3RTBA

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima soaked with adenosine-3'-5'-diphosphate
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
490
structure length
490
Chain Sequence
HMKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Putative uncharacterized protein
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 179
structure length 490
sequence length 490
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rtbA01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3rtbA02
1BX4A 2AWDA 3QAIA 3UQ9A 3RSGA 3W4SA 5CGEA 4EN4A 4K8TA 3RQHA 3BF5A 4S1IA 1EKKA 1VI9A 4YL5A 1TZ6A 1V19A 2NWHA 2R3BA 2R3EA 4WJMA 3RQQA 3UMOA 4DC3A 5BYEA 4B8RA 3UQDA 3H74A 3RT7A 3MBJA 2VARA 4K8KA 3RRFA 5BYCA 3GO7A 1ESJA 1GQTA 3GO6A 3RREA 1LHPA 1RFTA 3Q1YA 3RQ6A 3OTXA 3RRJA 1ESQA 1RFUA 5EY7A 1DGMA 4K8PA 1JZTA 2DG2A 4XCKA 5TQIA 3KZHA 3QA2A 3RQ8A 2AA0A 4E3AA 2Q5RA 1UB0A 3B1QA 3NM1A 3RRBA 1UA4A 3JULA 3KD6A 4X8FA 4XF7A 4JKUA 2C4EA 2HQQA 4B8SA 3HICA 2AFBA 4EUMA 3K5WA 3RTEA 2JG1A 3RSQA 3UQ6A 4S1IB 3RS9A 3I3YA 3RPZA 4E69A 3IQ0A 3VAQA 1V1BA 1GC5A 2QCVA 3IKHA 3KTNA 2I6BA 5F11A 3RY7A 3ZS7A 3ROGA 4KADA 3RQ2A 3FHXA 4EOHA 3RT9A 1RKAA 2O8NA 2AX3A 3RTDA 3NL6A 3ROXA 3B1PA 3FHYA 5EYNA 5F0ZA 2DDWA 3IH0A 3UQEA 3VASA 2HLZA 4E84A 3B1NA 1LIJA 3NCAA 3RO4A 4C5NA 3IN1A 2PKMA 1RK2A 3RNOA 3RTGA 3RQXA 1YGKA 3EWMA 4JKSA 4N08A 3B1OA 4PVVA 4K93A 2PKNA 4UBEA 4C5JA 4E8WA 5C40A 1RFVA 1JXHA 3RPHA 4O1LA 1LIOA 2YXUA 5B6AA 2JGVA 5TRWA 4KALA 2AB8A 1TYYA 2AJPA 1TD2A 4KANA 3RSSA 3BGKA 4KAHA 4XF6A 4LBGA 1JXIA 2I6AA 3B1RA 4GM6A 4K9IA 3LJSA 3ROZA 2JG5A 2DDOA 1L2LA 4DU5A 3LKIA 4EBUA 1RKSA 1RKDA 3NC2A 3D3KA 4C5LA 2FV7A 2C49A 3H49A 3NL3A 4LBXA 4S1MA 3B3LA 3RS8A 1VK4A 1V1SA 3RM5A 4E8ZA 4E8YA 5CGAA 1TZ3A 3DZVA 1LIKA 3NBWA 2A9YA 2PKKA 3N1CA 1C3QA 2HW1A 3D3JA 2PKFA 2YXTA 3MBHA 2QHPA 2ABQA 2F7KA 3RTCA 4XDAA 2DCNA 1V1AA 2F02A 2AJRA 3NC9A 3UBOA 5BYDA 3RTBA 2XTBA 3LOOA 4KBEA 3PL2A 4U7XA 3NL2A 3UMPA 4K8CA 5C41A 1LIIA 4C5MA 3DRWA 3LHXA 5COJA 3RSFA 1YGJA 1EKQA 3NM3A 5C3YA 2ABSA 3RU2A 1KYHA 4K9CA 3IE7A 3K9EA 3PZSA 1WYEA 3KEUA 4S1HA 1U2XA 3ROEA 1LHRA 4LCAA 3HYOA 4C5KA 5BYFA 2V78A 3RQ5A 3RTAA 3RO7A 2A9ZA 4YWRA 3RU3A 4JJPA 5CM5A 2DDMA 4N09A 4O1GA 1VM7A 4LC4A 1YHJA 3Q92A 2RBCA 3CQDA 3HPDA 3GBUA 2I5BA 3IBQA 3NBVA 5C3ZA 3NL5A
chains in the Genus database with same CATH superfamily
3BL6A 3STXA 3A70A 4O3FA 2IOYA 3UB4A 3W4SA 1JI0A 4B3CA 3TAHA 5KI6A 2AN5A 1LA2A 2L17A 4TN5A 2CEKA 2HJ9A 3L1HA 3OQBA 2JJ1A 3GFSA 1RWWA 2HPAA 2JLXA 1QTRA 1MA3A 2DTXA 3TLZA 1ZQ9A 2ZSEA 1IXSB 4LDZA 4YRIA 2UXBB 4B3HA 1QOZA 1TVCA 2CNDA 2Q1YA 2QN8A 3A9VA 3NG1A 3OC6A 2JLCA 2D13A 3Q87B 3OLXA 1SOUA 1F2TA 1XMIA 4Z2YA 5CVTA 5LNK1 3UK0A 1EFPB 1K98A 1V48A 3BQ9A 4RPLA 1TIBA 4ZCMA 1O96A 2XA2A 1JH8A 3WV4A 3Q10A 1L4LA 1BXRB 1SURA 3AIKA 3PWSA 2AM1A 1ZBQA 5FLYA 5JECA 4IUDS 1O8BA 3EGXB 1G1AA 3JQQA 4J2OA 4E5VA 2WMYA 1EGVB 1JSXA 2BSQA 3RSQA 2C1ZA 2GAOA 4D9NA 5HVNA 2JGKA 4HH4A 1TZBA 1ZRSA 4QYIB 1J0DA 4K8PA 2ZYGA 3OKFA 4DWJA 3C7TA 1NG1A 2XX3A 2DERA 4O8CA 2QX7A 1GZ6A 1JEQB 1SC9A 1WSDA 3UB3A 3N2LA 2Y0PA 4BPBA 2GASA 4BXOB 3K0BA 3JTMA 5JS8A 1QK4A 3I1FA 3OLVA 2TMGA 4RS4A 5DM1A 4IWXA 4O59O 4RA9B 2ID9A 3ETHA 3QMMA 2GZHA 4IBOA 4KOEC 1ZM9A 1JKXA 4LYHA 1I3MA 2G1PA 1NSYA 4NBWA 3HXOA 3VJLA 1R27A 4EQZA 1NYLA 1QHHA 2CMDA 4B4DA 4A6PA 5EA2A 1RSZA 2VJDA 3BA6A 5FPSA 1D6MA 3TLAA 4C4SA 4KN5A 3QKSA 4URHA 5AKGA 1IY8A 3KJQA 4HZUB 5CJ2A 4EHJA 2UYGA 4AZWA 5JO9A 5BP7A 1JXIA 3BRWD 3DBLA 1RC1A 5FF9A 2Z6AA 2XE4A 2P9YA 5AD1A 4I4TA 3LDGA 1TYZA 3K6SB 4MVJA 4YPVA 2A5LA 1FDIA 2I22A 3AZOA 4INOA 4AG6A 5FFFA 3A14A 3PGVA 4YT8A 1IBKB 3MAAC 4F4DA 1A9SA 2G9ZA 2O4UX 1MOZA 2Q3EA 3L7CA 4RK4A 3GGSA 2OR3A 2O2EA 4WZAB 2O2IA 2ZBDA 4QPNA 4RULA 3VNRA 4HXGA 5JPIA 1N0VC 1UZNA 2C9YA 4U8GA 1ZU4A 2NZWA 3QUQA 4K6GA 1C9NA 1NURA 1BS2A 3OEED 3HR4A 3NDJA 4DC0A 4F93B 3NAZA 4ZTBA 1W5SA 5FTLA 3UV6A 2KPOA 3H5IA 3ZOKA 2IWHA 1EDBA 2IOFA 5KVSA 4RJ2A 2PBFA 1ULHA 4EYGA 2QX6A 4GR5A 2QZ9A 3UTDA 1RC8A 4GOKA 1GT91 3SY8A 2XE8A 3WBFA 3OJWA 3EIUA 1W47A 4LCAA 1U0BB 3OPYA 3CX7A 1A5TA 4OHUA 1VLJA 4EVSA 1GL7A 2QTTA 4F2HA 2YWDA 1RKXA 2QV0A 1OI7A 1ZRNA 3HY4A 4R1SA 4HNVA 1F8UA 1T1RA 2XRZA 2VXBA 1K97A 5AW2A 2FEWB 2IYPA 4MUMA 4JR1A 2FZEA 3KLMX 1T9BA 1EUDA 3W8RA 3LPCA 2NU7B 2WWHA 2KX7A 3I6MA 3NTRA 4OQEA 5A05A 4UJ5A 3TZEA 2WLTA 2XCTB 4NBUA 1DEXA 3LWZA 5DI3B 5F9HA 2FQXA 4KLCA 4TT3D 1KNQA 3DPUA 4IJMA 4DY4A 1PJZA 2F67A 4RORA 3QE9Y 4PICA 1A9RA 1QR2A 2AJDA 1YZTA 3WWYA 3CRVA 3MMNA 2GESA 5DM70 4CLOA 1HMPA 3FDJA 2H1RA 3GEMA 3DF7A 3KXPA 3K6KA 2JIPA 4TRRA 1L5MA 1UM9B 1DRUA 4WLVA 4B6SA 4YRZA 5GTDA 1E58A 4PSAA 2WIGA 1WEKA 3ZY4A 4ZXFA 1WPQA 2QSUA 3S70A 5ANRB 2G71A 2NX2A 1W75A 2J31A 4YAFA 3ABOB 3UTCA 2GPJA 4CMAA 2BM9A 1P2TA 5AFSA 2BR4A 3AFOA 1RXSA 3L41A 4I4NA 4ND6A 5HJ7A 2JLBA 4Q18A 4HWSA 5E8JA 1KZ7B 2WVJA 5A0VA 1QM5A 2Z4TA 3K9NA 3P9NA 4PYRA 3X0DA 2IEGA 1EFRD 3WFIA 3SEZA 1AN9A 3JYPA 5MGNA 2VLBA 3B1PA 3Q9UA 2Q1TA 1O5TA 2A9KA 3EH2A 3GVPA 5I6DA 1YRWA 5J4KA 1R0CA 4JENA 3TTUA 1T8TA 2Q5FA 2QL7A 3UJ6A 3E2MA 3QLVA 5KNCD 5A0TA 2OCPA 1NLUA 5J4VA 2WYIA 4DC1A 4KQ1A 1BWSA 1MTZA 2FEMA 1P1KA 3QI7A 4JKIA 4WADA 3S2UA 3ROQA 1ADJA 1KI6B 4E07A 1VL0A 3TKAA 4E08A 2VA9A 3LUHA 3M6IA 4OFBA 1QG4A 1ZCJA 4RTJA 2Q4OA 3I45A 1KDRA 4WGGA 1Z16A 4I8XA 2O8BA 3UUWA 1EGMB 4E7OA 2HPZA 4WJZA 5BRJA 3ODGA 1TAQA 2WSSD 5IDYA 3LWBA 3PVSA 3PNOA 2BKVA 1YFKA 4OBXA 1R0ZA 2HN9A 3BERA 2RH8A 3AW8A 1Z4NA 2QNRA 3E5MA 3QU9A 3MAJA 1BMFD 1Q5PA 1DCMA 3LKIA 1LBQA 4IDGA 5FI1B 4KR0A 5JOQA 3HXTA 2DFVA 4DVGA 2F17A 1MFZA 2J32A 4MIOA 4CM4B 5FP0A 1CCWA 4ZV4A 1GPYA 4IIHA 1ZHHA 1TEVA 4UVIA 3VPGA 1C1XA 2QNIA 1SXQA 1XZPA 5E2BA 5F35A 2OY0A 3W6ZA 3ZW9A 3W5CA 4EM6A 1KRXA 5E4YA 3GU3A 5EESA 3IUJA 3PPWA 4IGIA 4L27A 4LCJA 1E2NA 5CT6A 3PUZA 5J4LA 4BO0A 2H7CA 2P5UA 3ECSA 2DUMA 2FX2A 1H0KA 5B7PA 3PFCA 4D97A 3M34A 3VQTA 3L05A 5CXUA 1RP7A 1G9SA 3CZPA 3ELDA 5JAPA 2FG7C 3RK4A 1DUSA 4K6CA 4XD7D 2BFFA 3RYFA 1ZJJA 2UUOA 2ZVDA 5A06A 4KGZA 2P6RA 4V1CB 4ZAYA 1ZD1A 3KE8A 5LJLA 4FR0A 4B4KA 4JEUA 1XYYA 2AN9A 1OAAA 1Z0ZA 2WOJA 4GPZA 2HK7A 2XDQA 1UP6A 1KZGB 3HDTA 5JAUA 1UM8A 3K9HA 3ENZA 2C5FA 4UEOA 5C4GB 2P4QA 3E8SA 1VJGA 3LCRA 4C2UA 1YK0A 3M5DA 2TS1A 3BK7A 5LA6A 4O3MA 3NBVA 2AKEA 2WP8J 3D4PA 3ND5A 3NL5A 3RJMA 3NHJA 3PQDA 1YQDA 2EU8A 1BOFA 4Z4QA 4EJMA 1Y8QA 4JLWA 5EZYA 4NBNA 3WZLA 4HN2A 2RIRA 3DM5A 3P1JA 2O8EA 3DVLA 2I2FA 1P3JA 1P9OA 3PXBA 5J2UA 2V1UA 2B98A 2VOEA 4K88A 1TC1A 1WBJB 1Z4KA 3IELA 4HEQA 2C97A 2XB6A 4OLFA 1L4NA 3AHIA 3CSSA 4Z2AA 3TR5A 1QC5A 2AFVA 5AW6A 1IXYA 1P18A 2G3YA 3GPIA 3H1FA 1VSTA 2PZMA 1IM5A 4YCNA 2CZGA 2HXSA 4FNMA 1Y1KE 4XE5A 2GCOA 3W3AD 3R0VA 3H2HA 1ZCFA 1DFGA 1GNPA 3OJCA 2QUIA 3UGQA 3ZHCA 1VKNA 4GHWA 5AICA 3RRBA 1VQ1A 3P19A 5IZ4A 3UPUA 4AJEA 6PFKA 4LXXA 4WK6A 1M10A 3GNSA 3E03A 1YZHA 3JVEA 3V33A 1NN0A 2R1TA 1ZITA 1P75A 3I0MA 3TLCA 4MUHA 3RY7A 5IKEA 4NARA 3MWEA 3FNFA 3ZGNA 4BKUA 3BWBA 4WVFA 1E3MA 5HIAA 3N53A 1B8OA 4UTNA 3F67A 1EMDA 3PSHA 2OD9A 1EP3B 5KHOC 4AJIA 2BGNA 1E8NA 3LY5A 3KOUA 4DIKA 4JCCA 1ISJA 2CHVA 4O4LA 5KWJA 4YXFA 4JKSA 4BFVA 2R47A 4MTLA 4IV8A 5HJ5A 3JQAD 5JJIA 1N0IA 4PPNA 1HE1C 1TRHA 3M6VA 4G97A 1JLLB 1CK4A 3RUDA 3AUAA 3VDQA 2YVLA 1N5IA 5TVKA 5EKDA 5FL7D 2VFAA 2IS4A 1YNSA 2MSWA 1HY3A 2Q07A 2XUJA 1V3TA 1YTLA 4KK3A 5FBWB 5IH3A 3AHFA 4RX1A 2JG3A 2IHTA 1IZ7A 3DDUA 4G1CA 2ZYDA 3JAKB 4LE1A 4LF5B 5TQ2A 2EJVA 4Y2GA 5M5BA 3K9FC 1TF2A 2B5OA 3CN9A 4QL3A 5UKDA 3RAJA 1D9ZA 4BFTA 4E22A 2JIZD 3D8UA 1E7MA 3NUGA 4FCWA 1RCUA 1W0KD 4O02B 3HJBA 5LP6B 3L06A 3WGLA 2BW0A 3LO5A 1QQ7A 1IN7A 3DMYA 4IOKA 1YDMA 3T41A 4DN6A 4ZIRB 3W6OA 4RNCA 2PO7A 3V1UA 1NKVA 1YHZA 2RMKA 4X1YB 3OIYA 4MI9A 4UEWA 1W2GA 4CKEB 2FLVA 5EMKA 4B3JA 4DJTA 4FBGA 2ZBUA 5CT5A 4KB5A 4BATA 4P8RA 5JS7A 3KQPA 3NPAA 4HQ6A 4GP9A 4QM7A 1XDGA 3BCRA 4ZI2A 4L6AA 1YI0A 4LY9A 4Y6PA 4IIVA 5CA0F 1GGMA 1BCSB 3USZA 4H4DA 4QQRA 1FA9A 3DC7A 3IB6A 4MEJA 3OTQA 4R31A 5AI5A 5ENVA 2UV8A 3IQGX 4BTLA 5J58A 5JXGA 1W59A 1EPUA 1Y3BE 3DW1X 4BZQA 3K0FA 1L5LA 2VVTA 4OK6A 1WE2A 4ED9A 1ZOOA 2EQ5A 3MSXA 3TOVA 4Y67A 4B75A 1M5RA 4P31A 4EL5A 1AZSC 3R24A 4MA0A 1JG2A 2V9CA 4JA2A 1GZDA 4GPTA 4V0SA 5E4FA 5HE8A 2VXYA 2OFOA 1L1RA 5SYAA 1F14A 3GEIA 2XW6A 4LGYA 1HH4A 1D09A 4F72A 2QT0A 3AUXA 4GP7A 4TRJA 5BSEA 4DA8A 4E0BA 3GLFA 5HTOA 4BB9A 4WNYA 5FR2A 2WK1A 4WXRA 1UZUA 1DP4A 1FFXA 1LXCA 4FGUA 4O4HA 1XVVA 3TRKA 3GCGA 4Q9NA 5LIPA 3UKDA 3SVZA 4FEEA 3MOSA 1AC5A 1S2GA 4QEDA 2PGNA 5EAIA 3BGVA 4Q16A 2A5DA 3ZVRA 1MX1A 4YPOA 2H1HA 1P9LA 1TJNA 4OHPA 4ZALA 2M6SA 2OP1A 4CI0B 1RZ3A 1UJBA 3IAM6 4J1SA 4LRUA 5AW5A 1Y5MA 3G59A 4M54A 4QXPA 5NLLA 1VPDA 5JO0A 1TUEA 3U3KA 1Z38A 4ID3A 1AE1A 3VH2A 2H06A 1IY2A 2ZBQA 1ONPA 4QNNA 1GEGA 1GQFA 1LSSA 4CKCA 1HK7A 4JQCA 4RCZA 3DR3A 2VTBB 4EMBA 1TX4B 2NNWB 4KUGA 2I6UA 4POOA 1RCFA 4A0FA 2GBFA 1V96A 3GOHA 1AUPA 3OT1A 4LXTA 6YASA 5H83A 5HILA 3IE1A 1EX6A 1NBHA 2RB5A 5C5IA 3A1FA 4YIHA 2TMKA 2I3ZA 2UKDA 3K9BA 2NGRA 3VNSA 5K9ZA 3TR0A 2B37A 4LEIA 1ICIA 2VJMA 4DQ0A 3RAPR 4MB0A 2CXTA 2JS7A 1U81A 2WSLA 3QU7A 2XJAA 2DTDA 1EXWA 3D6MA 5JNTA 4WH0A 1FRVA 1Q7TA 2ZRHA 1WM1A 2Q5QA 1AMOA 5IVKA 4ZPXA 5ECWA 2JCBA 1DRJA 1MDFA 3VJRA 4GW3A 1HG1A 5T67A 3NFYA 3OZTA 4BX8A 1W5BA 1ENOA 5CTAA 1P62B 4JBXA 2ATIA 5HA5A 5LZ4A 4KGXA 2JC3A 4Z4HA 1SXJA 4LNUA 4R0NA 2OCIA 2W6OA 1JSRA 2JAHA 4L8LA 4KDFA 1CQJB 3C3DA 2PWZA 3ZV7A 2O2XA 4YV7A 2QSYA 3EQ2A 1PFGA 2XT9A 4BYMA 5CA1F 5FADA 2R6AA 3I32A 1V3VA 4JLAA 1ZGBA 4JT9A 1U8XX 2XCUA 4KQMA 3I9LA 1SQSA 2QTLA 2D1RA 3GARA 2DR2A 3QBTA 4OH1A 1C3JA 4YDSA 1OZAA 3KG2A 2JFBA 2NTEA 2PVPA 2PZEA 4CDGA 5C41A 4WFIA 3NT5A 1HG0A 2FW0A 2IZ1A 3FKSA 3IQEA 4HZIA 1K63A 3FB1A 4X8OA 1PJSA 3LY7A 4Y6GB 6GPBA 1G38A 4HMOA 3A4VA 4AJOA 5KTNA 4I50B 2K6GA 1YTUA 1E4VA 3X3HA 5I48A 4OUDA 3L7KA 1UQUA 2G8NA 2RGYA 1VE5A 3BSWA 2QQ0A 4HAUA 4KDCA 5FUXA 4Y2JA 1RHMA 1KR2A 1ZINA 1TQHA 3NOVA 3OA2A 2J09A 2NM0A 4QLOA 2QVBA 3MUOA 5AJXA 4BU0A 1MAHA 1OYOA 4FGWA 3R77A 3RSGA 4NCIA 2YRWA 3H0EA 3T7CA 1NN5A 1INLA 2Z2YA 4KAAA 1REQB 2IEDA 3GFQA 1X1TA 4E30A 2PKEA 3JR7A 4MROA 2NWHA 3DLPX 3TWOA 4C7XA 1ZL2A 2PAFA 4FDMA 4XA8A 1WV0A 1CIPA 1I1OA 1W9HA 3QHQA 3QGMA 3TE7A 5EIEA 1FFEA 1NVMB 1R74A 2V7VA 2W90A 4N6OA 5CM8B 3THXB 4NV1A 3V00A 2HX1A 4X93A 4A2PA 1TRKA 4IX1A 3PE6A 3COVA 5EJFA 2GA8A 4UXJA 4QD3A 2C59A 3USCS 1N32B 4P5PA 2VP0A 3C2QA 2VATA 3MWDB 1R6VA 1NVVQ 1U8AA 2FNAA 2BHLA 3BCHA 1DU4A 3ROPA 2OXCA 1NVGA 3ER8A 3JULA 1GG5A 2WWXA 4K1LA 4I5IA 1MZVA 3DHNA 1C4XA 3WJAA 1M0WA 3SR4A 2OFFA 4EN4A 5HXAA 1VFNA 4PLHA 3PC7A 1P29A 3TOCA 4M99A 1NXPA 1RHRA 4B0OA 1OT3A 4EECA 4CQLA 3JQ9A 4EOHA 1YQXA 4B6EA 2DULA 5DNUA 2UZ1A 5E2AA 2UZ0A 3ELBA 4PFQA 3ZBTA 1LTHR 3L0ZA 1M2KA 4X90A 4OA5A 4EENA 4XUCA 3AR6A 4ENWA 1R5OA 1J1IA 4FILA 2Q9CA 2ODQA 3IX7A 4A6DA 4AVYA 1EXMA 5CFOA 1QRSA 1U4OA 1G8YA 2I7XA 4N1AA 3EF1A 3U39A 4CJXA 2GX6A 3F5DA 4AJJA 4RTMA 1GD1O 1XK6A 4DDUA 4E5SA 2ZRCA 4IWNA 3PDIB 2IU3A 4RIFA 2OB2A 4PRYA 2FG6C 1PWZA 1G19A 4ZVQA 1M3SA 2GZAA 2GXQA 3FBGA 1RD4A 4DAEA 3U9SA 2QLTA 4JL5A 2RBKA 4UE2A 2ZREA 2I6AA 4EX6A 4D9CA 9GPBA 2X40A 5JH7B 2ONCA 3DXYA 1QP8A 1PT8A 4WSOA 5E8RA 1LJ8A 2B36A 2ZI7A 4ZO8A 3D3KA 5HOEA 6LDHA 4JGBA 5F52A 5BQ5A 2H07A 2FJ0A 1UFKA 2YN4A 3B9QA 3CWZA 3HC7A 4FGZA 2TSYB 4WNAA 1Y3DE 4QXMA 3UQYS 3FIUA 1IK4A 3FVVA 1CLEA 3C41J 3HYLA 3KAKA 3WLPA 5D86A 5C5CA 1BDIA 1XGKA 2XBMA 3RARA 4B4OA 2J07A 1Y8CA 1Z8DA 3G0CA 1P33A 2IYFA 3LUBA 4RENA 2ATEA 3WK9A 3M4NA 1HR0B 1G8MA 5HRAA 3KSZO 5C8DA 3RWOA 3F0TA 4I1IA 5TPZA 5AMXA 1Z2PX 3IIKA 4HQNA 2BCGY 4TUYA 2ZBRA 4UTXA 3ORFA 5FOVA 5TGTA 3RIXA 1KJIA 1DDIA 3RROA 3IO5A 1G59A 3PZSA 1DBRA 1Z7BA 3FYCA 1K4KA 1VG0B 4E21A 4D79A 1QV6A 1U9IC 1KYZA 4DV7B 1XTUA 3TOZA 5CM5A 4EYQA 2AV6A 5BRAA 1TEZA 1NPTO 4M0DA 2I65A 2WNHA 5ALXA 1KK3A 3WYEA 4WCFC 1RXEA 1X86B 2JFUA 1E7QA 1KAGA 4RCYA 4KR3A 5DCUA 4URUR 5IT4A 4QEKA 1HSOA 2B94A 1GLNA 4YT4A 4K87A 1ADFA 1C7RA 1K3TA 1YZGA 4RHUA 1A4XA 4EKDA 4DDHA 1CUBA 1NC1A 1KY3A 1SG6A 3TG2A 2WU4A 4KREA 3BAZA 1O9HA 4CG3A 5B2FA 5J4HA 3T12A 1C1YA 3SC3A 1A82A 4OAQA 5B64A 1FUIA 1Y1TA 4FQ8A 4MUYA 4XSHA 5EP4A 3S1AA 5HZMA 5LU9A 1NHWA 4G4JA 5TQ0B 3ZEAA 1XZFA 4I3FA 2SKEA 1E60A 1SUWA 2VT6A 3DT9A 3GT7A 4CM6A 4K9NA 1AF7A 2WC1A 5K6AC 3TJRA 2OK7A 3QYJA 4L50A 3T7DA 3DPIA 2NZJA 1PT7A 3GCXA 3H5TA 4BCBA 1JKFA 2O0MA 1D2CA 4JP1A 3W1WA 3BJEA 3N0XA 5EJ5A 4G4GA 5YASA 1LBTA 2YNMC 3FHTA 1E2UA 3OZRA 3JZFA 1GTVA 4PCUA 5A02A 4MRNA 2O7RA 1O6BA 2FPLA 4EEKA 2QXUA 4E5UA 3T9BA 5CDYA 3R44A 2WTBA 2AHRA 5DGIA 1YAHA 1RPTA 1Z8HA 1A7JA 2F4NA 3QBEA 4BLSA 1OFGA 4E32A 3KX2A 4F06A 3R3UA 1I3OA 2XUZA 5KX5A 1EA5A 3NHKA 2PK3A 3NLLA 4GPAA 3VYTB 4C06A 1UOQA 4YQEA 3VO9A 5AUOB 4P38A 4EFDA 3E70C 3VTZA 4A0QA 3UAOA 1B8PA 2C0CA 3DOEA 4C0JA 1O89A 4Q3NA 3REFA 1DAOA 2HWUA 4WK4B 3M3DA 5I01A 3HU5A 1XLUA 4NCKA 2ZB8A 5A4FS 4HATA 4GLFA 2W58A 4RACA 3S2SA 2I1WA 4KO8A 4ZGGA 2GN9A 4BNMA 3RC8A 3FKJA 3BGKA 3M6MD 1GILA 1L4MA 3CCBA 1P6QA 3ONFA 5F2NA 3LF2A 3LC7O 3ZWNA 3QHAA 1MAWA 1GNVA 1WHSB 4YRTA 3EPJA 1PQ4A 3GGPA 4LF7B 4TKVB 5DX0A 4ASUA 1TXGA 1V5IA 5EE1A 2HCTA 4DCGA 4XAQA 4K86A 3PK0A 3Q7QA 1SD5A 3BXHA 1U8EA 1EVQA 2A5GA 4R8MA 3C43A 3WO0A 2J45A 3MWLA 4LNHA 1H2XA 2XWBF 5I8ZA 1GAWA 1N7JA 5G40A 1J2JA 2XTJA 1PEKE 3FOWA 3MUFA 4QECA 4CF7A 4QGSA 3L8HA 4NY1A 3K35A 1Y9EA 3ZQ4A 2AJRA 5HG0A 5G0SA 1QIIA 4RV5A 5CK5A 1LPOA 4L8VA 4RTSA 1YMUA 4LDRA 3SOZA 5I47A 1CBUA 3ID6C 1WD5A 4G5HA 4PSUA 4DM3A 3R76A 2HNKA 3WYNA 3ZNQA 2HHCA 2Q9AA 1NVBA 4RK0A 3A1CA 5I7HA 3LKVA 4Q4AB 1SUBA 3LBIA 1GPWB 5HKKD 4S05A 3G9ZA 1DSSG 3VNBA 3Q8KA 2HTEA 1SB8A 3E7FA 4MWZA 4RVCA 4ZRDA 3DOFA 4AX8A 621PA 5LP1A 2QQGA 2A9ZA 2D5CA 4LS3A 1YZYA 5FPYA 4D4KA 3N8HA 3R09A 2WG0A 5T3YA 3T94A 4N7RA 2PZGA 4ND7A 2R7MA 3A6KA 2Y1OA 1L8XA 1Z33A 1NDHA 4I55F 5FQOA 3T52A 4KRGA 4YR7A 3DMPA 4R7GA 1LIOA 2VYFA 4WLOA 4ACAA 3HYNA 4O5OA 1NV9A 2A0KA 1ECPA 5E9JA 5A3VA 1N2HA 2QE7A 3QA9A 3U1VA 1GTSA 4HHEA 4YRRA 5IH7A 3KPWA 1OX6A 1EAYA 4I9FA 3ADKA 2FPPB 4WCDA 5TGZA 4RYLA 3BN3A 4BNXA 3QIAA 3TG8A 1OTXA 4PFKA 4OP1A 4EUEA 3V6LA 5JU6A 2WG1A 1OAKA 2AGVA 4MRRA 4NMHA 3KTAB 3ON5A 4I99A 2X4IA 1JKIA 5FULA 2CUNA 4H7DA 2YOHA 4PGHA 1U0NA 4YWJA 4C7OA 3N8NA 4BBAA 2XYRA 1OD6A 3VZBA 5JDIA 4LZPA 2AFBA 3RBZA 2IY8A 2QN7A 3DAGA 1IVYA 2JKVA 2P77A 2Z3WA 1SA0B 3T15A 1H65A 1SVMA 2EW8A 4DYDA 1KKLA 1WQ4A 2VHYA 3BGIA 3GDFA 3M2TA 5DYNA 1Q20A 4MARA 1EWVA 1XSEA 3ZI7A 3RT9A 3MEQA 1OCEA 1EXNA 1S2OA 2HREA 4LZZA 3NL6A 1BFKA 1NLMA 2YWHA 3L18A 1KJJA 2FP3A 2YC2C 1JLMA 2R1VB 3L7DA 5M2QA 4YV2A 3EGEA 1RI2A 4HSGA 1BXKA 2C20A 3QMVA 3QVJA 3REGA 1Y4UA 1TU4A 2HQ1A 4BWVA 1F4VA 1RS0A 2Z6UA 1TJ4A 1V39A 2VHCA 3L4EA 3RUEA 4YCLA 1DFHA 2M6RA 1ATZA 3WGGA 2EOAA 4JEHA 4L2IA 1SAYA 1CR1A 3MD0A 4NBRA 5JXIA 4BMVA 3N70A 2H0RA 4S04A 2CNBA 1WOMA 4X64B 4K9IA 4FFBB 3DDWA 4QARA 2B1IA 1K6XA 5CIQA 4QGBA 1BD3A 2H9YA 3E0QA 1I30A 1V3UA 3GAAA 3GN1A 1BRTA 3LP8A 4S2UA 4YPFA 4RTLA 1PJCA 5CPFA 4CMHA 4GE0A 1EFUA 1XMXA 2A9YA 5LZ9A 4G0MA 4FMBB 2DM6A 2P2ZA 3KZOA 5BNIA 5CLGA 3VHXB 1DIRA 2G7MC 3WYAA 1M75A 1XVAA 2PX8A 5KYWB 1BDMA 1SMKA 4TKZA 2C95A 1QYVA 1NI5A 4M1YA 3GRKA 4UCQA 1DC4A 1P8JA 3DE3X 2NMVA 4RADA 1KU0A 1L1EA 1Y6ZA 4DYHA 2NYUA 1AMNA 3S8YA 3D64A 1YE3A 2GRAA 5EWMA 1EG2A 2PZ8A 3LZCA 1W4ZA 2REQA 5EJMA 3WLJA 4C14A 1A7AA 1TI7A 4NNOA 3KQVA 3RSFA 3W8EA 2BGUA 2P9JA 2WA1A 2Y2VA 1VRWA 2FF5A 3CW9A 3A6DA 4M7WA 5CT4A 3SHVA 1UJ5A 4FI3F 2PPVA 3RJTA 5K0FA 3GLGE 3CS3A 1DQNA 1XKQA 3JRWA 4DDVA 3VR4D 3MRXA 5EWJA 3I83A 1FMLA 2CFSA 3E9QA 4C4AA 5DK6A 4LC4A 1WOYA 2D54A 5EP3A 2D0DA 1G42A 3DWGA 3IV6A 1XHEA 3OI7A 5KNDD 3J80A 3CVUA 4J0EA 1M2OA 1R0XA 1IOLA 1TYDE 3N0RA 5E1OA 4KRYA 2DGDA 1J8FA 1RWQA 3EQ7A 4MP8A 4GGMX 1CUSA 2VRWA 2OECA 2PPLA 1KEUA 3CRQA 3ECAA 3T1VA 1V3QE 3UG7A 3UWMA 2HZ7A 4AZ0A 1I3NA 3ZWQA 4DB4A 3ICQB 4JH0A 3PD0A 2GN8A 1EQ2A 2HPHA 2XUDA 1JA0A 1Y1SA 1OMOA 1HV8A 3C1AA 4BLPA 3HQ4O 3GVXA 4MWGA 5JZBA 3RFFA 2II6A 5T7BA 1TYCA 2LKDA 3IVCA 1HEYA 4X45A 5JYDA 3ZW8A 3PEEA 2I80A 1MAUA 5MF6A 2JGAA 4AZTA 3GEDA 4MV7A 3A4MA 1P80A 2VO1A 2XWPA 3LV8A 4DCCA 2PVSA 3G85A 3MINB 1B43A 4KI7A 4XIJA 4NATA 1Z82A 3U3RA 4HN9A 1WXWA 3CVYA 1MEEA 2F64A 3L0DA 4AUKA 4NEGA 5ERYA 4ZT3A 4CG1A 5KINB 1QDEA 4YFVA 5I4IA 5DTEA 4JJ8A 4BFCA 4GOMD 3ROGA 4M7RA 3GL9A 2QGZA 2QMUA 2B9EA 3DEIA 1I6LA 1ESEA 2AFRA 2BFNA 3C4JA 2VS1A 3PC6A 1JF8A 1KEEB 1VP3A 4BP9A 2DFDA 2LIVA 2P6NA 1T4BA 4IMJB 3RUCA 1TT5B 5EXEA 1JXMA 1I4LD 5AJTA 2HR1A 2OBBA 3AONB 1RK2A 4C5CA 4B7AA 1JT9A 4OI1A 1YONA 1OOEA 3RRXA 1L2TA 5I9MA 1FTNA 5WRFA 2CE2X 2HRDA 2YHIA 3FCEA 3KOYA 3HNRA 2P5YA 1HE5A 1UPAA 3C3EA 3K8ZA 4DGQA 1JEEA 5IJ0A 4NU8X 3ZZNA 4JL8A 1E62A 4B0PA 5JJBA 2RK6A 2DCMA 1Q0HA 2CDNA 3A4TA 1UXJA 4F5DA 1WF6A 2NU8A 4F7DA 2XKAA 3B8HA 1NQVA 1TB4A 2I5PO 4D4HA 1I2AA 5LYJB 3HFGA 3D8NA 5LLSA 5ITVA 1KXZA 2CHFA 1RM5A 5M04A 1S8FA 2C9MA 1I9GA 3JASB 4U7FA 2HY7A 3ZL8A 3D0RA 4I19A 1LI5A 1KDPA 4CV0A 4YAUA 3F46A 1FRNA 4RXTA 5ALKA 4FIZA 4UHJA 5A2QA 4CKWA 1XTBA 5AW8A 2OLJA 3QX8A 4ETMA 4RQAA 2QG6A 3WKCA 1V8OA 3U9TA 1RWXA 4WZBE 5IM4A 1DX9A 2JJ2A 2P2YA 1R9JA 2PJZA 1JIJA 3MGKA 4KQWA 1NOIA 2I7TA 2JGRA 5AHOA 2ABQA 3OZGA 1GPDG 5IVHA 1LLUA 1DPFA 4F46A 5IC4A 1X80A 3LXMA 4NECA 3UBOA 3HWRA 3ACCA 2VDWB 4M8KA 3LLVA 3O3NB 1WS6A 1XAIA 2BM0A 2WTXA 5A9SA 2VPQA 4ZODA 2PXHA 3IEPA 5CVEA 1W30A 3I2KA 2QTNA 4OG2A 3T7JA 1F1BA 2XODA 4AP5A 2F2TA 3MB5A 1M8JA 5COAA 5DEOA 1CPYA 4CN9A 1LVGA 3FJ1A 1Y63A 2F1HA 1DAFA 3HHEA 1ECFA 3OLWA 5EXDA 3N7AA 2P2SA 3CX3A 4HWKA 4H7KA 1J24A 1EEHA 2IXGA 4F3CA 1EUQA 3IUEA 4F4IA 3D0KA 3FZGA 5BWBA 3RYHA 4PTZA 2YUIA 1ISRA 5EJ6A 3B1FA 2XMCA 3ASZA 3C7KA 1AQLA 5IDQA 4FFSA 4KYVA 2WD7B 2SKCA 1HDOA 3JAWA 4FN5A 4DR6B 1QKJA 3LXRA 1QG0A 3L92A 2DBZA 3T1HB 2X15A 4HMQA 5E7IA 1F2UB 2BF7A 4OL9A 3NEJA 1DAIA 3AW9A 5KQGA 4JCOA 4ZZ1A 1M2JA 1ZEMA 3FYUB 3GZ4A 4GMXA 3KV1A 5HWSA 3NDBB 3ZM5A 1Q0LA 4IQFA 5CBKA 1S7CA 3C16C 3FUCA 3L0OA 1I2BA 2ZRNA 1IDN1 4R6XA 1ESQA 5KYXB 2I54A 4YGXB 4PPGA 2VZ9A 1NNUA 2P6PA 4KQXA 5TQIA 5E6UB 3VSCA 2ZQZA 5KQMA 1UF9A 5KNBA 4JXJA 2MOKA 5K99A 3P9YA 3EE6A 4N3AA 1FVHA 2G08A 3GG2A 2YJ5A 3R6WA 5DIZA 5B1DA 1I01A 4ZOLA 5BSRA 4B5KA 1VE1A 1XEFA 2BDUA 1Q0SA 1V11A 4KWHA 2J3IA 1HL7A 3ZN2A 4TPKA 1SUSA 3QE0A 2FX3A 4DMFA 4JI5B 5F5XA 2BD0A 4ZU3A 3K9GA 5HE9A 2N47A 2BDEA 3GT3A 4XRRA 2GF0A 1MJNA 1QX3A 1M1ZA 4PYQA 2ZBVA 4JXKA 5CNKA 4IWYA 1UPCA 2PBRA 3P9PA 2XUQA 2VORA 2UUPA 2YH2A 4U39A 4CHGA 3DNMA 1WKCA 1OFHA 3GN2A 1NTOA 4JY7A 4Z7OB 3UMVA 4QU9A 1R50A 2ZIVB 1X2BA 3BRSA 1B0AA 4EA8A 4FDVA 2Z56A 4RGYA 1SUFA 3UMMA 1XMVA 3V1NA 3RPHA 2BOVA 4DNPA 1KDOA 1Q0TA 1FNMA 1X0XA 1ONOA 2XGSA 4IQ8A 1JDZA 2QVCA 4LJAA 3U4GA 3UAXA 4ETWA 3H4VA 4EL0A 4LRXA 3P9ZA 1W2WB 3GCWA 4N6NA 4ZPJA 5FAXA 3KQLA 3ZDBA 1CQPA 1KYWA 5J5VA 1I4WA 1U5BA 4IAOA 4FT4A 5F4BA 5C34B 1CYDA 2QTBA 1T0JB 2WR8A 4JL6A 3WLNA 3TCNA 3B3JA 3IESA 4ZVPA 2YY6A 4UU8A 3UWSA 5A6VA 2BISA 3JW8A 6CHYA 3OZDA 2FN3A 2IW3A 2FMIA 4EHDA 4LCEA 1N5OX 1ZICA 2H1CA 3AJ9A 3RIEA 3ZCUA 2Z4RA 3BQNB 4URVR 2FWMX 1C3QA 3TSYA 1C7ZA 2OGTA 2RAVA 2R65A 3KXLA 5AHKA 3RANA 4UNSA 4WDRA 1A71A 4UOQA 3WADA 3TQFA 4L6IA 1FB5A 3WLKX 4AX4A 1BJTA 3RC2A 3JQPA 1C30B 2DWCA 4QODA 2EDAA 2C5GA 3M3HA 3A7DA 1P9NA 4PINA 2F00A 4ZOBA 5KIAA 1GZSA 4HN4B 2SCUA 3MCWA 3WIEA 1GQRA 1YDFA 4Q4JA 4ER7A 1WSWA 2Y68A 4IIUA 1YL5A 1ZONA 3EEYA 3GEPA 4IIJB 4OLAA 3NL2A 1LDGA 5EL0A 1U4NA 3UEOA 1BWPA 2ZLBA 1EKQA 4ZRMA 4HDKB 1WUJS 2GBPA 4IJUA 3TNDA 3G2PA 5AXDA 1W5EA 2V7UA 4CCWA 1NNSA 3F3KA 1JIQA 1A27A 1AUOA 2IHBA 1NJFA 2VWQA 4UXHA 2ZE8A 4AIIA 1E6KA 2X4LA 4C1BA 3LP6A 4R2HA 1OZGA 4CM3A 1SKAA 4XYMA 2GWHA 4YMTA 3NBZC 1T9CA 3CBQA 1ZK1A 4D9GA 1F7VA 4AT1A 1SG0A 3DWEX 3PNMA 4MYHA 1TYEB 1C3XA 5G3ZA 4PGMA 1WB9A 1XKXA 4MUJA 4MI6A 2WBLC 3FUVA 4NV3A 2PWAA 2R4UA 2RHJA 4FPXA 4FYIA 5TS2A 4COKA 2NLOA 4TWAA 1Z47A 3JQ8B 1GQTA 3SC2B 3I3YA 4IHJF 3DR5A 3H1GA 3BVPA 1PG5A 3HJTA 3TTYA 2OD2A 4BO5A 3EG5A 1FE8A 2O5RA 3RASA 2YQ4A 3RGGA 1AKEA 1P5HA 2VNHA 4A5OA 1FJ2A 1S4MA 1UBEA 3G88A 4BHTA 3H5VA 4DT1B 1IZ0A 1KARA 1JR3A 4EJ2A 2YHUA 5BNFA 1Y3FE 3D6NB 3KB1A 1OVGA 3FBTA 3AJAA 3E8MA 4C0WA 1USIA 5EJ9A 3ORQA 2VCYA 1JZQA 4C0QC 3GF4A 1HYEA 3AERA 3GY0A 3CIFA 3NIFB 1IWBB 4R9SA 4UEKA 4HNTA 3NMUF 1W0JD 1RWKA 3K16A 1Q11A 1WZNA 1J9EA 4X7PA 1GUBA 3CX8A 1H2BA 1RE1A 3M6FA 4PZLA 3SQDA 5HIMA 2HA3A 3R0QA 1QIMA 2CFIA 4RPIA 2WAYA 1PGPA 3FIJA 1E0AA 1MC1A 1P81A 3ZQUA 1KP3A 2Z1NA 2ISQA 5T4BA 4LKOA 2VJYA 3IP1A 5IT0A 1UH5A 5D6NA 2VNSA 3U4CA 2WP0A 4KXLA 1K27A 2C5AA 1RHKA 3OQMA 1H4VB 5J4YA 2H3HA 3Q7RA 2IVZA 5GM1A 4FJ0A 5DGHA 5IWAB 4YGYA 4JYCA 2YS7A 5FLXA 3ZDFA 3S5UA 4NS4A 1H4SA 4HQFA 3L0CA 4UHCA 1AHNA 2DCUA 1UJMA 1ZM2A 3GFFA 3Q11A 4HX9A 3G2QA 1N7GA 1UC9A 2BMVA 1RHQA 3IURA 5A5VA 3LOQA 2XMRA 2O48X 1U1FA 2O5CA 5HKBA 2HRRA 3PXUA 4LZAA 4DSNA 1H9CA 1JB9A 1GNSA 2IOHA 1NNLA 3BULA 3JRNA 4QTZA 3F6SA 3SEQA 3SSNA 3I6QA 3F4LA 5BR8B 1C4KA 3PFGA 4ZI7B 2O8CB 3EX7C 3KR9A 1QX4A 3VI4B 3RSHA 1U9IA 5ESXA 1KE2A 3GLSA 5ALLA 4CDNA 1T9ZA 3DVAA 3CUKA 3SNKA 1E1QD 2Q2OA 4WCFA 2NSHA 4TMYA 1M6YA 4U2EA 4EW2A 2Z08A 4P3OA 1PCXA 2P9TA 3WTCA 5B4VA 3EODA 1WLSA 4XGRA 1FL9A 4DMUB 4UNPA 3SFTA 4QUBA 1P4JA 1BDJA 1UINA 2XUPA 1GGNA 4HVTA 3TD6A 2PRSA 4N40A 3O4IA 1SU7A 2ZT8A 2AQ8A 3OBIA 1C7QA 4MGIR 2W2MA 4NCAA 1Y7IA 1G18A 4C7OB 1RBYA 4ZQHA 1UKCA 4O33A 1M7HA 3OQ6A 3EUAA 4TVSA 2GTPA 3HXKA 3F6CA 1H8HA 1G291 3F8WA 1NBEA 2RGUA 3TNLA 5BN3B 2XB2A 3GYGA 4H0NA 4KNVA 2XYGA 1MN6A 1XCJA 1HA3A 3IVGA 2ZJ8A 3ANTA 1PNQA 2BVNA 2QQFA 4LG1A 1YJ8A 1JA9A 3PJDA 4DLUA 3NT2A 4OBWA 4NFHA 4P4SB 4EYKA 1DG3A 4Y7CA 4ZMBA 1PJRA 1C0IA 3WXBA 2QNBA 1A96A 3C87A 3G1UA 1K6JA 4H1HA 2QYTA 4IDDA 4TQGA 4ZEXA 3ER6A 2JZCA 3NRCA 3RU9A 1VI9A 4DSUA 1NE2A 3BFJA 6Q21A 4W5TA 1JMKC 4WJMA 5KCMA 3K2EA 4EYEA 2ADFA 1F7UA 2GEBA 2A1UA 4MI3A 4CPDA 3B2EA 1WMBA 1GZ4A 3DXFA 4P6VF 5A9RA 1LK7A 5I8PA 3ZIUA 2DT8A 2XMQA 4WY2A 4X66B 3AHCA 3UHAA 1ZH2A 3DUWA 5B53A 3SM3A 3I1JA 4P4UA 1LRKA 3VI3B 4ND5A 1QIDA 4TLAA 1EINA 3I4FA 5DMHA 2X4GA 3R6DA 1HXHA 3TQQA 1YHYA 2WUGA 2XB9A 4YYZA 1P2BA 1E9BA 4UEQA 3LLMA 4CFYA 3A2MA 4L7VA 4A4DA 2YC4C 4K03A 1SPBS 2VPIA 4L4YA 4EF6A 3UK7A 4TVBA 4WIAA 2PLAA 1OXBB 2X1VA 3L6OO 5HX7A 3B7GA 3PQ6A 3IKTA 2FQWA 2Z98A 2W2XA 1DT3A 4YCDA 1CUYA 1F2TB 4LTDA 4XWWA 2R6JA 2W2QA 3E9CA 3C8ZA 2B34A 1O96B 3RNOA 4DBVO 2M2IA 2V6FA 4DSOA 3KZKA 4FKZA 4W7IA 4D92A 2GVDC 2J0QA 1CNEA 1E1RD 3SIPA 3KTOA 4KVZA 3CW8X 3BMOA 1VMIA 4PZUA 3RVDA 5C4IA 3M4ZA 3AH8A 4D6XA 3F7NA 5ALDA 5IAGA 1Y98A 2CNOA 1Z36A 2O0KA 3QPDA 1N75A 3U26A 2FCRA 4JJEA 2I6TA 1Q3TA 4NCHA 2WNIA 3V7YA 1ADCA 5JS6A 3P97A 3V4RA 3LL4A 2BMEA 2IDMA 1DZ3A 3GRVA 1U3TA 2HLNA 4XR9A 1NVAA 5CEJA 2EZUA 5JFGA 3GJ0A 5JYBA 1YDWA 3SXUB 3UAYA 4CDMA 5KC8A 5CDUA 1Z4QA 1BJKA 3RS8A 4DNFA 2FEPA 3IAM1 1QVAA 3Q85A 1U02A 1T36B 1N1EA 1KE1A 2AOUA 5JJ5A 1RT9A 4Z4FA 4F92B 3O8LA 3BMNA 2C2YA 1W52X 3FCSB 3SFZA 3AHEA 3CZMA 5F64A 1FOEB 1KVQA 4QE3A 4JLUA 4UMDA 3IALA 3PC4A 3PKIA 1IULA 2VT7A 3NONA 4NK5A 4BFSA 2HHAA 3KUKA 3S2GA 3WRVA 3ZLJA 3WJ1A 5KVQA 5JR3A 1YB4A 3PB3A 3DF9A 1YA6A 2VSFA 2WMOB 4RJIA 2A9VA 2APJA 2ZI5A 3GQVA 1VB5A 2V58A 2ZT5A 4YAIA 1RRPA 1YHNA 3DBLB 1I4TD 3LZ6A 3N6XA 2D0OB 1RMQA 1WDKA 1ZG3A 3GI1A 3KHUA 4I4TB 4MO2A 1EHCA 4NH0A 2E7ZA 4UE6A 5KWSA 4L74A 1LCIA 4FX2A 1GG8A 1N3LA 4JT8A 4DIUA 3TLMA 1VHJA 3FCOA 8AT1A 3A04A 2BWJA 3HCCA 4IG9A 3LCCA 2WA2A 5L9AA 1IY9A 4CQMD 4OQNA 3ZJTA 1H42A 3ZIAD 4CFZA 1GQ2A 2DOKA 1WDWB 5SY4A 2G06A 5J59A 4F6CA 4FBMA 5JMOA 1ZLYA 1BS9A 1MO4A 2QZJA 3F90A 3GDWA 5JYCA 1YB5A 5CURA 5LQDA 5LL6P 2C3PA 3HEMA 1J9ZA 5KTPA 4OV6B 2R3EA 1LZLA 4LE2A 3G79A 4CLDA 1QH8A 1QRDA 2EHDA 1ZH4A 3V32A 3MJEA 2QRZA 3BX1A 3OFKA 4TKUA 1IBRA 5KOJA 2O7VA 3SLKA 2Z8ZA 4I9UA 4QAJA 3STUA 4XDAA 3QW2A 4X7MA 1RKUA 3OPYB 1NJSA 4X63A 4UPVA 2LGJA 2UZ3A 4TZ0A 1XMJA 3NBKA 3ITNA 3NORA 4IPTA 5HGJA 3L82B 5TIIA 1FC0A 1ODFA 1RRVA 1EVKA 3EZFA 5IFKA 2FWNA 1P0CA 1V9SA 1N4AA 1PN3A 1TO6A 3GLIA 2NO6A 4LK3A 4Q4CA 8OHMA 1WCXA 3LUDA 3P0RA 3U48A 3H1PA 3R9WA 2C2OA 5ENDA 1EUDB 4G9BA 2XY4A 1OTHA 1NC3A 5TQJA 3HKCA 4N41A 1WXXA 4BFUA 2PBZA 2EZ4A 4FT2A 1AXEA 1O5IA 5DXJA 3G2JA 3KEGA 2BMWA 2CN1A 5T4EA 1GAXA 2QQ5A 3N9IA 3P8ZA 3O1HB 1F4PA 1DJQA 3I6ZA 4O4IA 3TLBA 4CLOB 2MMGA 5MFZA 5AT1A 5I7WA 4YBRA 1H2YA 4JJFA 4F9GA 3TGPA 4HDOB 1COWA 3K0KA 3M1LA 4KH1A 3AVYA 3WSTA 2WOOA 4OXYA 3GGCA 1N9ZA 3AWDA 2E4AA 3ANLA 3EFBA 3ICVA 5LDGA 3SMVA 4DIOA 3WX0A 4DMKA 1G3RA 4JDUA 5FH9A 4RESA 4LNAA 3QXGA 5GY7A 3AEKA 2ZGVA 3JD2A 4YCMA 1WCIB 4IDHA 4U7HA 2FTKE 2GN4A 4ZU6X 3JWPA 1E5QA 5JARA 3OLYA 3E2PA 3SG0A 4HS4A 3CIOA 2WE8A 1G9XA 3TTSA 2ZWVA 2H59A 4BNLA 1J8YF 1Y7LA 2EEPA 2MSKA 3VRHA 1EAMA 4WV3A 3TMAA 4QU5A 2FWJA 2NUTB 3RYTC 3OCJA 4L5BA 2LIPA 1DUVG 4IUBS 4NAUA 1IB6A 3SJZA 4BMYA 1KIFA 2ENWA 2GBCA 3CRMA 2O59A 1J5XA 3L5OA 3DZVA 1VJ1A 2GYYA 3K5IA 4IOLA 2PD3A 3L7YA 3VAYA 4BLVA 5C2JB 1YBFA 2JEYA 1QHFA 1KY5A 4R2JA 2ZDQA 1A69A 4NG5A 1OXUA 3Q7PA 5FOTA 2ZE6A 3V4LA 4DCUA 1EFAA 1P72A 3K7EA 4E4TA 2O8BB 1ZAKA 2FYTA 3KVYA 1IH8A 2X42A 4CV1A 1QHEA 3WSWA 4IDFA 2LKCA 2HD4A 4L0MA 3WIBA 4LIPD 3G1WA 3TE6A 3T5PA 2INGX 3PUIA 4AJNA 1AQ6A 3IAS6 3AEZA 3EXHA 1ODIA 2ZVQX 3E9EA 3RS4A 3L4JA 3H5WA 1MX3A 1WXHA 4DSTA 1C1XB 2BZGA 3C7DB 1HX7A 4J75A 3PUKA 2W4MA 3JZDA 2VI5A 4O1GA 1HLGA 1GZ3A 2QT9A 4FC6A 5I45A 2XA9A 3UHPA 5FPKA 1OH8A 1C7IA 2PLWA 3CMMA 5C80A 3IBQA 3VAQA 2BONA 4NYIR 2ZU0C 4H7PA 2JK1A 3ER9A 2FR1A 3KQMA 2FZWA 4HR7A 4NF2A 1NBOA 3S6JA 4CODB 5JALA 2XXBA 4L4XA 3WK8A 5SY9A 3OU6A 3HB5X 3DZCA 3W5IA 3UT0A 1YBMA 3C4VA 3PIDA 3RYFB 2ZUEA 3IEVA 2H48A 4WOCA 1KA9H 1P4AA 4X6XA 4AXBA 3PYMA 2GCAA 3GQBA 5AIAA 5FQNA 1ZW1A 2D5BA 3C98A 4HJRA 2XDQB 4ESEA 3EIFA 1GSHA 4R05A 1AK9A 2QL5A 3G8AA 3UANA 4WCVA 2CLKB 1D5WA 4JLKA 2K2WA 1A76A 1DKQA 2NU9A 2V7QD 5F51A 3NOXA 4ZDIA 5L8VA 4O4JF 5FDFA 5A6SA 1A9XA 3UT6A 5CFQA 1GL6A 2VDOB 5FV4A 5CX4A 1TD1A 5EOVA 5EZYB 3AF6A 1XRMA 1K2VN 1D2RA 1X1RA 2ZIXA 5CXQA 4CEHA 1F8XA 3H8SA 1AK1A 4MV0A 1WZ2A 1Z8NA 1GRVA 2XOEA 2YWJA 3ETJA 4X7RA 5EKXA 3C0KA 5J2UB 3O82A 4E5NA 5MDHA 1L4FA 3PFHA 1XHLA 1MDBA 3G0DA 4CV2A 3ZGZA 5I4BA 3NGMA 1FEZA 1XE3A 2IE0A 1QC5B 3VC1A 3T95A 3WNZA 1SCQA 5E38A 4Z4CA 1P2GA 9ATCA 1K4MA 1WXQA 2HA6A 3UWPA 4EG6A 5G0TA 3JD3A 3OT4A 4J1QA 5ER9A 3G7UA 2A5FA 3ZDEA 4EGJA 4C13A 2BEKA 2CNKA 1BYUA 1T35A 3QUSA 3A2LA 3DJFA 2HIMA 2ERXA 5BWLA 2CBZA 3BQMB 3QE4A 3KEQA 2GEFA 3LDUA 4QJIA 2W2LD 1KJZA 3PR3A 4LV5B 3NM6B 2VQEB 5K0JA 2IS6A 2REBA 3BHJA 1MIOA 3HTXA 4M1ZA 1PR5A 4PX9A 2R1TB 1J0EA 2IYLD 3NZEA 2X77A 2WIFA 1XZMA 4RVDA 3SEAA 2H85A 2ZWOA 4OFZA 2J3JA 2A94A 1M74A 3B6ZA 3U7QA 3T61A 4B40A 1E8CA 3SLGA 3ZIDA 3BMQB 1Y42X 4IZIA 2OHXA 2AA3A 4YJFA 5I4KA 4O4LB 5EIBD 3OX2A 2HWWA 1KI7A 1EHYA 1GP2A 5DPMA 3TPZA 4TMXA 4QLBA 1E4OA 2H3EA 5DP2A 4C89A 1R2QA 1KO4A 3TI9A 3SSOA 2IEBA 2XMZA 1FXWF 2PM8A 4N0DA 4O2BA 4C0LA 1DIAA 4Z0TA 4GDFA 3ZXYA 2ZJBA 4FS8A 4I6JA 2J46A 2EFHB 2OLEA 1KFJB 5L3ZA 2HMYB 3U5ZB 2XXJA 5H1YA 3FI9A 4OXNA 5D87A 1JFSA 1WXIA 2XECA 2NTJA 2R6ZA 5IK2A 4CLXA 3Q3VA 1NZDA 1U2RA 3QXXA 3OD1A 4FGJA 1XAHA 1JU3A 2CC2A 3LT4A 3KLBA 5JSFA 4DV6B 4HLDA 1RMTA 2WPDA 2GN2A 3QA3E 5ETJA 4E31A 3ETEA 4EY6A 4XSGA 1NY5A 2DHEA 3QHPA 1KYHA 3I23A 3ESDA 4TKMA 4EW6A 1B6GA 1M9NA 3QELB 1CE8A 4IFBA 1KKMA 3FRHA 3AVOA 4R51A 1XXHE 3NHPA 4II3A 3F5QA 4AL4A 4EHHA 2QZ4A 3MGAA 4P7JA 5FUMA 1DTEA 2Q5LA 1M8GA 2G6BA 4S3MA 3CRNA 1RI1A 2GJ8A 3F71A 2OBYA 3GUUA 4JQOA 5E9AA 2DHQA 2GBGA 3T4UA 2O2JA 5DE3A 1SUIA 1GCIA 2B0CA 2X58A 3FOCA 3HCFA 3H97A 3JD1A 1F0PA 1G20E 1KQ3A 2C2BA 3F9IA 4HQLA 4XTRA 4Q3LA 2DBVO 2V7PA 5DRTA 1SNYA 1ZVJA 5JT1A 1FZTA 3VVMA 4PXSA 1Z17A 2IXAA 1SQGA 3SQWA 1C0LA 3AUTA 3EW7A 4A1OA 1JIIA 3GRPA 4L16A 4N0PA 4ERXA 4MGZR 4I1PA 1ESJA 3HCAA 1V8PA 3L40A 1U1DA 3GFVA 4OYLA 5AOVA 5TPWA 2M6LA 1O6ZA 1SJ9A 3RB8A 4XVUA 2DB3A 3Q8XB 2UYYA 1KPGA 4A10A 4LFAB 4TYYA 5FXMA 4Z8XA 3HKDB 3TM4A 2B7CA 4LX8A 3K0FB 4ROTA 4R7TA 1E66A 2JCVA 3OJ0A 5FPQA 2FSGA 3RG2A 5TSDA 2B5VA 2QM8A 3W77A 4X65B 5IJAA 1RM0A 1X9GA 3P7MA 3CF4A 2XH8A 4FOTA 4MYUA 1WNFA 1P44A 5JS2A 4K6KA 1VSVA 1WWKA 1GPKA 1HURA 2FPUA 4NQRA 4AZ3A 4KMOA 1ZGJA 2ZRBA 4W1PA 2VQFB 2AG1A 4WBNA 2Q3FA 5HCUA 4IH4A 2EKQA 3WXMA 4AN4A 4Y1FA 1XTKA 1J22A 1L8QA 3I04A 1TFRA 4LKRA 4W5WA 3SQOA 5JC8A 2Y1FA 3M3PA 2PL3A 3IVAA 3OZEA 2E37A 2BBTA 4O4HB 1FUKA 2F6RA 2PSDA 3A6JA 1KKUA 2ZSDA 3QY9A 4KQKA 2R60A 3MT7A 3B85A 1YJCA 3T5GA 5GJVC 5B7GA 3H04A 4C5NA 2F1IA 4DBZA 4C7KA 3RQSA 1Z2CA 1EXDA 3KFLA 4LZLA 4R2KA 3ELWA 4QUHA 5CXXA 2OCGA 5JTTA 2C7PA 1PEYA 2AZXA 2OFPA 3T3MB 2B25A 2X41A 1AD2A 5ALGA 2OZKA 3QFSA 5JBIA 1Y9ZA 3CLRD 3W79A 4AY5A 4BY9E 1K4YA 4U2KA 1JEOA 2D1QA 2PYIA 2QOEA 2AB0A 1I9CA 3BORA 3JQBC 3NP9A 4MV5A 3RSSA 2BEWA 1QCDA 1IZ9A 1QSGA 1UK6A 3DB2A 3KJNA 5FWYA 2GK7A 4CKCB 2A33A 3H99A 3AMVA 3ZCRA 4IDNA 1AKYA 1FFYA 1Z63A 4Q93A 3N2AA 5KO2A 3IJ5A 4O1IA 3JPWA 4MDHA 3OT1B 2VF4X 2FXVA 3UOAB 1AUVA 5C53B 3H18A 3CJTA 1Z39A 1JDVA 4Q66C 3V48A 2NXCA 5BSGA 2UVPB 1NBMA 4Z1MD 3CUEF 1GM5A 3A1NA 4RLQA 1UXIA 3IUBA 2VBIA 4X85A 2VJMB 4DR3B 4RZIA 1U8YA 2DPHA 1G41A 3N2NA 4ZQFA 3GDOA 4BMXA 1PR0A 2C9CA 3M8KA 3LVBA 1JDJA 4GXNA 5ALWA 1TPYA 4NOJA 2I3BA 5F3RA 4NXNB 1QVVA 3H42B 3LOOA 2YZ2A 4R98A 3U4QA 1T9HA 2ZSBA 1KFKB 1WD7A 4BZXA 2Z2XA 1K7YA 2AYYA 3HRHA 4ZANA 1RI5A 3IXLA 1KYQA 5AK4A 4TLDA 1SXJB 1CUGA 2FZ4A 4YUVA 3WNCA 5L4NA 3Q8LA 4LNUB 4RDXA 2OHVA 4CXMA 1KQOA 1Z9BA 3BAFA 4EYSA 1YQEA 3K20A 1MW9X 1UEIA 2Q3BA 1OZ0A 3INTA 1T8WA 3DLAA 4OXRA 4CTKA 1JIUA 1K75A 3DO6A 3VH3A 1BN6A 1EWKA 1FSSA 4C5BA 4HEJA 4DRYA 2EZTA 3DVRX 3CONA 3LDFA 2FPMA 3HUEA 4PVDA 3OZSA 3REOA 1U6JA 1XWIA 1SQFA 3ZU5A 2JGIA 3ABRB 3FR8A 4URWR 5GZ6A 1PU2A 4ID9A 1PNRA 5C3ZA 3CEPB 1JHQA 1VLVA 3E81A 1QOQB 3VSAA 4K8TA 4A6EA 2JGDB 2X5XA 2PNJA 3BGOS 3HMQA 1E1CA 1T5HX 3AEQA 3C4QA 4DLRA 1P17A 2DR3A 3PLRA 3U3ZA 1M1YA 3P2MA 1A2BA 2B78A 4B46A 3E18A 3AB3A 5I3ZA 1I7NA 3G8DA 2R2GA 2W93A 1LNSA 1QKIA 3CB4A 3ESXA 4URZR 1VE3A 4C4RA 4N48A 4LJKA 3PTLA 1TF5A 3PQ3A 1CWUA 2ZANA 4M1MA 1O87A 3P2EA 4C1NA 1QRUA 2VN8A 3ZGXA 1S3GA 1BGVA 3WLQA 2FSPA 4G4SO 2QLNA 3U80A 1P8AA 4GPD1 3KD6A 1KORA 4UTVA 2IX3A 2C9OA 3BSSA 2QRKA 2WSBA 3ZJYA 2CXPA 4DL9A 2EL7A 2H4YA 2JLUA 2H18A 1JYSA 1MQSA 5F33A 3ZD7A 3GLQA 4DCVA 3N2ZB 3AUJB 3E5HA 4L73A 5FOWA 1CRQA 3W7BA 4C04A 4GL4A 5FNVF 2X8WA 4MWOA 3BGSA 4PBRA 4J0QA 4P4NA 4KH0A 2V3WA 4QPPA 3T7KA 3CLTD 1CVIA 1TJPB 2OYCA 1IAQA 4HX2A 1V5GA 1VL5A 1ZIPA 2ETVA 2QTRA 2ZYRA 3H84A 4TMVA 2I1LA 3AUFA 2YFQA 1N6RA 3DDZX 4IQ4A 2WYWA 3MTQA 3IEUA 1QO7A 1IN6A 4FGSA 4Q1AA 3SP1A 4RKFA 4EFMA 1JFLA 4LSMA 1SVNA 5CH8A 5BWNA 3BZUA 3FUWA 2M32A 4P54A 2G9UA 2R4TA 3EUEA 3OM0A 2P5TB 2ZQYA 2YWRA 4CTOA 4OGKA 1J1ZA 3MT9A 4JNCA 1BWQA 3L02A 1Z5ZA 4X91A 3WC4A 5CB4F 5JNVA 1FIUA 4KFSA 1K9VF 1U3FA 2F3RA 1GYRA 3GLHE 4L28A 1MH1A 2IIBA 1O7JA 2Z5VA 4GP6A 4AFNA 2ZR7A 3EAFA 3VU9A 3QU2A 1NLFA 2X2FA 4RJJA 1E2JA 5JQWA 1Z4OA 1SHJA 1EQUA 2UZ1B 4KEAA 1PR4A 1D7OA 1R0YA 2G67A 1QFSA 1F4LA 2ODBA 4JJIA 4DZRA 4X7BA 1TMGE 4H1WA 4EELA 2ZYHA 4NYMQ 2VHJA 1QHSA 4OYYA 1PKXA 5CX1A 3PHIA 3BFKA 3GGDA 3S68A 2PR7A 1TZ2A 1RW4A 3OZAA 4JJZA 4Q4DA 2ZWMA 3OZXA 1V95A 1E6LA 2JH8A 2X23A 1AIPA 1X9IA 1H23A 3I9FA 3GO4A 5EPEA 3A05A 3MHTA 1DXHA 3PP8A 3A6HA 2P0AA 5LMZA 2G9QA 3NC9A 1JS1X 1FQKA 1WW8A 1E9CA 2R6FA 4PLVA 4RXMA 3DO5A 4C4PA 1HZJA 1G2PA 1L7DA 3EH1A 4CLRB 2CDCA 2A9FA 3EAQA 4C08A 1UT6A 3Q2OA 1K88A 2WLSA 4DMMA 2K4MA 4ABYA 2P0EA 1A0OA 1PJ4A 2D59A 3A2NA 3TW8A 5L3SA 5HM8A 4OYRA 4OD0A 3K9EA 1LQTA 3V4PB 3WDKA 2FUG1 2HMTA 4WNAB 1QO0A 5JSQA 4BPRA 4YS6A 5JQGF 3LUJA 2L18A 4WESB 4KLRA 2HZBA 1PW7A 1PK7A 2OCKA 1KNXA 1JE0A 5DTMA 3HUDA 4BGVA 4ENTA 1EJ6A 4F04A 3LVQE 1J90A 4XVQA 3AQIA 3RVMA 4CVMA 2BE9A 2JAXA 2W0SA 1P5FA 3GAFA 2UZ4A 1YB7A 2IOFK 1AH2A 1HTTA 1E79A 1J00A 1GFIA 2IHZA 2I4TA 5L45A 4KYTA 1QF6A 4KE9A 4TUYB 2RGRA 2JFZA 1NSTA 1O97C 3KUUA 5F1OA 5GGXA 1LV7A 3DZBA 3ND6A 1ESNA 1VLQA 4DIMA 5KTSA 5BW6B 1CNFA 1DO2A 1E1MA 4X54A 1WX1A 4KCGA 2PWPA 5BYAA 1GITA 1GUZA 2W6JD 3FWZA 1HTBA 2I2WA 1YR8A 4B87A 2ZCUA 4G5SA 2MYTA 2PMFA 2QYHA 2VJBA 4MKIA 1FX1A 1GNQA 1TTPB 4CCAA 3O92A 5JSYA 2O6LA 4RPJA 4ARIA 4KP7A 2BSXA 1BZYA 2IT1A 3U7GA 1D3AA 1XNJA 4HAIA 3TRHA 5JPDA 5LDDC 1EUCB 2PA3A 1S9HA 1XZEA 2ZXFA 4TMWA 5EVJA 3ZCPA 4AKSA 1E1YA 3AVQA 2WT8A 2Y93A 1UBMS 3PNYA 3ZYZA 4CLHA 1H0HA 1PQYA 3GBVA 4TTJA 4TV9A 3S1AB 4BLUA 3DOCA 1ZNZA 3NBQA 5CR9A 1T34A 3W5DA 2W6QA 3BTUA 3PJGA 2A0FA 3BB3A 3ZWYA 1N8TA 5KYNA 2H5LA 3PGMA 2J3KA 3BFXA 4UQOA 3OKPA 4BE4A 2PSFA 4F8JA 3I61A 4PLGA 4EY5A 2ZJOA 2GFIA 4B44A 4B7ZA 4BNUA 2EAUA 2AFHA 3UXEA 3H16A 2PZAA 3SM9A 5CMLA 3VR5A 1QPZA 1TUBA 2OCAA 3H9EO 5H81A 5HK8A 2QHXA 2VJCA 4US0R 3TK1A 3IT2A 4D82A 4ZGWA 1BVHA 5H5JA 3NKVA 1Q1ZA 1XOIA 2QLJA 2QROA 4LY3A 3NWJA 3T5BA 4MVJD 2HYIC 3BWCA 1NMXA 1T3ZA 3EQ9A 4FFRA 4IH9A 1DO8A 2W6IA 2R84A 2OHFA 2JH3A 4AJKA 3FR7A 5KQSA 1HQYE 3WO1A 4IVNA 3JYQA 3A2KA 5KX5B 3KSMA 2C2MA 3QTTA 1ISHA 1KVSA 3U1TA 2X5NA 3FJOA 4FDLA 5CIWA 4AQDA 2P2CA 2J48A 2X1LA 3F9CA 2NUAB 4M9QA 4BCDA 3B3FA 3ND9A 3AR7A 4JBLA 4RABA 5IAOA 1G8JA 1W19A 1D4OA 1ZM4A 1QB7A 1AZTA 1LTKA 1S3SA 2C2WA 4KW7A 4TV8F 2IUUA 3P9SA 1JPJA 1QFYA 3TQCA 1QTQA 2FOXA 3H4TA 5IKXA 3O1JC 1NJ5A 2XV1A 3VBEA 5JYEA 2ET6A 3C3KA 2GCIA 4BYGA 3M82A 4WK0B 4WERA 2J0UA 1V1AA 2W2KA 5AOCA 1JDPA 4TMKA 2NVUA 5TV2A 1GUDA 2EJWA 3PKJA 3N74A 1B41A 4IDOA 3B78A 3GC6A 3AU8A 3STHA 3NB0A 4BDTA 4DNQA 1UJ6A 1PS0A 1CTQA 2YIDA 1SK8A 3TQRA 1Z2DA 3G2MA 1TC2A 4L0QA 4IHKA 3LYHA 1JVNA 2BR3A 4V0KA 2D2XA 4HS9A 5EJ8A 4C6RA 2B82A 1XD9A 1PT6A 2G0NA 3F98A 3ZWWA 4GGOA 3U60B 4LK2A 3NTVA 1UKBA 2P4HX 5ABPA 3HGQA 2EC5A 4R3UC 3ZM6A 3NYWA 1KI2A 1RLJA 3TVYA 4UM5A 5AHRA 3O8DA 1LFAA 3B5EA 3K6RA 5B57C 1NQAO 3HFSA 3IUNA 3OM8A 2GZMA 2DWPA 2ES4A 3R3VA 5K1ZA 5CH5A 2G76A 1L7PA 3PDJA 4PX3A 1ZLXA 2QUBA 3ZQ6A 5A7GA 1KIMA 2OCDA 4QG3A 1O57A 2OAQ1 1AT1A 1QAQA 2IY7A 2P2NA 1PP4A 4AW9A 2E89A 2Q4DA 3H11B 3Q3EA 3OLQA 3TGWA 2HW8A 2CLMB 2WU0A 4PG7A 2FMHA 4QDTA 4RVSA 4QDXA 4NPHA 3ILXA 3BWMA 2V8BA 1W48A 1SR8A 1AN0A 4IZOA 3VR5H 3FPSA 1JDNA 4WGFA 3IOCA 3EDYA 1SRRA 3JVDA 5AHXA 1G17A 3ZTWA 1JTFA 1NXVA 3G2KA 3N5CA 3B20A 2WAAA 4O25A 2BHNA 3Q4GA 4BJ5A 1XDSA 5LMNB 4TXNA 4OHYA 3DBIA 4UE3S 2DRIA 1WMEA 1ZYUA 4H60A 4RXUA 3L7NA 1RKAA 2ZYSA 3PF9A 1BS1A 1GPLA 1VGVA 5AO9A 3T34A 1GZ5A 4I2VA 5CUQA 4YRPA 2F8TA 3JWHA 1LVUA 3PEVA 3PQ8A 1JNYA 1C3EA 2HV8A 3LPAA 5CT8A 3E7WA 1CKEA 4F5WA 4C6SA 1SVKA 1R9MA 4K81B 4MRSA 3B1RA 4YROA 2JIDA 2MHCA 2OZPA 2ZYTX 4G07A 1TNDA 4V3BA 5GM2A 2QLLA 5F23A 4Q02A 3TTWA 1RFVA 1NVVR 1MX5A 1MJ5A 1U0RA 4ARBA 3DM9B 2P9QA 1TYYA 2AFIB 4R1NA 1QRTA 1X0VA 1VFPA 1PZEA 5E7MA 2LCIA 2WDZA 1DEOA 1KJNA 1TMOA 4Y0NA 5ERXA 2PKCA 9ABPA 5MN4A 1ODJA 3MXOA 2Q5EA 4YAWA 1A5BB 3W1VA 3I1YA 5GP1A 2X3YA 2X2PA 5T57A 4C5LA 3L7BA 2AJLI 3B3LA 4JYZA 1RM3A 3H2ZA 2AE2A 4Y2UA 1ZD2P 2QAJA 5E6SA 3S8EA 3N2EA 3Q9SA 4EAAA 3ZCXA 1E0JA 2DHCA 3R40A 1BXRA 4Q3BA 1W5FA 5HMLA 5IXJA 2ONJA 4F11A 4BNIA 3OPNA 2R85A 4QQNA 1CY7A 2YN2A 4ZD6A 2KBFA 1OREA 3C6XA 3GFOA 3ILHA 4EHFA 3TTVA 2UXDB 1GJRA 1N6HA 1VMAA 2MIIA 3AI7A 4FJ2A 4CCYB 4EGQA 5LSAA 4QYIA 1X92A 1FNDA 3SDZA 1NGSA 1OHHA 1IUKA 1P5JA 5FFMA 1I8TA 4PYMA 4QHSA 4ZAZA 1JEQA 1A98A 4CEIB 1RAFA 1JLHA 2JCGA 1E9DA 5K4AA 1CJBA 5F2OA 1Y5LA 2B2XA 2VPWA 4ZTZB 1G7TA 4MLDA 4DV1B 2VJPA 1E2GA 3CFYA 5JWHA 1Y5NA 4MGEA 2Q6TA 5SZJA 1SBCA 2XQFA 3IO3A 4NKRA 4WTOA 2CMKA 1FNBA 5DHRA 3RAEC 1AKRA 1XRJA 3I92A 1ADGA 2C4VA 5C7YA 2ZDGA 2RHWA 4KQIA 5HFAA 3AL3A 3DL7A 5C8VA 2PTGA 1CQIA 1ZJYA 1WULS 1NQTA 1M8PA 4UAGA 4BAGA 5K6RA 3ELUA 5EWMB 3DS8A 2KLHA 3V8RA 2REQB 2WJAA 1QCCA 2CL7X 3VZSA 1V2HE 3AUKA 3GJQA 3KJEA 1L3BA 2GEKA 3CLUC 4KIGA 4RHEA 2YW2A 3PPYA 1UIRA 4PW0A 4UM9B 3QWFA 1MGPA 1DAGA 3D8SA 2XMSA 4KOAA 1T0PA 4HEHA 4MWDA 3RLFA 5A4MS 4G8CA 5EWJB 3UAWA 4M8SA 3HZHA 3SQMA 1DWQA 1I2MA 2Q27A 3KDSE 3VYWA 3TXYA 1QGUB 1SB9A 1NFRA 4BVJA 2ZBPA 1BGXT 4OM7A 4TVOA 5FTKA 2PFGA 2VAWA 3P0FA 3B1QA 5MFPA 1I5EA 2J5XA 1K8YB 1Y89A 5HKAA 2DETA 4A0HA 1OLUB 1M2OB 1UEXC 1WW2A 4F0JA 3V9AA 2QY9A 3IAHA 1HDZA 3ESAA 4B7XA 1YZVA 1HSZA 2D7JA 2IXBA 3ET4A 4AZ0B 4DR2B 4H77A 5DWDA 1CRLA 5LR6A 1O94C 2YX1A 3J7AC 3DE5X 1V8DA 1WQ3A 4D4JA 3QVWA 2DLNA 1H6DA 2Z2ZA 2GZ1A 2OFXA 3DZKA 3K30A 2GPBA 4TXJA 3TVTA 2YS6A 1PRYA 3G82C 4OQYA 4RL6A 5DV9A 4RKWA 1I7SB 1B15A 1EHIA 6REQB 4RTPA 5C40A 3U0BA 4TZ6A 2JJYA 4GBGA 2P2GA 4O4JB 1TKBA 4XVRA 2JLYA 1XNQB 3EHDA 3NIWA 4ILEA 2JFOA 4Y9TA 3WL8A 4GWLA 2ZI4A 3ZDYB 3EAGA 1H8EA 3UV3A 5C52B 3WNVA 4FXOA 5G53C 3QLJA 4XYGA 4Y9DA 1W1UA 2TMDA 2IP1A 3CLKA 2C5BA 4QVIA 4NCNA 4JI8B 2BC9A 4J6EA 5DK4A 2C03A 3RHZA 1AVTA 1UBLS 3I9KA 3PC3A 4DV0B 2W2TA 3PC8C 3IIMA 4FHZA 2OWEA 4QGGA 4PTYA 2ZAMA 1VZ3A 3LQQA 1IQRA 5FJIA 3T1NA 3JQ6A 3O21A 1IJEA 2O07A 3FFBA 4RHXA 4JB8A 4KDEA 2XMBA 1LW6E 4RY8A 3VSEA 4B47A 1NUSA 2D8MA 2VXOA 4G9EA 4YCBA 1VJTA 3RFCA 2W6CX 2A8YA 4X1KA 2QTVB 1FTGA 2KE5A 2P9FA 2YHIB 1YCFA 2GMWA 3EZXA 1O5ZA 5AI0A 3GAZA 3LDHA 5GVRA 1Q6YA 4BQNA 1ZOLA 5KVVA 3DAHA 3WGHA 5IJ0B 2XEXA 4P7KA 5BYKA 2IQIA 2QN9A 2NU8B 1H4TA 1A3CA 2O2YA 4N39A 3S7ZA 1HC7A 4KPYA 4OQ4A 1F6WA 1W0CA 3C48A 5JNWA 2XVMA 1GN8A 2FUEA 3FCXA 4YJ2F 5AJZA 5SZIA 1YGJA 3O38A 4PQYA 2ZZNA 3B3AA 1W25A 3MT0A 3E3OA 1Z5NA 1MIHA 2EATA 1IVNA 4MVJE 4P22A 3EIOA 1GCOA 3IODA 1DCFA 3CZ5A 2XI4A 4K9MA 5FTNA 2AZTA 2JCSA 2WM9B 3D3NA 3IP8A 3UK1A 4BZPA 2DDMA 2CVHA 1RWMA 2NUPA 2WYHA 2EXXA 4MP3A 1NR7A 2QU8A 4QC2A 5DOZA 3WIUA 4ZGBA 4WVLA 2V0GA 1UCFA 3U09A 1FLAA 5JZSA 1TQDA 3U4IA 5CNMA 3B60A 1NVUQ 4X20B 1EUZA 1YU6A 4J3FA 5GZ3A 3SPXA 3NTLA 2Y2UA 3NBMA 4L9RA 1RRGA 1SPXA 4PSCA 3IBFA 4PYOA 2P78A 5A9SB 2A86A 4G67A 2IF2A 2HTFA 4C78A 1V6CA 3V1MA 3HXMA 3IT1A 5HGXA 4M9CA 3VR6A 2VH2A 1LHPA 1N2CE 2E82A 2VP4A 4FR2A 1E63A 1VI2A 2H63A 2D7DA 1PV4A 3LT2A 1AS0A 4LZWA 4QQKA 5JTUA 1HT0A 1X7XB 2PEZA 2RHLA 3H0CA 1U4SA 4I9GA 2WJWA 2FRDC 3SF8A 3OFND 1HYGA 1K5HA 1ONBA 1I3KA 1JB1A 3CNNA 1YB2A 2FSFA 3JAWB 1Z6YA 3A6EA 1BCRA 1JMYA 3B6IA 4ER5A 4GKKB 5GQSA 2YFKA 5HF5A 4JLJA 5BYBA 5K0BA 4KPFC 1E6UA 4OO3A 1LF5A 4CWAA 5KYVA 3EVAA 3G6WA 1LBHA 4IKEA 3V6MA 3DCNA 2H2GA 3JQBA 4E6EA 4YXWA 4ZEVA 4LFBB 1WZIA 4LMPA 2AR7A 4ECEA 3KP1A 3W4KA 5FBVB 4V1CA 3MELA 3T4PA 4QOGA 4EI7A 1RHJA 3NR2A 2HCRA 3NH9A 4TTSA 3L8CA 4Y2XA 1XF9A 2F9LA 4HGOA 4XVHA 3VPXA 1VG8A 4WQMA 4ZHQF 2AOTA 2GCPA 3GAMA 2Q3HA 3LCVB 4WAUA 4ZOLB 4YRJA 4HQKA 2XTMA 1ZGGA 3EARA 4BNTA 2V3CC 2JGVA 3PNKA 4KFTA 1L4GA 1E6EA 2H0AA 3L6CA 1MB9A 2IZ0A 3W2GA 2VYVD 3L0SA 3F9RA 5I5EA 3AILA 1FJGB 5D01A 4OJMX 3DAOA 4OHCA 1E7SA 1QUEA 4U6QA 4MRMA 2R7LA 3RCBA 4D4GA 5EJEA 5H59A 3MGCA 2HK8A 4FEAA 1YZQA 2VP9A 2ZWAA 4P4TA 1BQ4A 4C9BA 1F12A 2RJ3A 2PYDA 3SJBA 1VKOA 3FPFA 1J06A 1QH9A 5KDDA 1RKDA 3RO4A 2NADA 1VP9A 3IE0A 3PFIA 4PU0A 4LBVA 4LAFA 2H31A 2GPWA 3A36A 3STWA 4PG8A 2IYTA 3QQ5A 4KKXB 4RJTA 3CGGA 4QJ3A 3M6AA 4F2WA 3AO0B 2CB9A 2YXTA 4G0YA 1J4AA 1XTIA 2QTHA 1I24A 1L5ZA 2FSSA 2FY8A 2HFKA 1DKRA 1R0LA 2O3SA 2YDXA 2BJWA 3IMEA 4X3OA 5ELMA 3U3XA 3QY0A 3AX6A 4HSEA 4KK4A 2XTBA 1UOEA 4LHWA 5E4JA 1FFBA 4CIAA 2A9RA 1P1FA 2C29D 2HXGA 2V96A 3N1UA 3TSZA 1M2GA 4BE9A 1A97A 3O4FA 2CJWA 2RJOA 4O08A 3C6ZA 1EVYA 3FFTA 4OYHA 5H68A 3S28A 4J0CA 3V4ZA 2Z8YM 1C0KA 1BOOA 1VSBA 2MSLA 1LHRA 1HETA 1SC6A 3P27A 1LPSA 3SSAA 3UCEA 2UYCA 2ZI9A 2X8AA 2Y77A 3V55A 1L7QA 2IYNA 3U81A 1UKEA 4GZ5A 3ZGVA 4J7XA 3ADPA 1SQ0A 1LJLA 5IS2A 1CJSA 1JEAA 4IV0A 1Q3HA 4D46A 2IY9A 3M83A 5C8YA 3U4HA 1U9JA 4L4UA 3ZIAA 2B8TA 4B8YA 4ZN6A 4JI7B 2SCUB 2I62A 4X61A 2VC2B 3TO5A 4Q4JB 4GE3A 4NE7A 1RKBA 3H9CA 3WKBA 2NPFA 4CNQA 2YKGA 2DFNA 3KZVA 1I5RA 1N25A 1ZQ1A 2CD9A 3F5MA 2WZDA 2AI2A 4I9NA 3Q9NA 3AM5A 4Q3EA 3PXXA 3RREA 3WRYC 1Y3HA 2AJ8A 1G8GA 2O0JA 2VPXA 2AK3A 4LHVA 4A0GA 4BMCA 4B83A 1FDRA 1MCZA 3EEBA 3L8DA 2GPYA 4XRGA 4F4HA 3CG4A 3ANMA 3WGMA 4DMRA 3ASYA 4J0JA 2WB4A 1GU0A 2RIPA 4FOOA 4ZIRA 1RWOA 2OOKA 4MV1A 1OBHA 2VYNA 1WXGA 2Y27A 1WZCA 3BC1A 5E6RA 1K8XB 2ZSJA 3ESQA 5I9SA 1L3CA 3IAS1 3KXKA 1K8ZB 4NBTA 3CW2A 4Y8VA 3WKAA 5IBQA 3I37X 4YT2A 2HA2A 1PLKA 1R6BX 3H19A 1G3UA 1ZIXA 2CDAA 1CUFA 3I5UA 3REQB 3WE7A 4D41A 3EIQA 2FJPA 3QBJA 4K2AA 1G6OA 1HT1E 2WKPA 4ZJYA 2FPIA 3U6KA 2PQ6A 2R1ZA 4JEIA 4BN5A 1WMAA 3L4BC 3JU3A 3QUTA 4MAFA 4CU2A 5B7QA 5F7JA 5IASA 3KU1A 2G4LA 4MO9A 3GIWA 2ZXEA 5E1BA 4EFLA 2V0CA 4Q4HA 2J3DA 3KR2A 3TLXA 2WWIA 4PSVA 4AMYA 4RTKA 3OQNA 4JKYA 2W98A 2WHQA 2OMEA 4V0RA 1ZKMA 3VSDA 3FNEA 3Q3JB 1ORRA 2WNSA 2AW3A 4OBEA 2AB8A 2B61A 1W88A 3LQ1A 2RGXA 4L0CA 3QVXA 1YGPA 1TAGA 4Q6WA 3AERB 1M5UA 1NWHA 2HJGA 4HFRA 1FLVA 4HJXA 5FNVB 3S55A 4NC9A 3OVMA 4MQEB 4RY9A 4WNIA 3PJFA 2NZ2A 1UWLA 2XNDA 4NU6A 3QVMA 4X3CA 3RNLA 1WLYA 1ZWLA 4PF1A 5B2EA 3F7TA 4S1MA 5B6JA 3BJRA 1OFUX 2VTKA 1NF3A 4BWFB 1OV6A 3RYIB 1R16A 2C98A 5DNWA 2XF8A 1ODTC 2GBLC 3AEXA 2YV3A 3RFVA 3UA3A 5TPZD 3OQIA 1IUNA 5B1YA 3MN1A 2JFHA 4V0MA 3P9RA 2HJSA 1T2AA 2HMSA 4TSFD 2M6KA 3TQTA 1E2HA 4CG2A 4ZZ0A 4DCOA 1SBHA 5TDHA 1OH5A 1SIUA 1YRYE 1ADYA 3ESZA 1NP7A 3ZJUA 2QS9A 3FYUC 3PIIA 3ZS9A 1Q84A 4K8CA 1JBKA 2IDJA 2J5QA 4AS1A 4U02A 1BN7A 5HBGA 4EY3A 4M89A 3Q1LA 3K70B 3G68A 2ZM5A 1DV2A 2GM3A 1IBLB 1RE0A 4A6XA 2BAGA 3CVJA 4RD0A 2HMWA 1P2FA 2Q28A 3WBBA 1LI7A 1NF9A 3D5EA 4PC2A 5DX8A 4HRAA 5CDHA 4EW1A 1VM7A 4HPWA 4E09A 2FFQA 4OHKA 1QH0A 2J9FA 1EKXA 3NRBA 4N3CA 3OX4A 4DUGD 3DVAB 1DEAA 5F21A 4EKNB 4RWZA 3ZY3A 3DL0A 2CNWA 1ZRHA 1N7HA 3DV9A 1N6PA 3B9PA 4NI5A 2ZUDA 2HC9A 1NTRA 3FKQA 1ENYA 4WCFB 4X92A