKA 5CH8A 2V4MA 3PS9A 3W5IA 3MUEA 4K8RB 4I9GA 4LBWA 2H4YA 3BF7A 5SY9A 1PR1A 1ULHA 2V96A 4AI6A 5FTJA 4KBGA 2J9ZB 3WBJA 1U4NA 2AJLI 3BXPA 3KXLA 2KBEA 4HDNB 1WUTA 3HYCA 2YQ5A 1HOTA 2PLNA 4I4TA 2OQVA 1L4NA 5KQPA 3UOWA 4NCAA 1W2HA 1AKNA 1L4GA 2YRWA 3G2QA 3GVXA 3IDFA 3L7NA 2VYFA 2GESA 3D6HA 3E2PA 1V5WA 3GJ4A 4G4JA 4NCHA 2HA3A 3K9GA 4GPBA 4UJ5A 3RIGA 1ZNXA 1V5EA 1KH3A 3TTUA 4HX2A 4GOXA 1F5NA 3S68A 2Q0SA 1O4WA 1YGJA 1ZC3A 1L4KA 4BNDA 2QTVA 3PUIA 4C4AA 5K05A 2UYOA 1W34A 1C29B 4ZO7A 2WUEA 3DMTA 5IDVA 3ROTA 3PXUA 3ROMA 3FNBA 5BYJA 4JJ6A 3ROFA 1I2BA 3KJFA 3M9LA 4KJZA 4J0QA 5LCXA 3GFPA 4CM6A 3GROA 2IRWA 1U6IA 1E1CB 4ROTA 3KUKA 2IYFA 3WGVA 1NRJB 3U16A 1HT3A 2HO5A 1MH1A 5I48A 5MN5A 2PUFA 3UMJA 1W5SA 1RMTA 1GTZA 2X1LA 3O91A 5EQFA 4CMEA 1AO3A 1U0TA 3ORHA 1JPNA 2WT4A 4FYJA 4O4HA 4BKPA 2UVQA 3EOZA 3GRAA 4OI0A 1U90A 4AY2A 4XQ9A 4S1WA 1Z8DA 1ZJ5A 3WBBA 1SKAA 4U2EA 3WLHA 1SRQA 1EHYA 2H4FA 2H7YA 1OBHA 1QZZA 1XDWA 1U31A 4LRQA 4X85A 2WSBA 3T94A 5E1DA 3ZW9A 2BM8A 1DUIA 5FBRB 1JXHA 4OQLA 3G9QA 1BOOA 2DY0A 1VJCA 5BSTA 1YB5A 4XPIA 3K16A 2CVQA 3KPWA 1P4HA 4D8WA 1JFFA 2ZETA 2I6QA 4DLUA 1BD4A 3B1JA 1ENOA 1PFGA 2XXAA 4LV6A 2ZYIA 4P83A 4DHWA 5DN6D 2PU5A 3HK2A 2QSUA 2HJRA 2GSDA 2Y77A 5HS6A 1XZEA 3PDUA 4XCVA 5BN4B 3UQEA 1H3NA 4DR1B 2A9ZA 3UAWA 4NC9A 4QYIA 3WVNA 4B3BA 4URVR 1X9HA 4FW8A 3U7RA 2CC2A 3A0RB 1KJZA 3JD2A 4DV5B 1W2WB 1L3CA 1X42A 3OZRA 4EG3A 4PC6A 3DMTC 3ZHQA 4M8NE 1K63A 3BWMA 3IXLA 4X24A 4BB0A 3U7HB 3EC7A 2DDOA 2XOXA 2FR1A 4MUBA 1C0KA 2P6NA 3X2SA 1BQ3A 6AT1A 1NMYA 4Q00A 2NP7A 3W2FA 1PEAA 3CF2A 1ZMBA 4RD4A 1UK7A 4AN1A 3L06A 4N7RA 3RV4A 4EGAA 1P8AA 1U2EA 3KHKA 4R84A 4RY2A 3QX9A 4LYEA 4IQGA 1XVUA 5HF9A 2JHCA 3G9UA 3VNVA 1VL6A 3L7YA 4B80A 3KLBA 3AR5A 4K81B 3GELA 3O82A 1NJSA 3E8MA 2X5NA 4ZTUB 3P2JA 3IMKA 4HGRA 3QSYA 3PUJA 2YZMA 4OUDB 3SZUA 3KQMA 4P4UA 2Q9UA 4O2LA 1BGVA 4TTVA 1T15A 3NBYC 3CLUD 4YAIA 1V3TA 1S1MA 1D4FA 4MO9A 1N4AA 3WMWA 3UF0A 5IF9A 4MLPA 5JJCA 1JLLA 1G60A 1M7GA 3MTIA 3A10A 2X8AA 4HFMA 3O9MA 4PYKA 5FWYB 2CE2X 4EHNA 1KERA 4IGAA 4R40A 4DMHA 3KD2A 3NW9A 4AC9A 2MSNA 1FFGA 2JLQA 2XMBA 3MWYW 4RUKA 3FPCA 1J22A 1IY8A 3LM8A 4B6FA 5E3HA 4PG8A 3ADDA 3RH0A 2WJJA 3D43A 1H4VB 2QRHA 4GOND 3BL6A 1DT3A 3WZLA 3CSDA 3KLPX 1Q1QA 4GZ6A 3VMMA 4XYLA 2YKGA 2FR0A 1XUOA 2J41A 3LIPA 3PICA 2KWIA 3QUSA 2P75A 1G64A 3GN2A 3R8CA 1A2BA 3FOEC 9MHTA 3PR1A 1RWKA 4HYYA 2R6CA 1SGWA 5FWXA 3NM6B 3I4FA 4RVUA 3ZJYA 1UP6A 2KLHA 3UC5A 3UWMA 3IMEA 4YMTA 3LTEA 3GRCA 4YCSA 1VYUA 3E9CA 3JQ7B 3TTTA 2HQQA 2Q4TA 1IXZA 4LDRA 1QH0A 4DIDA 1LBEA 4UM8B 1A95A 2PSSA 1N9GB 2H1CA 3RS5A 1E2GA 3ZQ4A 3RT1A 4B7AA 1FRNA 1YGPA 4MI3A 3UJ3X 2QRNA 3AFGA 3GGPA 5DI3A 2F62A 4OCZA 3RAPR 3WL8A 1JECA 3IT3A 1DUVG 1ZU4A 2JEZA 3MBHA 1Y8AA 3DVLA 3HY6A 1UC5B 1FCJA 1QDUA 2DR3A 3R6DA 3MWEA 1UM8A 4CL3A 2QX7A 5CYFA 4EUEA 1PFVA 3GFFA 3M1LA 3TEJA 1LPSA 3HVHA 5IVHA 2AN3A 3FMVA 1L5FA 2ZS7A 2QRPA 3IR5A 3I5YA 1HI9A 1ZC4A 2GF9A 1OFVA 3GMSA 1VPWA 3PWSA 2GJSA 2IFTA 1ABEA 3HICA 4NNPA 2FPXA 3EDOA 5IDQA 4GKBA 3X1DA 2A9PA 1LV8A 1V2GA 1LZKA 2QMUA 3WGJA 3GMTA 4KO1S 1WZUA 2E4ZA 4EL5A 2YW9A 4UVIA 3U61B 3E9DA 2Y1EA 2I80A 3AERB 4KXMA 1MDBA 4E1VA 2IZOA 4L9AA 2B92A 4FZJA 4L8GA 1RI2A 1Z0DA 3PIRA 2ON6A 5IUKC 5FUMA 1NLZA 3G0OA 4BVLA 1QV9A 1JKIA 3DAGA 3MTDA 1MW9X 3S5UA 3RF6A 2GM9A 4N5HX 3VJKA 1ZNWA 4C87A 3H3JA 3OFKA 1PGOA 2ADFA 5CIWA 1GVNB 2XMZA 3EISA 3I8SA 3SPXA 3AYXB 5C8YF 2Z1MA 3I2FA 4GI7A 2DQ4A 2BZ1A 4MYSA 2NYRA 3L8YA 5EZYF 5JTUA 3TW0A 1QR6A 5ICFA 4YQFA 3GLQA 4UPDA 4PVVA 4E11A 5LOVF 3ZOZA 1S2GA 4MUIA 4IV0A 4WXRA 4KB5A 3STXA 2HADA 3V00A 5HJEA 1WR8A 1U1FA 4JH0A 2NT3A 3TXYA 3V1TC 4X0EA 1VHJA 3BWXA 5AXCA 4WN3A 1N2ZA 1QIJA 4PQGA 4L75A 1PFKA 5DX0A 5ENDA 1L9XA 3A1VA 2H92A 5T3YA 5AI4A 1U7ZA 1KY4A 3DJFA 4P80A 3F8TA 2A6PA 4ND1A 4JA0A 5KTRA 4G85A 1CQJB 2XRYA 4PZEA 5CJ2A 4DMCA 2D62A 1VJ0A 5JCJD 4WEQA 3LXUX 1L1EA 2BEUA 1LSOA 1R0KA 2LKCA 4C2AA 5AOVA 5G2OA 1XKLA 3Q9LA 3RS7A 4RJIA 2RK3A 4P86A 2E55A 3DO6A 3EVAA 3LZCA 5K2MA 2IP4A 3FYDA 2BFCB 2PQ0A 3VFDA 4R8KA 2QZ9A 3NR2A 3ZV7A 3GLGB 4EDFA 3VAQA 1MABA 2C3UA 3KKZA 4MYDA 5IAKA 3IODA 2HXYA 3T95A 4C4PA 1ESNA 4QF5A 3N05A 2Z5LA 3KU4A 4BNKA 1YSCA 3IKLA 4K40A 4MVJG 1XAHA 3NBFA 5K0FA 2B37A 1NG9A 5JBQA 2Q0HA 1GR1A 3DVAA 1CJKC 2Q4DA 3O2SB 5D6OA 1QGUA 5P8WA 2BGRA 1IG3A 2WM3A 4LC1A 1G8JA 3DL7A 3Q7RA 1QP7A 3OTQA 5IH7A 3FWKA 4ZOCA 4CM4A 1YO6A 3HHPA 3SDBA 4PTYA 1OZAA 3QAIA 1QF7A 2XT0A 4KN6A 4TMTA 4B3HA 3BA6A 3KJNA 4OHUA 1I5OA 5LSAA 4CKWA 4L9SA 1KI1A 2OV1A 2VWQA 2WKQA 3QVLA 3WHIA 3KR1A 4MUJA 3U39A 3C6MA 3HJTA 1AC5A 3ONFA 4EUMA 3NONA 4ZV4A 1U2GA 2XQIA 1HL7A 3CBQA 3TE6A 1VBFA 4DR2B 3QXHA 3VYUB 2C7OA 4TT8A 4Q34A 3IBFA 3MWJA 4PPYA 3ZU4A 1NF9A 1FLAA 2EOAA 5FOVA 2V7VA 2QU8A 2PR2A 4V39A 5KWIA 3BULA 4C3UA 2DPHA 4IVPA 1KAMA 3L5OA 4C12A 5KYUB 1O95C 2O54A 1B0AA 4X60A 3AKDA 3LC7O 2C20A 3RO4A 2C5BA 1CULC 2FFAA 1BFUA 4EF4A 3S1LA 1UIRA 1SB9A 1YRLA 4R1NA 5LWQA 5K8JB 1B2RA 2JHFA 2MSCB 3ESXA 5EP2A 1QC5B 2OD2A 3LUCA 1S6YA 2RBKA 3N7AA 4R83A 3RKRA 1Z82A 2F1HA 3JAWB 4DV6B 5EQJB 4EHLA 5A05A 4X00A 4S1HA 1FSGA 3QBEA 1YK0A 1BXKA 1O6BA 1VLQA 3S81A 3LQKA 2IEZA 3TRJA 2IBSA 3H83A 2YUTA 3NKVA 3CEJA 4LBXA 1V95A 2PS1A 2HQRA 3GZNB 4QXAA 5NLLA 4CF7A 4KKVA 3WV5A 2QZSA 4X1YA 4FOLA 4PRYA 2NP6A 2G5CA 1USKA 1GXSB 5LQNA 3AX6A 3EW7A 3KR0A 4LTMA 4PWYA 3NBXX 4QT0A 3OWXA 1KQ3A 1G21E 1ZH8A 3OQIA 4GO1A 1UFKA 4B09A 2IP2A 1PHPA 3MJTA 4RXMA 1YVEI 1FUIA 2O57A 2P2GA 2YASA 4R1SA 4Y1RA 3ROKA 2F4VB 2IF2A 3B52X 2INGX 4FYWA 4RANA 4AO6A 4HRXA 2AEJA 1YBFA 3DSRA 3LCJA 3N3BC 2EAUA 2DECA 4NCIA 3S0JA 1DLJA 3BCHA 5C1PA 5F73A 1Z6ZA 1PNQA 1GNRA 2VUTA 3FW1A 3B36A 3I2IA 2HIAA 3LVRE 4L5CA 4LEIA 1OYOA 4JA2A 3ELYA 4RHUA 3RG2A 4X93A 3CRMA 1U11A 3AGPA 4FMPA 3QU5A 4DBLE 3E7PA 3VU1A 4XVCA 3GY0A 1RMQA 5LP6F 2FR8C 4KPFC 4GQIA 1C8LA 2FF7A 2JCBA 2VYQA 3V7NA 1IDN1 2O8DA 1FLVA 2NUAB 4YJFB 1NF8A 3DE6X 1CUGA 1KGDA 1KNXA 4AK9A 2C2HA 3PDIB 1LKZA 1CE8B 3AR3A 3L4SO 4QE3A 4AN0A 4S1MA 5T67A 5EY5B 4RD1A 3R8XA 2VC2B 3QYAA 1Z0UA 1GLNA 2ZWIA 4B3MB 5K1ZA 4MMYB 3LC2O 4NNOA 4P4SA 5BP7A 5IG2A 5J23A 1AMNA 1MG5A 3K0AA 3EAGA 4JASB 4GNRA 2A57A 4CMIA 3AUUA 4K05A 4QJIA 4KQHA 3C41J 1ACMA 1A8IA 5TRTA 1CZKA 1DWUA 1L7QA 5TIIA 2Q5IA 5BMOA 3ZDFA 1S9HA 3H2YA 1QXSA 1X8XA 3PGMA 4NYMQ 4OUKX 4R2KA 2FPLA 3VVMA 5MGNA 2GCBA 1CR6A 1PTJA 1XZJA 3OJOA 2PD4A 2VNAA 4N3BA 4BRSA 3X2FA 4S3MA 4PNEA 1KVQA 5D6NA 2E48A 3MCZA 1IVNA 1ADYA 5BQXA 1MHTA 1LD3A 3GPLA 3KKKA 3IP5A 2LXNA 5C7YA 3ZD6A 1HT1E 1A5AB 1TKAA 2C4KA 2RHOA 3HB4X 5LFAA 2D6FA 1Z4LA 1WPXA 3VO1A 3P8ZA 3K2IA 1Y7TA 5AOBA 1RPJA 4DIEA 4QG3A 3QU9A 2WV9A 3CR8A 2YVQA 3V2HA 2FMTA 4P6VF 4A91A 3N0VA 2UXBB 3MNFA 2JFNA 3AEKA 4Q9DA 5FB3A 3D6FA 1KETA 1W88A 4K9KA 1P91A 4AYWA 4CCWA 3VR5D 2OPHA 5ULLA 2YHUA 1IM5A 2YV1A 5JVDB 3MMZA 4H7KA 2IOFA 1DEKA 1A9OA 1Y9ZA 3JTMA 5F21A 4PAOA 3I30X 1MCZA 3GPBA 5LNK6 3ID6C 1WDMA 3AB7A 1V39A 4KKXB 5DDIP 1W36C 1IMOA 2ZRDA 1DJMA 3KT0A 4KWEA 4BNDB 3H9EO 4G0XA 5GY7A 3D0OA 2FW7A 3OIWA 1I3KA 2W6JA 2GPNA 4G6ZA 4M21A 4IJ6A 3UUEA 1H1LA 5FBHA 3FE2A 5AVXA 1RQXA 3ZE1B 2TECE 3ZCSA 4IFIA 1W0JD 3TAUA 4DA4A 3ZBPA 4W6ZA 5EJ6A 1CU1A 4U2CA 4NYJQ 2XVMA 1ZM9A 2HDWA 4ZU1X 3FNQA 4BJHB 1QZUA 3TOVA 5BQOA 3MFYA 3PDCA 5G1PA 4FI3C 4WBSA 4Y9SA 3AJEA 3D7LA 1L4EA 1TO2E 2QUBA 3DKRA 5LBUA 4A4DA 1ZGHA 2PL1A 5DCYA 4ZTZB 3WAJA 3SSNA 3UAZA 2NMVA 1O9GA 2DG2A 4EI8A 1TT5A 2YFQA 1GFZA 3DAFA 2AG6A 3MCAA 3O8BA 2VAPA 5LPNA 2NXCA 2ONZA 3I45A 1E3MA 4HWKA 4B33A 1OH5A 3DMFA 5ESRA 4YWHA 2GM3A 3VH2A 2QUZA 4PSCA 1AMUA 2WM2A 3O3NB 4HYTA 1WXFA 2JHGA 3F47A 3OLXA 4FFVA 4MUKA 2PRIA 3NMUF 5D1HA 1HSOA 1PTKA 2A9OA 2AI1A 4C6TA 1GAEO 3GARA 3LHDA 1E7RA 2WYOA 2WLTA 1C3LA 4NPHA 1M1NB 3L0IB 4MWOA 4UHCA 1R0SA 4YJKA 1HGXA 6CHYA 5JD5A 2ZZNA 1QGOA 3EFEA 2JGFA 3A6GA 3S6JA 2PWYA 3AEUA 2QYHA 2ZE8A 4R7ZA 5JZBA 2MMCA 5EIOA 1SURA 1P39A 1EP2B 1QVZA 2A7QA 4LHEA 4DARA 5HRAA 4OXXA 1WCWA 1FS6A 4WXHA 2BGJA 1ZN8A 4N5MA 4OBXA 4UPVA 3UQZA 2ZTUA 4AULA 4DCUA 4EJ6A 4IKPA 4QDJA 1H2ZA 1F5SA 4M99A 4EITA 2QD5A 3H6GA 4RKFA 3ZLBA 4NAVA 4BOYA 1Z2NX 2FWNA 3KB8A 4PFKA 5J40A 5B58C 1ODJA 1ONSA 2JIOA 2PRYA 1AQJA 3D6AA 3L7BA 2MMGA 3P2OA 3EPKA 4MS1B 4D4KA 1E7WA 5EHNA 2QMHA 3FD8A 3RM5A 1CUCA 4BVFA 2W2MA 1IULA 2LBPA 3IDAA 3PWKA 3CF0A 1WO8A 2F43B 1EZ4A 1H2WA 4N65A 4Q4JB 2G9NA 1JWBB 3THYA 2WWRA 2Q4BA 5JPDA 1JR3D 4WD3A 4CQNA 4GUAA 1X15A 2K4MA 4O4HB 2YVLA 5AIAA 4CBVA 2PKMA 3I6QA 1UMKA 2W6MA 3Q72A 5ALFA 1VJDA 4LDAA 3ENKA 1ARZA 1NUHA 3PJEA 4YMHA 3TLYA 5CA1F 1EM6A 3QOWA 1SCNE 1QGZA 4MRNA 3BIXA 1TLFA 5AI9A 1EE9A 1OWMA 1E3JA 1W29A 2QMQA 5JNUA 2B2XA 1PE0A 1T6BY 3FNIA 1VSVA 3FG9A 4MGEA 4R9SA 5H1YA 1QTRA 3UXYA 2I6FA 5HDBB 1W5FA 3LIIA 1DFHA 4D4IA 3KSMA 3QF7A 1HEYA 4M9QA 4TZ0A 1SELA 3EBLA 4L4XA 3ZI0A 5HM6A 3A1WA 3A9RA 4LHWA 4QIHA 1JJFA 4I6GA 2CUTA 4JUDX 2Q3CA 4KAHA 4QYIB 5AH0A 3BB1A 5JCJA 2B4AA 1I94B 1XTZA 4BMZA 1JIJA 2WDPA 2QRQA 2QDKA 3O3CA 2BKEA 2O1SA 3GGJA 3W6OA 3QW2A 1GPUA 3O8OB 2FOIA 3M2TA 1ITZA 3HFJA 4WY8A 1SQFA 3H2GA 3QPBA 3VC7A 3CNQS 3EGDA 2BHTA 1T0BA 5LZ9A 2QM0A 1DC6A 1C41A 2PEYA 2QSZA 2X40A 4EPTA 4WBNA 3N59A 4IRMA 4EY6A 1U8FO 2FI1A 2EKDA 3DHNA 4OFWA 2BGIA 3Q8WA 4M1OA 1T4BA 2WRZA 2QR3A 2X13A 4O08A 4HAUA 1D6SA 3BWVA 2EW1A 3NTLA 3O47A 4P3OA 5CW2A 4MJ3A 3RSFA 4L5BA 4CODB 4FGWA 1J7JA 3C8HA 2UXCB 1EWVA 3PE4A 3WGKA 1OASA 3ICVA 1KI2A 5I7UA 2J9RA 1E0KA 3T99A 2BTEA 3VVBA 1V1RA 5KNDD 3B1QA 2J9FA 3ZY3A 1ELOA 1ZESA 4KXLA 4MWTA 5E6UB 3VR1A 2IYVA 2QG4A 2RHGB 3MWKA 4DPLA 1CZUA 3HJAA 2D0DA 2HN9A 4GX2A 1CETA 1PG2A 4YMUA 3ESYA 5GINE 3U6BA 2NO1A 4O1IA 2QL6A 1THTA 4UQPA 3HJFA 1TTHA 5CX1B 2WNSA 3QKUA 1WDTA 2HSWA 3AERA 3DMNA 4FCTA 3GH3A 2Y1LA 3R5XA 4HOYA 3Q5GA 2JA2A 4R0VA 1NRIA 2Y1GA 4ENVA 3TQRA 3G8YA 1SIWA 2FSPA 4MNTA 4D3FA 1R8SA 3TMAA 2A3RA 2C4NA 4OHWA 1P2TA 3VZPA 4QDOA 3VDMA 2Q6OA 2XODA 1NXQA 4MQ6A 3AFMA 3ZVKA 4CEJB 1AHPA 3KT8A 4OBWA 2EP5A 4IDOA 1I32A 2W00A 4QLOA 4TN5A 3IILA 3ZCUA 5KC8A 4NXNB 2OBNA 1CQXA 5HZGA 1EEXB 1MIOA 2WIDA 4QO8A 3TR5A 4ACBA 2OCDA 3BIJA 4QBIA 1FRQA 1ZUD1 4NOMA 4TUYF 3AVTA 4FDTA 1X2EA 2KLBA 3KWLA 4J91A 4K6MA 4R9UC 4JI0B 2NV0A 1S8AA 4P3YA 4ZKEA 2QXTA 3FHOA 2FZVA 1N3IA 5JPCA 5CVTA 3UJ7A 3KQUA 4LF8B 2ZUDA 3RROA 1C2YA 3HI4A 1PFYA 3U09A 3L4BA 3U4CA 2HM7A 2K6GA 3JYNA 1FUKA 1JHUA 2G5TA 4S0XA 5C46F 1EA7A 5I7RA 2C4MA 4JYPA 3RFVA 4WQMA 4AB1A 2BJVA 3G7UA 4M6WA 4PO8A 3ITDA 3MTAA 4OKNA 1SB8A 4U4AA 2QW0X 3O4JA 4Z1MA 2JL1A 4A0RA 4F85A 3CZRA 1UINA 1R0BA 2QT0A 2XTBA 2WTAA 2XBMA 1I36A 4AG3A 721PA 1EBFA 3NEPX 3P0FA 1F2TA 3EQ7A 3WZ2A 4UEQA 3IHTA 4PQEA 4CG3A 3GLFB 4ILEA 5FTKA 3A7DA 3V2GA 4ER0A 4MVJA 4NBRA 1TUEA 4CQMA 1H22A 5TLSA 4LF5B 3G8AA 1BHQ1 4I2VA 4HT3B 2NLOA 3H0CA 4KOAA 1QGUB 4HVCA 5MHTA 2WTZA 1TF5A 3H8WA 5ECDA 1EIZA 2DVMA 1K8ZB 2P67A 4URHA 2VOJA 3PNLA 4IDHA 4YN3A 1YR8A 2A78A 4KFRA 1TO6A 4XA8A 1CRZA 1QHYA 4FPXA 4QGSA 4LC0A 2A0XA 2XMCA 4KFTA 3D3QA 5KU7A 3M6LA 3ASUA 1NVWQ 3E6AA 3OAAA 4EEZA 3RC3A 1UIMA 3MGBA 1JEOA 4FOOA 1JBWA 2NTJA 3RNLA 1OZ0A 1MA3A 3GB9A 1GWNA 3E7FA 2BGLA 3QVUA 4HNRA 5CCXA 3NXKA 2FWPA 1US8B 1U5BA 2AW5A 2MHCA 3FMPB 4QPCA 3BPSA 1YCHA 1WSWA 3LAWA 3K71B 3EA4A 1VPTA 4DDVA 2XJ9A 1BSVA 1QRDA 4O0MA 1QGAA 4DQUA 3GJ8A 4KH0A 4Z5XA 5A4FS 5JU6A 1U0HC 2ZI7A 3QFRA 4XTRA 2FUKA 1U8UA 3KT6A 1SBNE 3OA0A 3G89A 1X7HA 4M86A 1RKBA 4MH0R 3AXSA 3RYHB 1XEXA 4DQVA 3O4FA 5M5BA 1CS0A 1BEZA 1XLVA 4FDLA 1AN0A 4IS3A 1UZLA 2AQ8A 4GRDA 4BQSA 5K8VA 4PFSA 1E98A 1NWHA 3RHZA 1ZYUA 3LY7A 4MEJA 2X7HA 1U7WA 2C54A 3L1HA 1B0ZA 3KKPA 3W5AA 3SBDA 3D4BA 1ZK3A 1G21B 2I3DA 2PL9A 3N87A 2W11A 4DR3B 1JT9A 3MWDB 2PX4A 4IG9A 5HRUA 3TZ6A 3TVTA 2XMSA 1Q83A 3NATA 5F12A 4Z0HO 2X9NA 2WTXA 1KWGA 2OC4A 2ZJBA 1L7PA 3LYUA 1EFPA 4I4TB 4R9NA 4EJFA 2DETA 1WKBA 4IO0A 5IT0A 3IE7A 1LIJA 3CLTD 3TYXA 3GEIA 2PBLA 4RKYA 1QBKC 2YV3A 4WBXC 5D00A 5IKXA 3GA5A 2ENWA 1WLSA 1FU4A 5JSFA 1HC7A 3BEOA 1RLIA 4P7FA 4HLUC 2GLUA 3SE7A 4D3DA 4ZVKA 1ZM4A 4D8XA 4ENRA 5B36A 3AG5A 4H27A 4V24A 4REMA 5G40A 3CWQA 3LUJA 2ZJ3A 3HGQA 1XCLA 3DOJA 6LDHA 4JLUA 3RVNA 3WHKA 4L1KA 3UYKA 3VR2A 1A5BB 2IXTA 5H83A 1TAUA 3EY4A 4EVIA 4REQA 3SWWA 4BNGA 4ZGGA 4PG4A 3HACA 2G71A 2VT6A 3NGXA 5FTMA 5HEKA 5K3CA 1W44A 3P96A 5H59A 2FSVA 2O7VA 3AFNA 3B20A 3BKWA 4C89A 3VTZA 2AK2A 2P6PA 4F9GA 4HXYA 1E0DA 2DDMA 4ENTA 4CEHA 1EVEA 5LUBA 1YMQA 2EKQA 1GGVA 2KX7A 2P9FA 2BCGY 3O83A 2B3DA 2Y66A 4MV9A 5CM8B 4CIYA 1F8UA 1A27A 1PDWA 2HCFA 4JJ8A 3HMKA 5FADA 2WVGA 1PLJA 2W48A 3D02A 221PA 3VPSA 2EF1A 4J2TA 1YD7A 3AR7A 4DREA 2YCBA 5LJLA 1RI1A 5FDFA 1GO2A 3ELWA 1VIMA 4X6UA 5C52B 2GWHA 1Z6PA 4YT4A 4YMLA 5IP5A 1JS1X 4MLDA 1VSTA 1FFXB 3O3OB 4KMSA 4A15A 2O8EA 4JVOA 4LI0A 2W6IA 4UBJA 4C13A 2ZU0C 3V1YA 4EVRA 2O5CA 5AW5A 2Q1YA 1NNEA 2DWUA 2P6UA 3A36A 3ZBTA 4G01B 4FIDA 3R41A 5EVJA 1BKDR 5U9CA 4EFLA 1RBZA 1YZGA 3QJGA 4U2KA 1XJ0A 1ZA2A 1SOUA 2VR1A 3QF4A 4HKTA 1HE3A 2EJCA 3ZWOA 3TAHA 3GZNA 1M5UA 5IWCA 5CLLA 3GO6A 1ORWA 5KX5A 2VH1A 2RC6A 1N4DA 3RC7A 3ZS8A 1O2DA 1CUUA 2BP7B 1W85B 3PR3A 1KIMA 4OP1A 3CJQA 4I08A 1Y3FE 3WK8A 2VTBB 2OQRA 1XQ1A 3K6SA 7MHTA 3STVA 1OOEA 5TNXA 1PR0A 3QNWA 4EEXA 1TUIA 1UB0A 4DLBA 4BBAA 1NI3A 3JAMA 1NN5A 1AM4D 5KHAA 1X1QA 3G6WA 1T29A 4S12A 1GTG1 4JBWA 1RWNA 1F0YA 1D6NA 2P9YA 2PL5A 3V1MA 4NU6A 4KSYA 1TAQA 1Z5WA 2H51A 1DKUA 2I2BA 2ZE6A 2GF2A 4XX1A 4AO7A 4D4HA 4WACA 4LWPA 4J0HA 4M1WA 5GJWC 3DV0B 2NZYA 3WYFA 3E1GA 4LHSA 2P5YA 2Q50A 2F6RA 5ALDA 4IILA 2JJ8A 5I9TA 1YVUA 3ZHOA 1LPNA 4RIEA 5BO5A 5CLJA 2NUAA 4Q7KA 2PIDA 1NSYA 2P2SA 2REQA 4NP6A 1NX6A 1LBQA 1QHNA 3RVBA 2GCGA 4G8CA 5LYJF 4BAGA 1TW2A 3EXEB 5I4IA 5HFAA 1G66A 4BV3A 4R1MA 5IK2A 3WHPA 2Q1XA 4C0WA 2X2OA 1XL0A 2G17A 2OY0A 1TXGA 3IPCA 4XD7D 1CZHA 1J06A 1FDRA 1V7PC 2R7MA 5JC1A 3CJTA 4DJJA 5I7WA 1D1TA 1YS9A 1X86B 3RS2A 1Y9EA 4XXHA 3U49A 1NMXA 1GNPA 3NM3A 3A6KA 3B8HA 5AJWA 2QZZA 1JEYA 4CW7A 1F9EA 3V33A 3MA0A 4B3DA 4RULA 2HMWA 1SUCA 1N3YA 2RI6A 1SG9A 3UWSA 1NXOA 3NHRA 4GGMX 5G0SA 3C3BA 5FPPA 1GGNA 2QN7A 2XMPA 3LFTA 3OPVA 5KOYA 1TNDA 3SF0A 2CEAA 1RC1A 3MVEA 3PF8A 4PLYA 3SD7A 1H4SA 5DTQA 4DW8A 3CLRD 5F7JA 4G1VA 5GQSA 4C5AA 1L3BA 2WP8J 2GK3A 4IGIA 1TLLA 3S44A 3UK1A 4C0JA 5EXTA 5CH5A 2VJPA 4OXIA 3C4JA 2GM5A 1V41E 1VCOA 3C2QA 5BPFA 1Y8ZA 4A8JB 3NRBA 1N5JA 4O2BF 2XCIA 4KPUA 4Y1EA 4U6QA 1QYCA 4RSMA 4JI3B 3MILA 4UD6A 4C5NA 2PBRA 2PT9A 1Y5LA 2IQIA 3PI7A 4Q7EA 4BQPA 1Y7LA 1W88B 3HJHA 2Y0PA 4GR4A 5FPHA 2ZJ6A 1V8PA 5EI5A 3N1CA 2GCPA 1O94C 2NZXA 5C8XA 5C34B 1FYXA 4WOBA 1XTBA 3HN6A 2V0GA 4LJRA 4KREA 3R76A 1HK7A 3GVIA 2JCSA 4OAPA 2D2EA 2AJ8A 2OCBA 3IKJA 1OCEA 3PTAA 3INYA 3TVYA 3H5TA 4MR9A 3V1LA 3EGXB 2NYAA 5EXDA 3RI3A 4QFBA 4LA4A 4XIJA 4N3CA 3UK0A 3VX3A 3SMQA 4DUZB 1Q7CA 2EDCA 2FDCA 1QM5A 4KYTA 3OSUA 2CBXA 2OYCA 1YC2A 2IP1A 2Q27A 1V6AA 3AETB 3F0TA 3HWRA 3ZIAA 5BN5A 2H2GA 2NTEA 3D8SA 1HNZB 1Q0UA 4CUJA 1O7JA 3AFOA 1CJVC 2AR9A 3A3OA 1JDUA 4PNHA 2A4KA 3EZNA 4WPGA 3THYB 5L4NA 1BMQA 5THXA 1WW3A 2FZ5A 2H11A 2XUZA 2W2LA 1KYXA 3CN9A 2VJLA 3DT6A 3ODGA 2ZWVA 3R9KA 4D6XA 9LDTA 5KHLB 3BILA 1JR4A 5FIUA 1IQUA 4IJMA 3VH1A 4O3FA 3R7LA 4FE3A 1ZXLA 2F4NA 1G7SA 1KXZA 2H54A 4TVOA 3QBTA 1UBRS 2F90A 3FNHA 1F38A 1GZ3A 1R6XA 3F7NA 4X1IA 4DMMA 4EQ6B 2M6RA 2E4UA 1PO7A 4MUEA 1RAHA 2C7PA 2C5HA 1PUJA 1UEIA 2C82A 2FW0A 4S2UA 3GLRA 3LPNA 3MGCA 4JBLA 3K0EA 3L04A 1QSGA 1J2EA 2O5VA 3PUYA 4C6TB 4E7PA 4KNWA 3SG0A 4IH1A 2B3TA 4TMWA 1W0KA 1F8GA 1I7DA 5IBCA 1EGQA 1JLRA 1LLDA 4ZZ2A 1E1RD 1K8YB 3RJTA 5CFNA 3O84A 3P1JA 1TYYA 3WP0A 4LISA 5D3MB 3TG2A 2AXPA 1G8PA 3H2KA 3TRDA 3VO2A 3ZHSA 1SBCA 3EY9A 5IRCD 2GO7A 4D9IA 1B6TA 1NVMB 2DH5A 1S3FA 2E4YA 2OBXA 1C9KA 2QLJA 4I9FA 4K9MA 3GLTA 5DSZA 5AVWA 5CVCA 1CDOA 5FLYA 1Q3TA 4WGGA 5K8LA 3ORSA 4YNBA 1FU8A 2B6NA 4WY5A 1N9ZA 2OT3B 2A9VA 1PUIA 4FGKA 5ENZA 1EFHA 2DX7A 2EL9A 1E99A 1IHYA 4LK3A 4LVCA 1Y1RA 1YRHA 4MYUA 2V6MA 2MINA 4TSFD 3NKFA 4Y7CA 1KJYA 4YLGA 3FUUA 3OBBA 3K70C 4G0WA 4F4FA 3W4SA 5F7OA 3QU2A 1UOPA 2YCLA 5JALA 4PBSA 4ZDJA 3FPLA 3R24A 4PLVA 2EGHA 3IV6A 4CTKA 2ZPTX 5K3DA 3VU8A 2VA9A 2X2PA 4MQUA 5EFZA 2AKYA 2O2DA 4GF5A 2CB0A 3E5NA 4LI3X 3UJ6A 1T8RA 3W3ZB 4CM4B 1KY3A 1E18A 5HFNA 3UV7A 3N8HA 5SZHB 1OLUB 4Q6WA 4TZ6A 2YC4C 4F2PA 4JK3A 2HWWA 4RU1A 5FUWA 3ONNA 4FOSA 3WKBA 3DEJA 5LQUA 4ESEA 4LVOA 4F1WA 1GYRA 2O06A 3RVPA 2FZCA 3I6MA 4X92A 4N5DA 4QAJA 2PS9A 1YCDA 1QMPA 2O4CA 4GWKA 2C7QA 3BZWA 4EIWA 4TMFA 3V9AA 5J43A 4KN5A 4ZT4A 1IRXA 4B3XA 1PGJA 2G9QA 4J29A 4OX9Y 3LKDA 1Q14A 1WZNA 3AW9A 3PQ2A 4DZZA 4R0MA 2ZIXB 1I1HA 1SCUA 1M8FA 3G1WA 3V80A 2BEWA 2GPWA 4WSOA 2DWQA 5JSUA 1CC1S 3OG9A 5BSMA 4AFNA 1GPDG 1YS6A 3JQPA 1Z0JA 2H18A 3KDAA 1ND5A 2GYUA 3BZUA 4FNAA 4KQ6A 4LVUA 4DZTA 4R81A 1QOPB 4NBSA 1DIBA 1I80A 3MIZA 3WB2A 2C5EA 1CZOA 4PLFA 1XR3A 4HGQA 2XE8A 4L4RA 2D1RA 4C0QC 5EZYB 1X0VA 1CY4A 1LVGA 3AWDA 2X0NA 2TMKA 1HEUA 3VBCA 3K70D 4TUYB 2Y0BA 2OVBA 1KP9A 3O5AA 2LKDA 3OVMA 3TKLA 2ORYA 2ZIUB 4MO2A 4JENA 2CNLA 3NCAA 2LP4Y 1GXSA 3GLHE 2WZDA 3CKYA 3GW8A 4YP6A 1KO8A 4M7RA 1UADA 3D5QA 4LSZA 3KR9A 2CUNA 1BQ4A 4GS5A 3RTAA 3GEHA 4QQKA 3DB2A 3ZV6A 1D0VA 4ZJYA 1MTZA 1Y5MA 3HB0A 1UOOA 2B1GA 3LRPA 3KEGA 4P2GA 3SM9A 2RAPA 3WGQA 1UT8A 5IU6A 5JD6A 2FFRA 3KELA 3QMWA 3WGZA 4D9EA 5I7EA 5JTTA 3RU7A 1DTWA 2VHCA 3C7DB 3TLKA 1KEEA 3GBUA 2O2XA 1JQ3A 2IZ7A 4X7MA 4JP1A 3KZKA 4E4YA 3E0QA 1E4EB 1Q44A 3HVIA 4ND5A 4CCSA 1XZMA 1BX3A 5HW0A 2CT8A 1GZDA 1PL6A 3HSYA 1MVLA 3H42B 2BBWA 4A0QA 3K5HA 2VLBA 1P9NA 4CG2A 2XUDA 3EDQA 3O21A 1XF9A 4JP2A 2D1FA 4Q6BA 4E5UA 4J1QA 1PX0A 1RQRA 5DXAA 2XGJA 2XYVA 2EL7A 3AXTA 5BRJA 2VJOA 3PYXA 1QO7A 1V1JA 3CG4A 1KDZA 4O1GA 5B4VA 3HSKA 1V26A 1N5DA 1J0DA 4KOEC 4BQOA 1R6AA 2XNJA 3QMMA 2QI9C 4RELA 3T5AA 1OWLA 1TUBA 2HMUA 1DCKA 4IX9A 2IF0A 2XWBF 4MA5A 1UKBA 2HU2A 2ZCJA 2FQYA 4AZVA 3QLVC 1JG6A 4ZJUA 3TDNA 4DCVA 5E8RA 1N0UA 3RD5A 1I8TA 3L7IA 3DOUA 3CSUA 3HHEA 2I2DA 4GLBA 3SFZA 3D3JA 4FWBA 4A6XA 3IS3A 2A0FA 5DLQC 4MYHA 4CVLA 3DBIA 4ZIRA 2V6GA 4KQFA 2VRCD 1M2HA 5TE9A 4PX9A 2A5YB 1PI3A 2X0IA 4IIHA 3RYHA 1XZNA 4JSRA 3PHCA 4QWMA 1WCV1 2WC1A 4RZUA 3PJFA 3FCEA 4IWNA 1FMCA 4EUSA 2UVPB 2PV0A 2Y1CA 4A0GA 3ELDA 1GRRA 3E9QA 3HBAA 2IV2X 1THZA 4JT4A 1KO5A 1GSIA 3SX4A 3RARA 4GX5A 4FUQA 4YVFA 4D74A 1JQ5A 2VYVA 5EUQB 3RS8A 3CLSC 4BGEA 1B6SA 4NBTA 4QO7A 1TMYA 2OB1A 3HUEA 2GWRA 4G1UC 4E09A 1HOXA 4JQSA 3AO0B 1A7UA 1EPUA 4YHBA 2Q1SA 1QB8A 2QQ0A 1EMDA 1LPOA 3JRWA 1UBEA 1ZJZA 4QTYA 4DV0B 3UB2A 4MI1A 1RRKA 4EFMA 1D9ZA 4GDMA 3W9BA 3FHTA 1F60A 3LTNC 3FNFA 4P38A 3HB9A 2FP3A 3IALA 4IHKA 4MVWA 5HMMA 1D4OA 3ZGLA 3W1VA 2F3QA 3BUSA 3M1AA 4WCFA 5JEEA 4D0SA 1IN1A 5TQIA 3IQWA 3PUHA 1HE1C 3ZDEA 4ON9A 1EK2A 3OUZA 3EXIA 1MXHA 3PFWO 1P0PA 1M7BA 2MDTA 4C4OA 1N8SA 2VH5R 4FYKA 1CPYA 2OB2A 3OIDA 4ZQBA 3RRBA 1DAIA 1HE2A 4E2YA 1TEVA 4D46A 3A6JA 1HDEA 3DEHA 3SEQA 5MN6A 1C2TA 1G6Q1 1S3IA 1SA0A 3G2NA 4LUCA 3ORQA 1CY7A 4KQGA 3OIGA 2FMXA 3F3MA 4ZEVA 4FMCF 3UPDA 2VG8A 2MYTA 2SBTA 2WAOA 4A6EA 1H8HD 1JWAB 5F9MA 5C1DA 2OV8A 3LA6A 5DULA 4GMGA 4MVJH 4B2YA 2VXBA 1R5OA 1FUUA 2GN4A 2QRVA 1SUEA 4BX9A 4MRPA 4BFVA 4S1IA 1IUOA 2DULA 3TOXA 2JFYA 1OX4B 1ZHFA 3R5FA 4Z9AA 4ZREA 2WJGA 2X41A 2JCGA 1DB3A 3VM6A 4D8TA 4DF3A 4G2TA 1ZJJA 2VPQA 2ZU6A 3HSSA 2QTZA 2DQKA 4IZOA 4DCSA 2ZW9A 3ABRB 4BMDA 2I54A 3WLFA 4TKVA 3H8SA 2VBCA 5JJ5A 5GMOA 5BWBA 4HH1A 1U28A 2BH2A 3NGLA 1U9JA 4RA9A 3KKMA 3DT9A 4PSVA 5I51A 2YMLA 3IH5A 1B8VA 1OVMA 3SSOA 5BV7A 1AKRA 2CE7A 2WABA 2J0VA 4BP1A 3EXHC 1E96A 1U1CA 2AV6A 5JEDA 1Q0TA 1CUDA 1DIHA 2HUNA 1TYCA 2GH1A 3G79A 2F7SA 2JLSA 3FYTA 3JQDA 3LK6A 1JHZA 2ZUUA 3PGLA 2ZI4A 2KMLA 3AEUB 1U8YA 5A0FA 5CBPB 4OF4A 5EWMA 1Z5ZA 2ZJOA 3H6KA 2RKWA 2I9PA 4U7FA 1FJGB 4M9CA 2ATXA 1W85A 2EJBA 3H99A 2IU0A 3TR0A 4N41A 5ITSA 2WSSD 4KRYA 3SN6A 4B75A 1NJFA 3A70A 3H8JA 3LE8A 5CIQA 5AESA 3AUYA 1LPPA 1Q6ZA 2XYHA 1T8UA 3B38A 3DXZA 3II6X 4H3SA 4OHPA 3RDPA 3ZW7A 2ATCA 3BFXA 4I4IA 5FUBA 4UUPA 1WCXA 3Q8KA 3B6KA 4FMDF 3N0TA 1H8ED 3MYRA 1OXSC 4HATA 3GJ7A 2ID7A 2WHRA 1OLSA 2GETA 2VOEA 2HYDA 2VNJA 5CHYA 2P5TB 2PMKA 4NYIR 1OJ7A 4BO5A 1HFEL 3AJRA 4Q4JA 5K0SA 2R25B 2XW6A 4X65B 3VVCA 3DV0A 5UKDA 4OHCA 1R0LA 5EMJA 4LW8A 1CFJA 5GV7A 1VFPA 2G04A 1OJLA 5EUMA 1F1BA 2PXXA 3PVCA 4XE5A 1X7XB 1RAGA 4EQZA 1P3JA 3SFTA 3TGLA 4AS1A 1JHVA 1KWKA 1JEDA 2W2NA 1H8EA 2BM0A 4UVGA 2Q3MA 3RJ9A 2RHBA 2HV9A 1WHSB 2RONA 4RQUA 2JAQA 5LMZA 3FKQA 1U3CA 4ZQHA 5H02A 3EOAI 3U0VA 2VT3A 3R1IA 2Q2VA 1S1CA 5B1EA 4BNNA 3PX7A 4WKCA 3ET5A 3GXOA 1JU4A 3O6VA 4KFUA 3TNFA 4CMHA 1BZYA 3ZD8A 4RH3A 3JQAA 4KSCA 4EUKA 4LGYA 4P7GA 4BGDA 4DSTA 1W4CA 4R68A 3VDXA 5AKIA 4HNSA 3B1RA 4UZEA 3A9WA 1ZM7A 1OYWA 3AHIA 2OCYC 2Q6LA 5KJ1A 2HHCA 1NI4A 3MZ0A 1QHHA 1QUEA 4Y2RA 3E8XA 3TRKA 1ZD8A 3ZLTA 4MA4A 1XTIA 4JJZA 1IVYA 2NO9A 2H59A 3B6JA 1Z68A 3JALB 4GP6A 4YRQA 3ZE0B 3HZRA 1XD2B 5BWLA 4BCDA 5ITVA 5EJ8A 1Y6JA 3M6IA 1PJRA 3QIAA 1PDOA 2KSQA 3PNOA 2W4QA 3CNEA 4R01A 4ZPJA 5EWLA 2GJAA 4PO9A 2DKNA 5JMWA 2ZQZA 2FHPA 4HQNA 3MT9A 4C4YA 4RK7A 4JGIA 2VTBA 1E6UA 1GP2A 4IYJA 5DGXA 4C7OA 1IPHA 2A0WA 2GTIA 3G13A 4W9RA 2HW1A 1GQQA 4E5SA 3UW3A 3VO8A 2Z6AA 5LZ2A 5C1BA 2Z6QA 4JI6B 4C6HA 5E2BA 2PZGA 2XTAA 4LDPA 3CX3A 4R2IA 4M83A 4X45A 2Y0DA 2H1LA 1S4MA 4J43A 5C3UA 3U7GA 1DFGA 1O87A 2C94A 3NBAA 4R8SA 1G98A 4HI0E 5EQTA 5B3KA 4R6XA 1L4YA 1ZI8A 2JC3A 1MAAA 3VR4A 3I6ZA 2O23A 4PS0A 4I55A 1T5TA 4J9VA 2G07A 3CZAA 4RF2A 1GUAA 1F0KA 3EGXA 1FX0A 3OCUA 4KO8A 3FETA 3C39A 2OENG 1V1RB 2J9FB 4MUHA 1S96A 5ALYA 3SHWA 1S2OA 3H3FA 5JDIA 4L3WA 2B94A 4BTEA 1I7NA 3WRXA 3IPXA 5JJKA 4N8EA 2ZZMA 4PXAA 1YRBA 1TYZA 2Q4RA 4FONA 1F1JA 4KQJA 3T1VA 4B35A 4CMCA 5HGJA 1PWXA 2O3RA 3IVGA 3PZSA 2ZBVA 1P4GA 2YIDA 3K4HA 4L95C 1FK8A 1RBMA 1H6CA 2K87A 4HF7A 5DMHA 4B3JA 4MVJD 3DBOB 1CWUA 1HE8B 2H4HA 3PKZA 4NG4A 4ZVNA 2FG7C 1NVVQ 3TE7A 5CGAA 5D3QA 4QOJA 1LW7A 3IMGA 2RGBA 4GXTA 1WULS 3JZAA 4DJDC 2VORA 3Q0TA 3A4TA 3ZHZA 2FUG1 4CM1A 2P9JA 1EUCB 1E66A 1E77A 1G7CA 4M7WA 3HCRA 4BNVA 1JEYB 3ZM6A 1D8AA 2H3HA 5C37A 2R6JA 3B3GA 4BS9A 1ECGA 2WKPA 3QKSB 4NBUA 4NYJR 2C2OA 4YJ2F 5DNDA 1RYBA 1TAGA 3UXMA 3MW8A 4X1IB 8ABPA 4TV8B 3KEOA 2VT2A 1J21A 4GICA 2HSGA 3HNRA 1WW8A 1AF4A 1RLUA 1LPBB 1MOPA 1UZNA 2AFRA 3CF4G 4UBOA 3WLPA 2WUVA 1IYZA 4F92B 3Q3JB 4F6RB 1L8AA 4WN9A 3UMVA 5I9LA 2J59A 3EHDA 3FWNA 4AJNA 1KFKB 4KSBA 3UVEA 1WPQA 2XZOA 3W79A 2JIZD 2F1OA 3FTQA 1G8YA 2HIMA 2V1UA 2Q7XA 4AECA 3LBHA 2O8EB 2E18A 5DI3B 1A7JA 4DCJA 3BXGA 1Z13A 4RFSA 5A7FA 5JSZA 1DC5A 3DKKA 2DBQA 9LDBA 3JQ9A 3G82C 3OEYA 1SAYA 1V0JA 5ELXA 1SQ6A 2IE8A 2YL2A 3D64A 3T06B 3GVPA 1PR4A 2NVOA 2QT9A 5COAA 1P2FA 1E64A 5F5LA 4CKZA 4KMRA 3F3YA 3VPDA 3K30A 1A5ZA 3PFNA 2WQZA 3CM0A 2DOKA 3M81A 3PBKA 3ZE9A 4G0ZA 5DYNA 3ZHTA 2YXPX 1RKXA 4C7BA 3FTPA 4TV9B 1A04A 1MVOA 1XMSA 2G5GX 5EGSA 1YOBA 4DLWA 1U3WA 4JV5B 3FM9A 2AJCA 2QW8A 3V4FA 1N7JA 1VE1A 3H74A 3LS2A 4NAUA 3T1TA 1Y81A 4ER7A 2H2WA 3ISTA 1OB5A 2EFJA 1US8A 4AIIA 1K7SN 1BD3A 2O2HA 3L8MA 3B9BA 5HCNA 1ID8A 1G1AA 2AG8A 3Q9NA 1B0PA 1PJAA 3WYEA 1HUQA 1W25A 2XZPA 3Q3IA 1RD4A 4JGGA 1QWOA 1U8ZA 1GT6A 5G3YA 1JJVA 3ND8A 4NBLA 4F21A 2ZIVB 4HP8A 5TDHA 5CNIA 4R8VA 1KEPA 1RYNA 3KJQA 2W42A 1ZGBA 1YHNA 4KE9A 3UQ6A 1NKSA 3KZCA 2EFHB 1SNYA 3GRRA 1NUQA 1UBKS 4JITA 1JF8A 4CZ2A 5KI6A 4CKXA 2WWFA 1E9SA 4BB5A 1ISRA 4NCKA 2ZE5A 4JEHA 3JV7A 5K09A 4U5QA 1W4RA 2BGTA 4N0QA 4XX0B 4IXDA 3AJDA 5SZIA 1LF0A 3SI7A 1R0WA 4JX9A 3UANA 3ZZ1A 3RQ8A 5CXXA 5EZYA 1G21A 4E2XA 3EZYA 3EZ9A 1DTEA 4KNYA 4RPGA 2OK7A 4ZCRA 2O7RA 5K0EA 2YNMA 4JD5A 1G2OA 1JNYA 2GA8A 4L50A 3CH4B 1XL1A 2I7VA 3EAFA 3HEAA 5IM5A 4KR9A 4F5YA 5J5CA 4PPGA 4OA5A 1Y4AE 4M0EA 3VKUA 1QFMA 1H4TA 4X97A 3IGFA 2XXBA 1NPDA 4J8PA 3CTMA 2VDRB 2IYNA 1X1DA 1IG0A 4WX2B 1MX5A 3GCZA 2O8VA 4OA8A 1B6RA 1LJUA 3NZEA 3LQ1A 2I6UA 2XYQA 1XZCA 3IVXA 1KDVA 1FXWA 1N2CE 1NTOA 5K0TA 1V9SA 1QFJA 1KEEB 4FOTA 4IQ8A 3SC6A 3WMXA 4DSZA 5EIAA 1NA5A 4D9HA 1R0ZA 2ZBUA 2PKKA 5CDUA 3RVQA 1RZUA 1E32A 3DBLB 1NP7A 4Q4DA 2B83A 4CIWA 3VSEA 5JCOC 4O2BB 5EHZA 2QORA 4KIJA 3WL6A 1LDYA 3RBZA 1TRHA 2UZ3A 4NBVA 1PR6A 3CCFA 1EQAA 3MMNA 3AVOA 1DLIA 3M33A 4XYBA 2H48A 3CISA 4OGWA 1JDTA 4WZBB 2DHDA 1HTBA 4P3NA 4YAKA 2WINI 3DWGA 1T9HA 2OV6A 4ALKA 3WWPA 1WBBA 3RU9A 1OI4A 4BRZA 1YB6A 1T34A 5CPFA 2SKCA 2PO5A 5JQGA 2I5BA 1K98A 2D7DA 2XGOA 5FPQA 4PYRA 2HRRA 4YP9A 3RRJA 4OHFA 2UAGA 2TRSB 3WLQA 2YZ7A 4FNGA 3VPFA 4MRAA 3BF5A 2R6FA 4M46A 3AVQA 4BKRA 1DWPA 4OQFA 3INRA 1D2CA 1QF9A 1VGQA 2IITA 2P78A 4MV5A 4B83A 3W0LB 5AKLA 2F02A 2Z9CA 2ZTHA 4DEVA 1QYIA 1T0IA 4EYKA 1ECBA 4E07A 5A5GA 3LOUA 1D2NA 4GI5A 1U04A 4RAQA 5ALWA 1XSEA 4HG2A 1ZK1A 1THMA 2EIHA 1WD7A 1XZAA 1OE0A 4BJ3A 5AVKA 5AW4A 1SCJA 4MVXA 4UQLA 4X71A 2BP7A 3HXKA 3QFCA 3JVEA 4WXPA 1Z6TA 4FFWA 4D4GA 2QNBA 4L15A 4PQRA 5KNCA 2C9YA 2ZULA 3HWWA 1P1CA 4Q66C 4Q3EA 1SWWA 5LZ7A 5IASA 4Z4IA 3TIGA 1GC5A 1YI0A 2QTGA 2WMOB 4LJ4A 4Q3AA 3ZNPA 2VSNA 2GEDA 5TSDA 3KVYA 3B53X 4GOLD 2E1PA 3K32A 3OPNA 2R6AA 2XB9A 5SICE 4BMYA 2X4GA 4UHEA 1ESJA 1YMVA 5KSYA 3QXJA 3DKIA 2W58A 3T3MB 3KZVA 3TLMA 1LI5A 1FMLA 3C87A 3IKTA 1C7EA 3GD5A 1QGYA 4L8VA 4UHKA 1B42A 3ACCA 3S28A 1EFRA 1EESA 1YL5A 1RVDA 1G8AA 1POWA 3HZHA 4IGEA 4ALJA 1UP7A 1KMIY 3IYLW 3OQPA 3WO1A 4C3ZA 4V1CI 3DE2X 1G63A 4YAEA 5TS2A 3ZHBA 2X8BA 3EXEA 1FYEA 1U1GA 3UMGA 3WA6A 1YDMA 1CEYA 1N5OX 1ZY2A 2NO4A 3LUFA 1KNQA 5EJ2A 4FYVA 3R75A 3RS3A 1Z0SA 4MQEA 1M5TA 3NHLA 2Q99A 1EM8A 2VJAA 2RFLA 3AINA 2PZ8A 4ZCMA 1BC5A 5HG0A 1QAMA 1PDVA 1JTEA 4TLBA 4UCWA 3D2LA 2GZ2A 1GUBA 3E3LA 3OCYA 1QQAA 3WLJA 4U6SA 2O8BA 3EEYA 3FGZA 1VMKA 1PJSA 3I58A 5DOVA 1WETA 3QVGA 1TOAA 4QPNA 3PUKA 2DB3A 3K9QO 2NPFA 1VFNA 2R6HA 1WCYA 2C3MA 2JW5A 1H3FA 4HQLA 4NJOA 4TKVB 3ZLJA 5ER9A 3EC1A 1PSDA 2ZRMA 4ILKA 2Q45A 3CE6A 3UAYA 2EP8A 1T25A 3JPYA 2OK8A 4YXWA 4KO2S 3TSOA 4KHPB 1ESCA 1IEWA 1MEEA 4UHHA 2BDUA 1C7ZA 3UGQA 2QV7A 1DNPA 1FP1D 1I6MA 2PUVA 3QITA 1PEYA 2FSSA 4HDRA 1W4ZA 3VPXA 1EX9A 1P29A 4OXRA 5KVCA 1YFJA 3Q0EA 1Z47A 1OW3B 2PKQO 3LP5A 2JFVA 3DCJA 1EG7A 4HDNA 4JZYA 4BWGA 3FJYA 2J5KA 5LNK1 1Y6QA 3KAJA 1TYDE 4EBBA 4PYIA 5FJJA 4ZODA 4C43A 2FW6A 4RABA 2HWKA 5BNZA 5C53B 4MS3A 3H97A 1YRWA 1FMFA 2VQSA 2I3ZA 1I9CA 8ADHA 4MGYR 1O96A 5DBIA 1U8EA 2LRHA 1O03A 5AKXA 4XJVA 1JN0A 2ZVDA 3EXIB 1G5HA 2D5IA 2WU8A 4WNYA 4B71A 4E33A 5TV2A 4FEEA 3JY6A 3CFYA 1Z33A 1RQLA 2CLEB 3FFBA 4KLZA 3OFND 5EA2A 3HNPA 4IIYA 1F20A 2EW8A 2YY6A 1GYQA 4NJEB 3RK0A 2ZJ5A 4PM4A 4GYYA 2H1SA 4WRRA 5J2UB 1IBCA 3K5WA 1NOJA 2WMDA 4G0PA 3RSLA 3SYTA 5I7FA 4EB0A 1JDZA 1GTMA 3JATA 1LQTA 4LBVA 2GVNA 3IQGX 3G2PA 1EH5A 5AT1A 1NQVA 3I3YA 2Q46A 2PVPA 1OX4A 2J08A 3H4IA 1X14A 5HYVA 1UC8A 2Q4EA 3M6WA 2P0YA 4G5GA 4W8OA 3WYBA 2G4LA 2HA6A 3IUBA 4Y9DA 1J0BA 3SC2A 4EKEA 2PWAA 2QTMA 3CUTA 3VR5A 1CUYA 4EQ6A 2KJQA 1PEKE 1X7GA 3P97A 4YGXB 3KALA 2RGWA 3PIDA 4D26A 1KP2A 3EUEA 1XZBA 1L5GB 1O97C 4EELA 4EW1A 1RXSA 4RF4A 3F4LA 2ICAA 2ZRFA 3JQAB 4HAIA 1YDFA 2OM6A 1LSUA 1L9KA 1R9GA 1WDWB 1XRMA 2HTEA 3H5AA 4CLDA 5E1OA 2PZAA 3E1SA 2PK3A 4HLCA 1VLHA 4R5MA 5LP6B 4EHKA 4TM8A 4Z7JA 2VS1A 3DHEA 5BV0A 1LWNA 1E2HA 4RH1A 3HCOA 3ZDCA 4QUAA 4TL6A 4DOMA 1IIBA 3AU9A 1QFZA 1II9A 3SE0A 4U7DA 1SZDA 2JGAA 3G2OA 3A4VA 3JALA 2DFLA 3NHWA 3OKFA 1DDIA 3EDRA 3GRZA 4KV9A 4P92A 1G8FA 4MVYA 4TKMA 3KFVA 3UQYS 2CDRA 3UOGA 4EW2A 4BLSA 1YZVA 4CCYB 2I76A 1XCBA 1KK2A 2O1XA 4BIMA 4OP2A 5KVAA 2Z8YM 4DNFA 3N7UA 4M0PA 2YWJA 3S8MA 1YJQA 4DB4A 3M34A 4RHXA 5IDWA 4KANA 3MOSA 1L7EA 5CPBA 1N2EA 1ISMA 1R3DA 1XCMA 2PJDA 4QPPA 4XWKA 4WTOA 3RSZA 2QJRA 3HDJA 4G65A 3GRVA 3V8MA 3WMFA 1HFWA 3NJ4A 2NPOA 3M3HA 4LYHA 2GAJA 1S3GA 5DB4A 3DW1X 1RWPA 2HNAA 3I6BA 2KI5A 3UCEA 1PYDA 2YR0A 4OJQA 3UATA 3DAHA 5TARA 5IYZF 4J7UA 1VK4A 2MCFA 2AX4A 2IU6A 4RESA 5EE0A 2BELA 3VKGA 1MNQA 4FNMA 3VC2A 2IOQA 1KQGA 3PZBA 3RQ6A 4EX6A 3DW3X 4IH9A 3D3WA 1QBGA 3GDOA 4OYYA 2R7AA 2Z2JA 3T7TA 3ZEIA 1O97D 3GRUA 3OTWA 2JD0A 3WIUA 5IAJA 1CF2O 4CIAA 2II6A 4PVCA 4Y2GA 2CHFA 3PB3A 3QMPA 3SYMA 3UFXB 3JAKA 2YJ6A 4L4SA 4AJOA 3LBNA 3PFHA 4DU5A 2GKOA 1MO6A 2XYGA 5DLDA 1IK4A 1AD2A 3RGWS 5BWCA 1U65A 2YFHA 3MRSA 3RRFA 1A77A 2EFCB 2XTMA 2Y76A 3DZDA 1NDHA 1BMFA 2XD4A 1COZA 2VDPB 4KVFA 3KYJB 3RK4A 2FW9A 1IOVA 1S8OA 1ST2A 1Z4IA 2H6EA 3HVJA 3IUEA 1YZLA 3LGSA 2QJOA 4HB4A 4OXKA 3T3PB 2NZ2A 1SWVA 2R96A 4NVRA 4ARSA 3ZXSA 4C0KA 5AK4A 1SHZA 2ACEA 3PYLA 2HMAA 4MVJI 1Q0LA 2ZR9A 4D41A 3Q1LA 3TIXB 3JQ7A 1G5RA 1LC0A 4QTUB 5ANRB 5FPYA 1FVXA 1XF1A 2HK6A 1RTTA 5HIMA 2M6LA 1NY6A 5AJYA 2W2TA 2JZOA