4EUMA

Crystal structure of a sugar kinase (target efi-502132) from oceanicola granulosus with bound amp, crystal form ii
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
302
structure length
294
Chain Sequence
GVDLGTENLYFQSMMHILSIGECMAELAPADLPGTYRLGFAGDTFNTAWYLARLRPESRISYFSAIGDDALSQQMRAAMSAAGIDGGGLRVIPGRTVGLYLIFAYWRGQSAARELAGDADALAAAMARADVVYFSGITLAILDQCGRATLLRALAQARATGRTIAFDPNLRPRLWAGTGEMTETIMQGAAVSDIALPSFEDEAAWFGDAGPDATADRYARAGVRSVVVKNGPHAVHFLQDGRRGRVPVPPVAQVVDTTAAGDSFNAGLLDSVLAGQPLETAIAAAAALAGQVVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a sugar kinase (Target EFI-502132) from Oceanicola granulosus with bound AMP, crystal form II
rcsb
source organism Oceanicola granulosus
molecule tags Transferase
molecule keywords 2-dehydro-3-deoxygluconokinase
total genus 102
structure length 294
sequence length 302
chains with identical sequence B
ec nomenclature ec 2.7.1.45: 2-dehydro-3-deoxygluconokinase.
pdb deposition date 2012-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 4eumA00
3B1QA 1KYHA 4C5JA 2Q5RA 5BYCA 1JXIA 2YXUA 3RTEA 1TZ3A 3IQ0A 2ABSA 1UB0A 1LHPA 2F02A 3QA2A 3RTAA 2C49A 4YWRA 3HYOA 3NL3A 5C3ZA 2PKKA 3IE7A 3Q92A 4KALA 1JXHA 3B1RA 3N1CA 4YL5A 4KANA 3RRFA 4LC4A 3NC9A 2DDOA 2PKFA 3RQHA 3Q1YA 3NBVA 3ZS7A 3BF5A 3KD6A 4XCKA 3H49A 1VM7A 1L2LA 1VK4A 1YGJA 2V78A 3GBUA 1GQTA 1YGKA 4N08A 2AWDA 3GO6A 3NBWA 3UMOA 4S1IA 1DGMA 4E8ZA 5CGAA 3UQ9A 1TZ6A 3IN1A 3RTGA 4LCAA 4S1MA 1LIIA 2DDMA 3HICA 1LHRA 3RS9A 3BGKA 3B3LA 4LBGA 3RT9A 4C5NA 4C5MA 2VARA 5F0ZA 3UQ6A 2HW1A 1WYEA 3I3YA 3HPDA 4K9CA 5EYNA 3NL5A 4DU5A 4E84A 3RQ6A 1EKKA 4WJMA 4K9IA 2YXTA 3RQ2A 3PZSA 2R3EA 3RQQA 3UQEA 4KAHA 3NC2A 1RFUA 4XF6A 3RRBA 3RREA 5CM5A 4K8CA 4XDAA 4E8YA 5F11A 3DZVA 2AFBA 2AB8A 3RU3A 5C40A 2NWHA 3OTXA 2I5BA 3PL2A 1RK2A 4EOHA 1UA4A 3IH0A 2HQQA 3MBJA 3H74A 3NM1A 4S1IB 3KZHA 3RT7A 3KTNA 4C5LA 2AJPA 3RPHA 5CGEA 3RQ8A 1ESJA 1TYYA 1ESQA 4GM6A 4JKSA 3UQDA 2FV7A 4DC3A 3RM5A 1LIOA 5C41A 3NL2A 3CQDA 4EBUA 3UBOA 4EUMA 1LIKA 2PKNA 3NL6A 3W4SA 2A9YA 3IKHA 4K8KA 3LOOA 3RY7A 2R3BA 4JKUA 3VASA 2JGVA 5BYEA 2PKMA 3RU2A 4O1LA 4K8TA 4E3AA 3B1NA 1RFVA 1C3QA 2JG5A 4KBEA 3LJSA 4LBXA 3QAIA 3LHXA 4E69A 4JJPA 3K9EA 1RKDA 2AX3A 2RBCA 5TQIA 2QCVA 3NCAA 3RQ5A 1EKQA 4K93A 2I6BA 2DDWA 3FHYA 1V1SA 4PVVA 2ABQA 5COJA 4X8FA 3RTBA 4B8RA 4K8PA 2AJRA 3B1PA 3LKIA 4E8WA 2XTBA 3MBHA 3RTDA 3FHXA 4C5KA 3K5WA 2DCNA 5BYDA 1TD2A 1V1BA 4KADA 5TRWA 3RSSA 5C3YA 3RSQA 3RSFA 3UMPA 1U2XA 4EN4A 3GO7A 3B1OA 3IBQA 3RQXA 4S1HA 4U7XA 4UBEA 1V1AA 3RSGA 3JULA 3VAQA 2A9ZA 3RS8A 3EWMA 4O1GA 1RKAA 5B6AA 5BYFA 1V19A 3RO4A 1YHJA 2HLZA 4N09A 1GC5A 1BX4A 2I6AA 4XF7A 3NM3A 2QHPA 2JG1A 3DRWA 3KEUA 3RPZA 3RRJA 3RTCA 4B8SA 1RKSA 2F7KA 5EY7A 1RFTA 2C4EA 1VI9A 2AA0A 1LIJA
chains in the Genus database with same CATH superfamily
2JFGA 1KYHA 3B1QA 4C5JA 5A5FA 2Q5RA 5BYCA 1JXIA 2YXUA 3RTEA 1UAGA 4N08A 1TZ3A 3IQ0A 1GQYA 2ABSA 1UB0A 1LHPA 2F02A 3QA2A 3RTAA 4E8ZA 2C49A 3NRSA 4YWRA 2AM1A 3HYOA 3LK7A 3NL3A 2PKKA 3IE7A 5C3ZA 3Q92A 4KALA 1JXHA 3B1RA 3N1CA 4YL5A 4KANA 3RRFA 2AM2A 4LC4A 3EAGA 3NC9A 2GC6A 2DDOA 2PKFA 3RQHA 3Q1YA 1P3DA 3NBVA 2VTDA 3ZS7A 3BF5A 4BUBA 3KD6A 4XCKA 3H49A 1VM7A 1L2LA 1VK4A 1YGJA 2V78A 2WTZA 1GQTA 1YGKA 3GBUA 2AWDA 3GO6A 3NBWA 2XPCA 2XJAA 1DGMA 4QF5A 4S1IA 3UQ9A 1TZ6A 2VTEA 3IN1A 3QCZA 3RTGA 4LCAA 4CVKA 2UAGA 4S1MA 1LIIA 2GC5A 2DDMA 3HICA 1LHRA 3RS9A 3BGKA 3B3LA 4LBGA 3PYZA 3RT9A 4C5NA 2VARA 4UAGA 4C5MA 5F0ZA 3UQ6A 1O5ZA 2F00A 1WYEA 2HW1A 3I3YA 3HPDA 4K9CA 5EYNA 3NL5A 4DU5A 4E84A 1J6UA 3N2AA 3RQ6A 1EKKA 4WJMA 4K9IA 2YXTA 3RQ2A 3PZSA 2R3EA 3HN7A 3RQQA 3UQEA 4KAHA 3NC2A 1RFUA 4XF6A 3RRBA 3RREA 5CM5A 4K8CA 4XDAA 4E8YA 5F11A 3DZVA 2AFBA 2AB8A 3RU3A 5C40A 2NWHA 3OTXA 2I5BA 2UUOA 3PL2A 2WJPA 1EEHA 1RK2A 4EOHA 1UA4A 3IH0A 2GCAA 2HQQA 3MBJA 3H74A 3NM1A 4S1IB 1E8CA 3KZHA 1FGSA 3RT7A 3KTNA 4CVLA 4C5LA 2AJPA 3ZL8A 4C12A 3RPHA 1P31A 3RQ8A 5CGEA 1ESJA 1TYYA 1ESQA 4GM6A 4JKSA 4C13A 2FV7A 3UQDA 2JFHA 4DC3A 4ZIYA 3RM5A 1LIOA 1W78A 3NL2A 3CQDA 4EBUA 3UBOA 4EUMA 1LIKA 2PKNA 5C41A 3NL6A 3W4SA 2Y1OA 3ZM6A 2A9YA 3IKHA 4K8KA 3LOOA 3RY7A 2R3BA 4JKUA 1GG4A 2JGVA 3VASA 5BYEA 5CGAA 2PKMA 3RU2A 4O1LA 4K8TA 4E3AA 3B1NA 1RFVA 1C3QA 2JG5A 3HJ6A 4KBEA 3LJSA 4LBXA 1W7KA 2JFFA 2Y67A 3LHXA 3QAIA 4JJPA 3K9EA 4E69A 2X5OA 1RKDA 2AX3A 2RBCA 5TQIA 1GQQA 2QCVA 2UUPA 2VOSA 3NCAA 3RQ5A 1EKQA 4K93A 2I6BA 2DDWA 3FHYA 3ZM5A 1V1SA 4PVVA 2ABQA 5COJA 4X8FA 1JBWA 3RTBA 4B8RA 4K8PA 4BUCA 2AJRA 3B1PA 3LKIA 4E8WA 2XTBA 3MBHA 3RTDA 3FHXA 4C5KA 3K5WA 2DCNA 5BYDA 1TD2A 1V1BA 4KADA 2VORA 5TRWA 3RSSA 2Y68A 3RSQA 5C3YA 4QDIA 3RSFA 3UMPA 1U2XA 4EN4A 2GCBA 3GO7A 3B1OA 3IBQA 4CVMA 3RQXA 4S1HA 4U7XA 4UBEA 1V1AA 3RSGA 3JULA 3VAQA 2A9ZA 1JBVA 3RS8A 3EWMA 4O1GA 1RKAA 5B6AA 5BYFA 4HV4A 1V19A 3RO4A 5A5EA 3UMOA 1YHJA 2HLZA 4N09A 1GC5A 1BX4A 1E0DA 2I6AA 4XF7A 3NM3A 2QHPA 2JG1A 3DRWA 3KEUA 3RPZA 3RRJA 3UAGA 3RTCA 4B8SA 1RKSA 2Y66A 2F7KA 5EY7A 1RFTA 2C4EA 1VI9A 2AA0A 1LIJA
chains in the Genus database with same CATH topology
3B1QA 1KYHA 4C5JA 2Q5RA 5BYCA 1JXIA 2YXUA 3RTEA 1TZ3A 3IQ0A 2ABSA 1UB0A 1LHPA 2F02A 3QA2A 3RTAA 2C49A 4YWRA 3HYOA 3NL3A 5C3ZA 2PKKA 3IE7A 3Q92A 4KALA 1JXHA 3B1RA 3N1CA 4YL5A 4KANA 3RRFA 4LC4A 3NC9A 2DDOA 2PKFA 3RQHA 3Q1YA 3NBVA 3ZS7A 3BF5A 3KD6A 4XCKA 3H49A 1VM7A 1L2LA 1VK4A 1YGJA 2V78A 3GBUA 1GQTA 1YGKA 4N08A 2AWDA 3GO6A 3NBWA 3UMOA 4S1IA 1DGMA 4E8ZA 5CGAA 3UQ9A 1TZ6A 3IN1A 3RTGA 4LCAA 4S1MA 1LIIA 2DDMA 3HICA 1LHRA 3RS9A 3BGKA 3B3LA 4LBGA 3RT9A 4C5NA 4C5MA 2VARA 5F0ZA 3UQ6A 2HW1A 1WYEA 3I3YA 3HPDA 4K9CA 5EYNA 3NL5A 4DU5A 4E84A 3RQ6A 1EKKA 4WJMA 4K9IA 2YXTA 3RQ2A 3PZSA 2R3EA 3RQQA 3UQEA 4KAHA 3NC2A 1RFUA 4XF6A 3RRBA 3RREA 5CM5A 4K8CA 4XDAA 4E8YA 5F11A 3DZVA 2AFBA 2AB8A 3RU3A 5C40A 2NWHA 3OTXA 2I5BA 3PL2A 1RK2A 4EOHA 1UA4A 3IH0A 2HQQA 3MBJA 3H74A 3NM1A 4S1IB 3KZHA 3RT7A 3KTNA 4C5LA 2AJPA 3RPHA 5CGEA 3RQ8A 1ESJA 1TYYA 1ESQA 4GM6A 4JKSA 3UQDA 2FV7A 4DC3A 3RM5A 1LIOA 5C41A 3NL2A 3CQDA 4EBUA 3UBOA 4EUMA 1LIKA 2PKNA 3NL6A 3W4SA 2A9YA 3IKHA 4K8KA 3LOOA 3RY7A 2R3BA 4JKUA 3VASA 2JGVA 5BYEA 2PKMA 3RU2A 4O1LA 4K8TA 4E3AA 3B1NA 1RFVA 1C3QA 2JG5A 3HJ6A 4KBEA 3LJSA 4LBXA 3QAIA 3LHXA 4E69A 4JJPA 3K9EA 1RKDA 2AX3A 2RBCA 5TQIA 2QCVA 3NCAA 3RQ5A 1EKQA 4K93A 2I6BA 2DDWA 3FHYA 1V1SA 4PVVA 2ABQA 5COJA 4X8FA 3RTBA 4B8RA 4K8PA 2AJRA 3B1PA 3LKIA 4E8WA 2XTBA 3MBHA 3RTDA 3FHXA 4C5KA 3K5WA 2DCNA 5BYDA 1TD2A 1V1BA 4KADA 5TRWA 3RSSA 5C3YA 3RSQA 3RSFA 3UMPA 1U2XA 4EN4A 3GO7A 3B1OA 3IBQA 3RQXA 4S1HA 4U7XA 4UBEA 1V1AA 3RSGA 3JULA 3VAQA 2A9ZA 3RS8A 3EWMA 4O1GA 1RKAA 5B6AA 5BYFA 1V19A 3RO4A 1YHJA 2HLZA 4N09A 1GC5A 1BX4A 2I6AA 4XF7A 3NM3A 2QHPA 2JG1A 3DRWA 3KEUA 3RPZA 3RRJA 3RTCA 4B8SA 1RKSA 2F7KA 5EY7A 1RFTA 2C4EA 1VI9A 2AA0A 1LIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B1Q A;  1KYH A;  4C5J A;  2Q5R A;  5BYC A;  1JXI A;  2YXU A;  3RTE A;  1TZ3 A;  3IQ0 A;  2ABS A;  1UB0 A;  1LHP A;  2F02 A;  3QA2 A;  3RTA A;  2C49 A;  4YWR A;  3HYO A;  3NL3 A;  5C3Z A;  2PKK A;  3IE7 A;  3Q92 A;  4KAL A;  1JXH A;  3B1R A;  3N1C A;  4YL5 A;  4KAN A;  3RRF A;  4LC4 A;  3NC9 A;  2DDO A;  2PKF A;  3RQH A;  3Q1Y A;  3NBV A;  3ZS7 A;  3BF5 A;  3KD6 A;  4XCK A;  3H49 A;  1VM7 A;  1L2L A;  1VK4 A;  1YGJ A;  2V78 A;  3GBU A;  1GQT A;  1YGK A;  4N08 A;  2AWD A;  3GO6 A;  3NBW A;  3UMO A;  4S1I A;  1DGM A;  4E8Z A;  5CGA A;  3UQ9 A;  1TZ6 A;  3IN1 A;  3RTG A;  4LCA A;  4S1M A;  1LII A;  2DDM A;  3HIC A;  1LHR A;  3RS9 A;  3BGK A;  3B3L A;  4LBG A;  3RT9 A;  4C5N A;  4C5M A;  2VAR A;  5F0Z A;  3UQ6 A;  2HW1 A;  1WYE A;  3I3Y A;  3HPD A;  4K9C A;  5EYN A;  3NL5 A;  4DU5 A;  4E84 A;  3RQ6 A;  1EKK A;  4WJM A;  4K9I A;  2YXT A;  3RQ2 A;  3PZS A;  2R3E A;  3RQQ A;  3UQE A;  4KAH A;  3NC2 A;  1RFU A;  4XF6 A;  3RRB A;  3RRE A;  5CM5 A;  4K8C A;  4XDA A;  4E8Y A;  5F11 A;  3DZV A;  2AFB A;  2AB8 A;  3RU3 A;  5C40 A;  2NWH A;  3OTX A;  2I5B A;  3PL2 A;  1RK2 A;  4EOH A;  1UA4 A;  3IH0 A;  2HQQ A;  3MBJ A;  3H74 A;  3NM1 A;  4S1I B;  3KZH A;  3RT7 A;  3KTN A;  4C5L A;  2AJP A;  3RPH A;  5CGE A;  3RQ8 A;  1ESJ A;  1TYY A;  1ESQ A;  4GM6 A;  4JKS A;  3UQD A;  2FV7 A;  4DC3 A;  3RM5 A;  1LIO A;  5C41 A;  3NL2 A;  3CQD A;  4EBU A;  3UBO A;  4EUM A;  1LIK A;  2PKN A;  3NL6 A;  3W4S A;  2A9Y A;  3IKH A;  4K8K A;  3LOO A;  3RY7 A;  2R3B A;  4JKU A;  3VAS A;  2JGV A;  5BYE A;  2PKM A;  3RU2 A;  4O1L A;  4K8T A;  4E3A A;  3B1N A;  1RFV A;  1C3Q A;  2JG5 A;  4KBE A;  3LJS A;  4LBX A;  3QAI A;  3LHX A;  4E69 A;  4JJP A;  3K9E A;  1RKD A;  2AX3 A;  2RBC A;  5TQI A;  2QCV A;  3NCA A;  3RQ5 A;  1EKQ A;  4K93 A;  2I6B A;  2DDW A;  3FHY A;  1V1S A;  4PVV A;  2ABQ A;  5COJ A;  4X8F A;  3RTB A;  4B8R A;  4K8P A;  2AJR A;  3B1P A;  3LKI A;  4E8W A;  2XTB A;  3MBH A;  3RTD A;  3FHX A;  4C5K A;  3K5W A;  2DCN A;  5BYD A;  1TD2 A;  1V1B A;  4KAD A;  5TRW A;  3RSS A;  5C3Y A;  3RSQ A;  3RSF A;  3UMP A;  1U2X A;  4EN4 A;  3GO7 A;  3B1O A;  3IBQ A;  3RQX A;  4S1H A;  4U7X A;  4UBE A;  1V1A A;  3RSG A;  3JUL A;  3VAQ A;  2A9Z A;  3RS8 A;  3EWM A;  4O1G A;  1RKA A;  5B6A A;  5BYF A;  1V19 A;  3RO4 A;  1YHJ A;  2HLZ A;  4N09 A;  1GC5 A;  1BX4 A;  2I6A A;  4XF7 A;  3NM3 A;  2QHP A;  2JG1 A;  3DRW A;  3KEU A;  3RPZ A;  3RRJ A;  3RTC A;  4B8S A;  1RKS A;  2F7K A;  5EY7 A;  1RFT A;  2C4E A;  1VI9 A;  2AA0 A;  1LIJ A; 
#chains in the Genus database with same CATH topology
 2JFG A;  1KYH A;  3B1Q A;  4C5J A;  5A5F A;  2Q5R A;  5BYC A;  1JXI A;  2YXU A;  3RTE A;  1UAG A;  4N08 A;  1TZ3 A;  3IQ0 A;  1GQY A;  2ABS A;  1UB0 A;  1LHP A;  2F02 A;  3QA2 A;  3RTA A;  4E8Z A;  2C49 A;  3NRS A;  4YWR A;  2AM1 A;  3HYO A;  3LK7 A;  3NL3 A;  2PKK A;  3IE7 A;  5C3Z A;  3Q92 A;  4KAL A;  1JXH A;  3B1R A;  3N1C A;  4YL5 A;  4KAN A;  3RRF A;  2AM2 A;  4LC4 A;  3EAG A;  3NC9 A;  2GC6 A;  2DDO A;  2PKF A;  3RQH A;  3Q1Y A;  1P3D A;  3NBV A;  2VTD A;  3ZS7 A;  3BF5 A;  4BUB A;  3KD6 A;  4XCK A;  3H49 A;  1VM7 A;  1L2L A;  1VK4 A;  1YGJ A;  2V78 A;  2WTZ A;  1GQT A;  1YGK A;  3GBU A;  2AWD A;  3GO6 A;  3NBW A;  2XPC A;  2XJA A;  1DGM A;  4QF5 A;  4S1I A;  3UQ9 A;  1TZ6 A;  2VTE A;  3IN1 A;  3QCZ A;  3RTG A;  4LCA A;  4CVK A;  2UAG A;  4S1M A;  1LII A;  2GC5 A;  2DDM A;  3HIC A;  1LHR A;  3RS9 A;  3BGK A;  3B3L A;  4LBG A;  3PYZ A;  3RT9 A;  4C5N A;  2VAR A;  4UAG A;  4C5M A;  5F0Z A;  3UQ6 A;  1O5Z A;  2F00 A;  1WYE A;  2HW1 A;  3I3Y A;  3HPD A;  4K9C A;  5EYN A;  3NL5 A;  4DU5 A;  4E84 A;  1J6U A;  3N2A A;  3RQ6 A;  1EKK A;  4WJM A;  4K9I A;  2YXT A;  3RQ2 A;  3PZS A;  2R3E A;  3HN7 A;  3RQQ A;  3UQE A;  4KAH A;  3NC2 A;  1RFU A;  4XF6 A;  3RRB A;  3RRE A;  5CM5 A;  4K8C A;  4XDA A;  4E8Y A;  5F11 A;  3DZV A;  2AFB A;  2AB8 A;  3RU3 A;  5C40 A;  2NWH A;  3OTX A;  2I5B A;  2UUO A;  3PL2 A;  2WJP A;  1EEH A;  1RK2 A;  4EOH A;  1UA4 A;  3IH0 A;  2GCA A;  2HQQ A;  3MBJ A;  3H74 A;  3NM1 A;  4S1I B;  1E8C A;  3KZH A;  1FGS A;  3RT7 A;  3KTN A;  4CVL A;  4C5L A;  2AJP A;  3ZL8 A;  4C12 A;  3RPH A;  1P31 A;  3RQ8 A;  5CGE A;  1ESJ A;  1TYY A;  1ESQ A;  4GM6 A;  4JKS A;  4C13 A;  2FV7 A;  3UQD A;  2JFH A;  4DC3 A;  4ZIY A;  3RM5 A;  1LIO A;  1W78 A;  3NL2 A;  3CQD A;  4EBU A;  3UBO A;  4EUM A;  1LIK A;  2PKN A;  5C41 A;  3NL6 A;  3W4S A;  2Y1O A;  3ZM6 A;  2A9Y A;  3IKH A;  4K8K A;  3LOO A;  3RY7 A;  2R3B A;  4JKU A;  1GG4 A;  2JGV A;  3VAS A;  5BYE A;  5CGA A;  2PKM A;  3RU2 A;  4O1L A;  4K8T A;  4E3A A;  3B1N A;  1RFV A;  1C3Q A;  2JG5 A;  3HJ6 A;  4KBE A;  3LJS A;  4LBX A;  1W7K A;  2JFF A;  2Y67 A;  3LHX A;  3QAI A;  4JJP A;  3K9E A;  4E69 A;  2X5O A;  1RKD A;  2AX3 A;  2RBC A;  5TQI A;  1GQQ A;  2QCV A;  2UUP A;  2VOS A;  3NCA A;  3RQ5 A;  1EKQ A;  4K93 A;  2I6B A;  2DDW A;  3FHY A;  3ZM5 A;  1V1S A;  4PVV A;  2ABQ A;  5COJ A;  4X8F A;  1JBW A;  3RTB A;  4B8R A;  4K8P A;  4BUC A;  2AJR A;  3B1P A;  3LKI A;  4E8W A;  2XTB A;  3MBH A;  3RTD A;  3FHX A;  4C5K A;  3K5W A;  2DCN A;  5BYD A;  1TD2 A;  1V1B A;  4KAD A;  2VOR A;  5TRW A;  3RSS A;  2Y68 A;  3RSQ A;  5C3Y A;  4QDI A;  3RSF A;  3UMP A;  1U2X A;  4EN4 A;  2GCB A;  3GO7 A;  3B1O A;  3IBQ A;  4CVM A;  3RQX A;  4S1H A;  4U7X A;  4UBE A;  1V1A A;  3RSG A;  3JUL A;  3VAQ A;  2A9Z A;  1JBV A;  3RS8 A;  3EWM A;  4O1G A;  1RKA A;  5B6A A;  5BYF A;  4HV4 A;  1V19 A;  3RO4 A;  5A5E A;  3UMO A;  1YHJ A;  2HLZ A;  4N09 A;  1GC5 A;  1BX4 A;  1E0D A;  2I6A A;  4XF7 A;  3NM3 A;  2QHP A;  2JG1 A;  3DRW A;  3KEU A;  3RPZ A;  3RRJ A;  3UAG A;  3RTC A;  4B8S A;  1RKS A;  2Y66 A;  2F7K A;  5EY7 A;  1RFT A;  2C4E A;  1VI9 A;  2AA0 A;  1LIJ A; 
#chains in the Genus database with same CATH homology
 3B1Q A;  1KYH A;  4C5J A;  2Q5R A;  5BYC A;  1JXI A;  2YXU A;  3RTE A;  1TZ3 A;  3IQ0 A;  2ABS A;  1UB0 A;  1LHP A;  2F02 A;  3QA2 A;  3RTA A;  2C49 A;  4YWR A;  3HYO A;  3NL3 A;  5C3Z A;  2PKK A;  3IE7 A;  3Q92 A;  4KAL A;  1JXH A;  3B1R A;  3N1C A;  4YL5 A;  4KAN A;  3RRF A;  4LC4 A;  3NC9 A;  2DDO A;  2PKF A;  3RQH A;  3Q1Y A;  3NBV A;  3ZS7 A;  3BF5 A;  3KD6 A;  4XCK A;  3H49 A;  1VM7 A;  1L2L A;  1VK4 A;  1YGJ A;  2V78 A;  3GBU A;  1GQT A;  1YGK A;  4N08 A;  2AWD A;  3GO6 A;  3NBW A;  3UMO A;  4S1I A;  1DGM A;  4E8Z A;  5CGA A;  3UQ9 A;  1TZ6 A;  3IN1 A;  3RTG A;  4LCA A;  4S1M A;  1LII A;  2DDM A;  3HIC A;  1LHR A;  3RS9 A;  3BGK A;  3B3L A;  4LBG A;  3RT9 A;  4C5N A;  4C5M A;  2VAR A;  5F0Z A;  3UQ6 A;  2HW1 A;  1WYE A;  3I3Y A;  3HPD A;  4K9C A;  5EYN A;  3NL5 A;  4DU5 A;  4E84 A;  3RQ6 A;  1EKK A;  4WJM A;  4K9I A;  2YXT A;  3RQ2 A;  3PZS A;  2R3E A;  3RQQ A;  3UQE A;  4KAH A;  3NC2 A;  1RFU A;  4XF6 A;  3RRB A;  3RRE A;  5CM5 A;  4K8C A;  4XDA A;  4E8Y A;  5F11 A;  3DZV A;  2AFB A;  2AB8 A;  3RU3 A;  5C40 A;  2NWH A;  3OTX A;  2I5B A;  3PL2 A;  1RK2 A;  4EOH A;  1UA4 A;  3IH0 A;  2HQQ A;  3MBJ A;  3H74 A;  3NM1 A;  4S1I B;  3KZH A;  3RT7 A;  3KTN A;  4C5L A;  2AJP A;  3RPH A;  5CGE A;  3RQ8 A;  1ESJ A;  1TYY A;  1ESQ A;  4GM6 A;  4JKS A;  3UQD A;  2FV7 A;  4DC3 A;  3RM5 A;  1LIO A;  5C41 A;  3NL2 A;  3CQD A;  4EBU A;  3UBO A;  4EUM A;  1LIK A;  2PKN A;  3NL6 A;  3W4S A;  2A9Y A;  3IKH A;  4K8K A;  3LOO A;  3RY7 A;  2R3B A;  4JKU A;  3VAS A;  2JGV A;  5BYE A;  2PKM A;  3RU2 A;  4O1L A;  4K8T A;  4E3A A;  3B1N A;  1RFV A;  1C3Q A;  2JG5 A;  3HJ6 A;  4KBE A;  3LJS A;  4LBX A;  3QAI A;  3LHX A;  4E69 A;  4JJP A;  3K9E A;  1RKD A;  2AX3 A;  2RBC A;  5TQI A;  2QCV A;  3NCA A;  3RQ5 A;  1EKQ A;  4K93 A;  2I6B A;  2DDW A;  3FHY A;  1V1S A;  4PVV A;  2ABQ A;  5COJ A;  4X8F A;  3RTB A;  4B8R A;  4K8P A;  2AJR A;  3B1P A;  3LKI A;  4E8W A;  2XTB A;  3MBH A;  3RTD A;  3FHX A;  4C5K A;  3K5W A;  2DCN A;  5BYD A;  1TD2 A;  1V1B A;  4KAD A;  5TRW A;  3RSS A;  5C3Y A;  3RSQ A;  3RSF A;  3UMP A;  1U2X A;  4EN4 A;  3GO7 A;  3B1O A;  3IBQ A;  3RQX A;  4S1H A;  4U7X A;  4UBE A;  1V1A A;  3RSG A;  3JUL A;  3VAQ A;  2A9Z A;  3RS8 A;  3EWM A;  4O1G A;  1RKA A;  5B6A A;  5BYF A;  1V19 A;  3RO4 A;  1YHJ A;  2HLZ A;  4N09 A;  1GC5 A;  1BX4 A;  2I6A A;  4XF7 A;  3NM3 A;  2QHP A;  2JG1 A;  3DRW A;  3KEU A;  3RPZ A;  3RRJ A;  3RTC A;  4B8S A;  1RKS A;  2F7K A;  5EY7 A;  1RFT A;  2C4E A;  1VI9 A;  2AA0 A;  1LIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...