4EUMA

Crystal structure of a sugar kinase (target efi-502132) from oceanicola granulosus with bound amp, crystal form ii
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
302
structure length
294
Chain Sequence
GVDLGTENLYFQSMMHILSIGECMAELAPADLPGTYRLGFAGDTFNTAWYLARLRPESRISYFSAIGDDALSQQMRAAMSAAGIDGGGLRVIPGRTVGLYLIFAYWRGQSAARELAGDADALAAAMARADVVYFSGITLAILDQCGRATLLRALAQARATGRTIAFDPNLRPRLWAGTGEMTETIMQGAAVSDIALPSFEDEAAWFGDAGPDATADRYARAGVRSVVVKNGPHAVHFLQDGRRGRVPVPPVAQVVDTTAAGDSFNAGLLDSVLAGQPLETAIAAAAALAGQVVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a sugar kinase (Target EFI-502132) from Oceanicola granulosus with bound AMP, crystal form II
rcsb
source organism Oceanicola granulosus
molecule tags Transferase
molecule keywords 2-dehydro-3-deoxygluconokinase
total genus 102
structure length 294
sequence length 302
chains with identical sequence B
ec nomenclature ec 2.7.1.45: 2-dehydro-3-deoxygluconokinase.
pdb deposition date 2012-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 4eumA00
4XF7A 3RTAA 5C3YA 3UBOA 3RTGA 3NL5A 3LKIA 1C3QA 1TYYA 2F02A 1YGJA 1YHJA 3RSGA 3BF5A 2V78A 2XTBA 4LBGA 3RRJA 1GC5A 1V19A 4KANA 5F0ZA 3W4SA 5C41A 3H49A 2AFBA 3IN1A 3I3YA 3RRFA 3NBWA 1TZ6A 4XDAA 3RRBA 1RKDA 4B8SA 1UB0A 4K8PA 1TD2A 3LHXA 3IKHA 4JKUA 5EYNA 3B1QA 3HYOA 3FHYA 4XF6A 3N1CA 5F11A 3RSFA 2YXUA 2AJPA 3K9EA 1JXHA 3KD6A 1RFTA 3RQXA 1LHPA 3K5WA 5BYFA 5BYEA 1V1AA 2HLZA 3IH0A 5BYCA 4E69A 3RPHA 5CM5A 1UA4A 3NBVA 3OTXA 3PL2A 3RQ5A 3B3LA 3RQ6A 2RBCA 3HPDA 2I5BA 5CGEA 1EKKA 1LHRA 4E8ZA 3RQQA 3VAQA 1RKAA 4LCAA 2DDMA 4E3AA 1VK4A 2NWHA 4X8FA 4C5NA 3RQ8A 5C40A 3Q92A 4N09A 3UQ9A 4JKSA 3UQ6A 3RTDA 3GBUA 2HW1A 4LC4A 4S1MA 4DC3A 3DRWA 1WYEA 4JJPA 3DZVA 2DDOA 3QAIA 1L2LA 3HICA 4K93A 4XCKA 3LOOA 1U2XA 5TQIA 1ESJA 3LJSA 3IQ0A 1LIKA 2AWDA 3B1RA 4O1GA 2I6BA 2FV7A 1BX4A 2PKNA 1VM7A 2A9YA 2A9ZA 2DDWA 2I6AA 3RREA 4C5MA 4E8YA 4E84A 1RKSA 2YXTA 4K8KA 2QHPA 3UMOA 3ZS7A 3JULA 2DCNA 3BGKA 3KTNA 4YWRA 1LIOA 4PVVA 3NC2A 5EY7A 3RS8A 1GQTA 4E8WA 1EKQA 4C5JA 1LIIA 3B1NA 4K8TA 2F7KA 2AJRA 5COJA 4C5KA 4S1IB 4B8RA 4UBEA 2Q5RA 4YL5A 3RY7A 1RFVA 3RPZA 2ABQA 3RTCA 4N08A 1KYHA 1TZ3A 2AA0A 3IE7A 4C5LA 2ABSA 5C3ZA 3RO4A 3Q1YA 4KADA 3RQ2A 3GO7A 3RQHA 3EWMA 4EBUA 3QA2A 2HQQA 4LBXA 4KBEA 3RSQA 3RSSA 1ESQA 1RK2A 2VARA 1JXIA 4U7XA 2R3EA 3CQDA 5TRWA 3NCAA 1RFUA 4K9IA 1VI9A 2AB8A 4KALA 3RS9A 3B1OA 3NC9A 3UQDA 3RTEA 3VASA 2PKKA 1DGMA 2QCVA 5CGAA 4O1LA 4EOHA 2C4EA 3RU3A 4DU5A 2R3BA 4K9CA 5B6AA 2JGVA 4S1IA 2JG5A 3RU2A 5BYDA 3NL3A 3NM1A 3FHXA 3B1PA 3MBHA 3NL6A 4K8CA 1V1SA 3NL2A 1V1BA 4EUMA 2PKFA 2C49A 3PZSA 4GM6A 3RM5A 3MBJA 1LIJA 2AX3A 3H74A 3RTBA 4EN4A 3RT9A 3NM3A 3GO6A 4S1HA 3KZHA 3IBQA 3RT7A 2PKMA 3UMPA 3UQEA 1YGKA 4KAHA 4WJMA 3KEUA 2JG1A
chains in the Genus database with same CATH superfamily
2JFGA 4XF7A 3RTAA 5C3YA 3UBOA 3RTGA 3NL5A 3LKIA 1C3QA 1TYYA 2F02A 1JBWA 1YGJA 1YHJA 3RSGA 3BF5A 2V78A 2XTBA 4LBGA 3RRJA 1GC5A 1V19A 1UAGA 4KANA 3W4SA 5F0ZA 2F00A 1W78A 5C41A 3H49A 2AFBA 3IN1A 3I3YA 3RRFA 3NBWA 1TZ6A 4XDAA 3RRBA 1GQQA 1P31A 1RKDA 4B8SA 1UB0A 4K8PA 1TD2A 3LHXA 3IKHA 4JKUA 5EYNA 3B1QA 3HYOA 3FHYA 4XF6A 3N1CA 5F11A 3RSFA 1EEHA 2YXUA 2AJPA 3K9EA 1JXHA 3KD6A 2Y66A 1RFTA 3RQXA 1LHPA 3K5WA 5BYFA 5BYEA 1V1AA 2HLZA 3IH0A 2AM1A 4ZIYA 5BYCA 4E69A 3RPHA 2Y68A 2Y67A 5CM5A 1UA4A 3NBVA 3OTXA 3PL2A 3RQ5A 1JBVA 3B3LA 3RQ6A 5A5FA 2RBCA 3HPDA 2I5BA 5CGEA 1EKKA 1LHRA 1J6UA 3EAGA 3RQQA 1RKAA 3VAQA 4BUCA 4LCAA 2DDMA 4CVLA 1VK4A 4E3AA 1E8CA 2NWHA 2VOSA 4X8FA 2X5OA 4C5NA 3RQ8A 5C40A 3Q92A 4N09A 3UQ9A 4JKSA 3UQ6A 3RTDA 3GBUA 1E0DA 2HW1A 4LC4A 4S1MA 4DC3A 3DRWA 2WJPA 1WYEA 4JJPA 3DZVA 1GG4A 2DDOA 1L2LA 3HICA 3LK7A 3QAIA 3LOOA 4K93A 4XCKA 1U2XA 5TQIA 1ESJA 4UAGA 3LJSA 3IQ0A 2GC5A 2Y1OA 2VTEA 1LIKA 5A5EA 2AWDA 3B1RA 4O1GA 2FV7A 2I6BA 1BX4A 1VM7A 2A9YA 2A9ZA 2DDWA 2I6AA 2PKNA 3NRSA 2JFFA 4C5MA 4C13A 4E8YA 4E84A 1RKSA 2YXTA 1O5ZA 4K8KA 2QHPA 3UMOA 4CVKA 3ZS7A 3JULA 2DCNA 3BGKA 3KTNA 2VTDA 4YWRA 2UAGA 1LIOA 4PVVA 3ZM6A 3NC2A 5EY7A 3RS8A 1GQTA 4E8WA 1EKQA 4C5JA 1LIIA 3B1NA 4K8TA 2XPCA 2F7KA 2AJRA 5COJA 2AM2A 4C5KA 4S1IB 4B8RA 4UBEA 2UUOA 2Q5RA 4YL5A 3RY7A 4QDIA 1RFVA 3RPZA 4C12A 4HV4A 2ABQA 3RTCA 3QCZA 4N08A 1KYHA 1TZ3A 2AA0A 3IE7A 4C5LA 2ABSA 5C3ZA 3RO4A 2GC6A 3Q1YA 1W7KA 3GO7A 4KADA 3EWMA 3RQ2A 2GCAA 2VORA 3QA2A 3RQHA 2HQQA 4LBXA 4KBEA 3RSQA 4CVMA 3RSSA 1ESQA 1RK2A 2VARA 1JXIA 3PYZA 4U7XA 2R3EA 3CQDA 3HJ6A 1GQYA 3NCAA 4QF5A 5TRWA 1RFUA 4K9IA 1VI9A 2AB8A 2JFHA 4KALA 1P3DA 3B1OA 3RS9A 4EBUA 3NC9A 3UQDA 2WTZA 3RTEA 2PKKA 3VASA 1DGMA 2QCVA 5CGAA 4O1LA 4EOHA 2UUPA 2C4EA 3RU3A 4DU5A 2R3BA 4K9CA 5B6AA 2JGVA 4S1IA 2JG5A 3RU2A 5BYDA 3NL3A 3NM1A 3FHXA 3B1PA 3MBHA 3NL6A 4K8CA 2GCBA 2XJAA 3ZM5A 1V1SA 3NL2A 1V1BA 3N2AA 4EUMA 2PKFA 2C49A 1FGSA 3PZSA 4GM6A 3RM5A 3ZL8A 4E8ZA 3MBJA 1LIJA 2AX3A 3H74A 3RTBA 4EN4A 3RT9A 3NM3A 3GO6A 4S1HA 3KZHA 3IBQA 3RT7A 2PKMA 3UMPA 3UQEA 4BUBA 1YGKA 4KAHA 3HN7A 4WJMA 3RREA 3KEUA 2JG1A 3UAGA
chains in the Genus database with same CATH topology
4XF7A 3RTAA 5C3YA 3UBOA 3RTGA 3NL5A 3LKIA 1C3QA 1TYYA 2F02A 1YGJA 1YHJA 3RSGA 3BF5A 2V78A 2XTBA 4LBGA 3RRJA 1GC5A 1V19A 4KANA 5F0ZA 3W4SA 5C41A 3H49A 2AFBA 3IN1A 3I3YA 3RRFA 3NBWA 1TZ6A 4XDAA 3RRBA 1RKDA 4B8SA 1UB0A 4K8PA 1TD2A 3LHXA 3IKHA 4JKUA 5EYNA 3B1QA 3HYOA 3FHYA 4XF6A 3N1CA 5F11A 3RSFA 2YXUA 2AJPA 3K9EA 1JXHA 3KD6A 1RFTA 3RQXA 1LHPA 3K5WA 5BYFA 5BYEA 1V1AA 2HLZA 3IH0A 5BYCA 4E69A 3RPHA 5CM5A 1UA4A 3NBVA 3OTXA 3PL2A 3RQ5A 3B3LA 3RQ6A 2RBCA 3HPDA 2I5BA 5CGEA 1EKKA 1LHRA 4E8ZA 3RQQA 3VAQA 1RKAA 4LCAA 2DDMA 4E3AA 1VK4A 2NWHA 4X8FA 4C5NA 3RQ8A 5C40A 3Q92A 4N09A 3UQ9A 4JKSA 3UQ6A 3RTDA 3GBUA 2HW1A 4LC4A 4S1MA 4DC3A 3DRWA 1WYEA 4JJPA 3DZVA 2DDOA 3QAIA 1L2LA 3HICA 4K93A 4XCKA 3LOOA 1U2XA 5TQIA 1ESJA 3LJSA 3IQ0A 1LIKA 2AWDA 3B1RA 4O1GA 2I6BA 2FV7A 1BX4A 2PKNA 1VM7A 2A9YA 2A9ZA 2DDWA 2I6AA 3RREA 4C5MA 4E8YA 4E84A 1RKSA 2YXTA 4K8KA 2QHPA 3UMOA 3ZS7A 3JULA 2DCNA 3BGKA 3KTNA 4YWRA 1LIOA 4PVVA 3NC2A 5EY7A 3RS8A 1GQTA 4E8WA 1EKQA 4C5JA 1LIIA 3B1NA 4K8TA 2F7KA 2AJRA 5COJA 4C5KA 4S1IB 4B8RA 4UBEA 2Q5RA 4YL5A 3RY7A 1RFVA 3RPZA 2ABQA 3RTCA 4N08A 1KYHA 1TZ3A 2AA0A 3IE7A 4C5LA 2ABSA 5C3ZA 3RO4A 3Q1YA 4KADA 3RQ2A 3GO7A 3RQHA 3EWMA 4EBUA 3QA2A 2HQQA 4LBXA 4KBEA 3RSQA 3RSSA 1ESQA 1RK2A 2VARA 1JXIA 4U7XA 2R3EA 3CQDA 3HJ6A 5TRWA 3NCAA 1RFUA 4K9IA 1VI9A 2AB8A 4KALA 3RS9A 3B1OA 3NC9A 3UQDA 3RTEA 3VASA 2PKKA 1DGMA 2QCVA 5CGAA 4O1LA 4EOHA 2C4EA 3RU3A 4DU5A 2R3BA 4K9CA 5B6AA 2JGVA 4S1IA 2JG5A 3RU2A 5BYDA 3NL3A 3NM1A 3FHXA 3B1PA 3MBHA 3NL6A 4K8CA 1V1SA 3NL2A 1V1BA 4EUMA 2PKFA 2C49A 3PZSA 4GM6A 3RM5A 3MBJA 1LIJA 2AX3A 3H74A 3RTBA 4EN4A 3RT9A 3NM3A 3GO6A 4S1HA 3KZHA 3IBQA 3RT7A 2PKMA 3UMPA 3UQEA 1YGKA 4KAHA 4WJMA 3KEUA 2JG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XF7 A;  3RTA A;  5C3Y A;  3UBO A;  3RTG A;  3NL5 A;  3LKI A;  1C3Q A;  1TYY A;  2F02 A;  1YGJ A;  1YHJ A;  3RSG A;  3BF5 A;  2V78 A;  2XTB A;  4LBG A;  3RRJ A;  1GC5 A;  1V19 A;  4KAN A;  5F0Z A;  3W4S A;  5C41 A;  3H49 A;  2AFB A;  3IN1 A;  3I3Y A;  3RRF A;  3NBW A;  1TZ6 A;  4XDA A;  3RRB A;  1RKD A;  4B8S A;  1UB0 A;  4K8P A;  1TD2 A;  3LHX A;  3IKH A;  4JKU A;  5EYN A;  3B1Q A;  3HYO A;  3FHY A;  4XF6 A;  3N1C A;  5F11 A;  3RSF A;  2YXU A;  2AJP A;  3K9E A;  1JXH A;  3KD6 A;  1RFT A;  3RQX A;  1LHP A;  3K5W A;  5BYF A;  5BYE A;  1V1A A;  2HLZ A;  3IH0 A;  5BYC A;  4E69 A;  3RPH A;  5CM5 A;  1UA4 A;  3NBV A;  3OTX A;  3PL2 A;  3RQ5 A;  3B3L A;  3RQ6 A;  2RBC A;  3HPD A;  2I5B A;  5CGE A;  1EKK A;  1LHR A;  4E8Z A;  3RQQ A;  3VAQ A;  1RKA A;  4LCA A;  2DDM A;  4E3A A;  1VK4 A;  2NWH A;  4X8F A;  4C5N A;  3RQ8 A;  5C40 A;  3Q92 A;  4N09 A;  3UQ9 A;  4JKS A;  3UQ6 A;  3RTD A;  3GBU A;  2HW1 A;  4LC4 A;  4S1M A;  4DC3 A;  3DRW A;  1WYE A;  4JJP A;  3DZV A;  2DDO A;  3QAI A;  1L2L A;  3HIC A;  4K93 A;  4XCK A;  3LOO A;  1U2X A;  5TQI A;  1ESJ A;  3LJS A;  3IQ0 A;  1LIK A;  2AWD A;  3B1R A;  4O1G A;  2I6B A;  2FV7 A;  1BX4 A;  2PKN A;  1VM7 A;  2A9Y A;  2A9Z A;  2DDW A;  2I6A A;  3RRE A;  4C5M A;  4E8Y A;  4E84 A;  1RKS A;  2YXT A;  4K8K A;  2QHP A;  3UMO A;  3ZS7 A;  3JUL A;  2DCN A;  3BGK A;  3KTN A;  4YWR A;  1LIO A;  4PVV A;  3NC2 A;  5EY7 A;  3RS8 A;  1GQT A;  4E8W A;  1EKQ A;  4C5J A;  1LII A;  3B1N A;  4K8T A;  2F7K A;  2AJR A;  5COJ A;  4C5K A;  4S1I B;  4B8R A;  4UBE A;  2Q5R A;  4YL5 A;  3RY7 A;  1RFV A;  3RPZ A;  2ABQ A;  3RTC A;  4N08 A;  1KYH A;  1TZ3 A;  2AA0 A;  3IE7 A;  4C5L A;  2ABS A;  5C3Z A;  3RO4 A;  3Q1Y A;  4KAD A;  3RQ2 A;  3GO7 A;  3RQH A;  3EWM A;  4EBU A;  3QA2 A;  2HQQ A;  4LBX A;  4KBE A;  3RSQ A;  3RSS A;  1ESQ A;  1RK2 A;  2VAR A;  1JXI A;  4U7X A;  2R3E A;  3CQD A;  5TRW A;  3NCA A;  1RFU A;  4K9I A;  1VI9 A;  2AB8 A;  4KAL A;  3RS9 A;  3B1O A;  3NC9 A;  3UQD A;  3RTE A;  3VAS A;  2PKK A;  1DGM A;  2QCV A;  5CGA A;  4O1L A;  4EOH A;  2C4E A;  3RU3 A;  4DU5 A;  2R3B A;  4K9C A;  5B6A A;  2JGV A;  4S1I A;  2JG5 A;  3RU2 A;  5BYD A;  3NL3 A;  3NM1 A;  3FHX A;  3B1P A;  3MBH A;  3NL6 A;  4K8C A;  1V1S A;  3NL2 A;  1V1B A;  4EUM A;  2PKF A;  2C49 A;  3PZS A;  4GM6 A;  3RM5 A;  3MBJ A;  1LIJ A;  2AX3 A;  3H74 A;  3RTB A;  4EN4 A;  3RT9 A;  3NM3 A;  3GO6 A;  4S1H A;  3KZH A;  3IBQ A;  3RT7 A;  2PKM A;  3UMP A;  3UQE A;  1YGK A;  4KAH A;  4WJM A;  3KEU A;  2JG1 A; 
#chains in the Genus database with same CATH topology
 2JFG A;  4XF7 A;  3RTA A;  5C3Y A;  3UBO A;  3RTG A;  3NL5 A;  3LKI A;  1C3Q A;  1TYY A;  2F02 A;  1JBW A;  1YGJ A;  1YHJ A;  3RSG A;  3BF5 A;  2V78 A;  2XTB A;  4LBG A;  3RRJ A;  1GC5 A;  1V19 A;  1UAG A;  4KAN A;  3W4S A;  5F0Z A;  2F00 A;  1W78 A;  5C41 A;  3H49 A;  2AFB A;  3IN1 A;  3I3Y A;  3RRF A;  3NBW A;  1TZ6 A;  4XDA A;  3RRB A;  1GQQ A;  1P31 A;  1RKD A;  4B8S A;  1UB0 A;  4K8P A;  1TD2 A;  3LHX A;  3IKH A;  4JKU A;  5EYN A;  3B1Q A;  3HYO A;  3FHY A;  4XF6 A;  3N1C A;  5F11 A;  3RSF A;  1EEH A;  2YXU A;  2AJP A;  3K9E A;  1JXH A;  3KD6 A;  2Y66 A;  1RFT A;  3RQX A;  1LHP A;  3K5W A;  5BYF A;  5BYE A;  1V1A A;  2HLZ A;  3IH0 A;  2AM1 A;  4ZIY A;  5BYC A;  4E69 A;  3RPH A;  2Y68 A;  2Y67 A;  5CM5 A;  1UA4 A;  3NBV A;  3OTX A;  3PL2 A;  3RQ5 A;  1JBV A;  3B3L A;  3RQ6 A;  5A5F A;  2RBC A;  3HPD A;  2I5B A;  5CGE A;  1EKK A;  1LHR A;  1J6U A;  3EAG A;  3RQQ A;  1RKA A;  3VAQ A;  4BUC A;  4LCA A;  2DDM A;  4CVL A;  1VK4 A;  4E3A A;  1E8C A;  2NWH A;  2VOS A;  4X8F A;  2X5O A;  4C5N A;  3RQ8 A;  5C40 A;  3Q92 A;  4N09 A;  3UQ9 A;  4JKS A;  3UQ6 A;  3RTD A;  3GBU A;  1E0D A;  2HW1 A;  4LC4 A;  4S1M A;  4DC3 A;  3DRW A;  2WJP A;  1WYE A;  4JJP A;  3DZV A;  1GG4 A;  2DDO A;  1L2L A;  3HIC A;  3LK7 A;  3QAI A;  3LOO A;  4K93 A;  4XCK A;  1U2X A;  5TQI A;  1ESJ A;  4UAG A;  3LJS A;  3IQ0 A;  2GC5 A;  2Y1O A;  2VTE A;  1LIK A;  5A5E A;  2AWD A;  3B1R A;  4O1G A;  2FV7 A;  2I6B A;  1BX4 A;  1VM7 A;  2A9Y A;  2A9Z A;  2DDW A;  2I6A A;  2PKN A;  3NRS A;  2JFF A;  4C5M A;  4C13 A;  4E8Y A;  4E84 A;  1RKS A;  2YXT A;  1O5Z A;  4K8K A;  2QHP A;  3UMO A;  4CVK A;  3ZS7 A;  3JUL A;  2DCN A;  3BGK A;  3KTN A;  2VTD A;  4YWR A;  2UAG A;  1LIO A;  4PVV A;  3ZM6 A;  3NC2 A;  5EY7 A;  3RS8 A;  1GQT A;  4E8W A;  1EKQ A;  4C5J A;  1LII A;  3B1N A;  4K8T A;  2XPC A;  2F7K A;  2AJR A;  5COJ A;  2AM2 A;  4C5K A;  4S1I B;  4B8R A;  4UBE A;  2UUO A;  2Q5R A;  4YL5 A;  3RY7 A;  4QDI A;  1RFV A;  3RPZ A;  4C12 A;  4HV4 A;  2ABQ A;  3RTC A;  3QCZ A;  4N08 A;  1KYH A;  1TZ3 A;  2AA0 A;  3IE7 A;  4C5L A;  2ABS A;  5C3Z A;  3RO4 A;  2GC6 A;  3Q1Y A;  1W7K A;  3GO7 A;  4KAD A;  3EWM A;  3RQ2 A;  2GCA A;  2VOR A;  3QA2 A;  3RQH A;  2HQQ A;  4LBX A;  4KBE A;  3RSQ A;  4CVM A;  3RSS A;  1ESQ A;  1RK2 A;  2VAR A;  1JXI A;  3PYZ A;  4U7X A;  2R3E A;  3CQD A;  3HJ6 A;  1GQY A;  3NCA A;  4QF5 A;  5TRW A;  1RFU A;  4K9I A;  1VI9 A;  2AB8 A;  2JFH A;  4KAL A;  1P3D A;  3B1O A;  3RS9 A;  4EBU A;  3NC9 A;  3UQD A;  2WTZ A;  3RTE A;  2PKK A;  3VAS A;  1DGM A;  2QCV A;  5CGA A;  4O1L A;  4EOH A;  2UUP A;  2C4E A;  3RU3 A;  4DU5 A;  2R3B A;  4K9C A;  5B6A A;  2JGV A;  4S1I A;  2JG5 A;  3RU2 A;  5BYD A;  3NL3 A;  3NM1 A;  3FHX A;  3B1P A;  3MBH A;  3NL6 A;  4K8C A;  2GCB A;  2XJA A;  3ZM5 A;  1V1S A;  3NL2 A;  1V1B A;  3N2A A;  4EUM A;  2PKF A;  2C49 A;  1FGS A;  3PZS A;  4GM6 A;  3RM5 A;  3ZL8 A;  4E8Z A;  3MBJ A;  1LIJ A;  2AX3 A;  3H74 A;  3RTB A;  4EN4 A;  3RT9 A;  3NM3 A;  3GO6 A;  4S1H A;  3KZH A;  3IBQ A;  3RT7 A;  2PKM A;  3UMP A;  3UQE A;  4BUB A;  1YGK A;  4KAH A;  3HN7 A;  4WJM A;  3RRE A;  3KEU A;  2JG1 A;  3UAG A; 
#chains in the Genus database with same CATH homology
 4XF7 A;  3RTA A;  5C3Y A;  3UBO A;  3RTG A;  3NL5 A;  3LKI A;  1C3Q A;  1TYY A;  2F02 A;  1YGJ A;  1YHJ A;  3RSG A;  3BF5 A;  2V78 A;  2XTB A;  4LBG A;  3RRJ A;  1GC5 A;  1V19 A;  4KAN A;  5F0Z A;  3W4S A;  5C41 A;  3H49 A;  2AFB A;  3IN1 A;  3I3Y A;  3RRF A;  3NBW A;  1TZ6 A;  4XDA A;  3RRB A;  1RKD A;  4B8S A;  1UB0 A;  4K8P A;  1TD2 A;  3LHX A;  3IKH A;  4JKU A;  5EYN A;  3B1Q A;  3HYO A;  3FHY A;  4XF6 A;  3N1C A;  5F11 A;  3RSF A;  2YXU A;  2AJP A;  3K9E A;  1JXH A;  3KD6 A;  1RFT A;  3RQX A;  1LHP A;  3K5W A;  5BYF A;  5BYE A;  1V1A A;  2HLZ A;  3IH0 A;  5BYC A;  4E69 A;  3RPH A;  5CM5 A;  1UA4 A;  3NBV A;  3OTX A;  3PL2 A;  3RQ5 A;  3B3L A;  3RQ6 A;  2RBC A;  3HPD A;  2I5B A;  5CGE A;  1EKK A;  1LHR A;  4E8Z A;  3RQQ A;  3VAQ A;  1RKA A;  4LCA A;  2DDM A;  4E3A A;  1VK4 A;  2NWH A;  4X8F A;  4C5N A;  3RQ8 A;  5C40 A;  3Q92 A;  4N09 A;  3UQ9 A;  4JKS A;  3UQ6 A;  3RTD A;  3GBU A;  2HW1 A;  4LC4 A;  4S1M A;  4DC3 A;  3DRW A;  1WYE A;  4JJP A;  3DZV A;  2DDO A;  3QAI A;  1L2L A;  3HIC A;  4K93 A;  4XCK A;  3LOO A;  1U2X A;  5TQI A;  1ESJ A;  3LJS A;  3IQ0 A;  1LIK A;  2AWD A;  3B1R A;  4O1G A;  2I6B A;  2FV7 A;  1BX4 A;  2PKN A;  1VM7 A;  2A9Y A;  2A9Z A;  2DDW A;  2I6A A;  3RRE A;  4C5M A;  4E8Y A;  4E84 A;  1RKS A;  2YXT A;  4K8K A;  2QHP A;  3UMO A;  3ZS7 A;  3JUL A;  2DCN A;  3BGK A;  3KTN A;  4YWR A;  1LIO A;  4PVV A;  3NC2 A;  5EY7 A;  3RS8 A;  1GQT A;  4E8W A;  1EKQ A;  4C5J A;  1LII A;  3B1N A;  4K8T A;  2F7K A;  2AJR A;  5COJ A;  4C5K A;  4S1I B;  4B8R A;  4UBE A;  2Q5R A;  4YL5 A;  3RY7 A;  1RFV A;  3RPZ A;  2ABQ A;  3RTC A;  4N08 A;  1KYH A;  1TZ3 A;  2AA0 A;  3IE7 A;  4C5L A;  2ABS A;  5C3Z A;  3RO4 A;  3Q1Y A;  4KAD A;  3RQ2 A;  3GO7 A;  3RQH A;  3EWM A;  4EBU A;  3QA2 A;  2HQQ A;  4LBX A;  4KBE A;  3RSQ A;  3RSS A;  1ESQ A;  1RK2 A;  2VAR A;  1JXI A;  4U7X A;  2R3E A;  3CQD A;  3HJ6 A;  5TRW A;  3NCA A;  1RFU A;  4K9I A;  1VI9 A;  2AB8 A;  4KAL A;  3RS9 A;  3B1O A;  3NC9 A;  3UQD A;  3RTE A;  3VAS A;  2PKK A;  1DGM A;  2QCV A;  5CGA A;  4O1L A;  4EOH A;  2C4E A;  3RU3 A;  4DU5 A;  2R3B A;  4K9C A;  5B6A A;  2JGV A;  4S1I A;  2JG5 A;  3RU2 A;  5BYD A;  3NL3 A;  3NM1 A;  3FHX A;  3B1P A;  3MBH A;  3NL6 A;  4K8C A;  1V1S A;  3NL2 A;  1V1B A;  4EUM A;  2PKF A;  2C49 A;  3PZS A;  4GM6 A;  3RM5 A;  3MBJ A;  1LIJ A;  2AX3 A;  3H74 A;  3RTB A;  4EN4 A;  3RT9 A;  3NM3 A;  3GO6 A;  4S1H A;  3KZH A;  3IBQ A;  3RT7 A;  2PKM A;  3UMP A;  3UQE A;  1YGK A;  4KAH A;  4WJM A;  3KEU A;  2JG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...