3B1RA

Structure of burkholderia thailandensis nucleoside kinase (bthnk) in complex with amp-mg-amp
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
310
structure length
310
Chain Sequence
ATLICGSIAYDNIMTFEGRFREHILPDQVHLINLSFLVPTMRREFGGCAGNIAYALNLLGGDARMMGTLGAVDAQPYLDRMDALGLSREYVRVLPDTYSAQAMITTDLDNNQITAFHPGAMMQSHVNHAGEAKDIKLAIVGPDGFQGMVQHTEELAQAGVPFIFDPGQGLPLFDGATLRRSIELATYIAVNDYEAKLVCDKTGWSEDEIASRVQALIITRGEHGATIRHRDGTEQIPAVRAERVIDPTGCGDAFRGGLLYGIEHGFDWATAGRLASLMGALKIAHQGPQTYAPTRAEIDARFETAFGYRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Burkholderia thailandensis nucleoside kinase: implications for the catalytic mechanism and nucleoside selectivity
pubmed doi rcsb
source organism Burkholderia thailandensis
molecule tags Transferase
molecule keywords Ribokinase, putative
total genus 105
structure length 310
sequence length 310
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.143: Diphosphate-purine nucleoside kinase.
pdb deposition date 2011-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3b1rA00
1ESJA 2NWHA 4S1IA 2YXUA 3B1NA 3UQ6A 5F11A 1RKSA 4LBXA 3RSSA 2DDMA 3LJSA 3K9EA 3RTEA 3B1PA 3RQ5A 1LHPA 3DRWA 1TZ6A 2QHPA 3RS8A 4B8RA 4E8YA 5BYFA 4EBUA 3GO6A 3UBOA 4E84A 2C49A 2A9YA 1LIIA 3CQDA 2AWDA 4EN4A 2JG1A 3RRBA 1C3QA 3RS9A 3RQ8A 3IH0A 2AJRA 3B1RA 4YWRA 2R3EA 5C40A 5C41A 1LHRA 4C5LA 3RY7A 1V1SA 2RBCA 3RTBA 1VM7A 3NCAA 3UQEA 1YHJA 4E8WA 3UQDA 4B8SA 5B6AA 1RKDA 1TYYA 2AB8A 3NBVA 3RSFA 3W4SA 3RO4A 2HLZA 5COJA 1TD2A 4K8KA 1JXIA 2I6AA 4U7XA 4KAHA 3RT7A 2HW1A 3GO7A 4JJPA 3KEUA 3ZS7A 3HPDA 4XCKA 4C5MA 5F0ZA 4K8PA 4KBEA 3QA2A 4WJMA 4XF7A 3RREA 5CGAA 1EKQA 4EUMA 3IE7A 4KALA 3K5WA 2AJPA 5EYNA 2AFBA 1L2LA 3VAQA 3FHYA 1VI9A 3RQXA 5TRWA 1U2XA 1YGJA 5BYDA 4JKSA 2DDWA 3RTGA 2JGVA 3B1OA 2I6BA 3B1QA 3IKHA 3NL6A 4K9IA 3RQ6A 1JXHA 4X8FA 4XF6A 4K93A 4JKUA 3Q92A 4LBGA 3I3YA 2R3BA 3NL3A 2JG5A 3NM1A 2PKFA 3BGKA 3UQ9A 3OTXA 4N09A 3RQ2A 3H49A 2F02A 3KD6A 2AX3A 1V1AA 3GBUA 2ABSA 3PZSA 3RRJA 1ESQA 4DC3A 2YXTA 3RRFA 3NBWA 1UB0A 3KTNA 3LKIA 1V1BA 4C5JA 3LOOA 5C3YA 3DZVA 1LIJA 2HQQA 2V78A 4EOHA 2ABQA 3RU2A 4YL5A 3RT9A 1DGMA 4C5NA 3VASA 3IN1A 4O1LA 4O1GA 4E3AA 4LC4A 1KYHA 5EY7A 1WYEA 3EWMA 3IBQA 2FV7A 3RTAA 3HICA 3BF5A 4UBEA 4N08A 1RFUA 5BYCA 3H74A 3NL2A 3KZHA 4S1HA 1RKAA 2QCVA 2F7KA 2PKKA 2XTBA 3UMOA 3FHXA 3IQ0A 1RFVA 1EKKA 2DDOA 3RPHA 4E69A 1RFTA 3MBJA 1V19A 3NL5A 4PVVA 2PKNA 4C5KA 3NC2A 3RSGA 3Q1YA 4K9CA 1YGKA 1LIOA 1BX4A 1UA4A 2Q5RA 3RU3A 3N1CA 3MBHA 3LHXA 2A9ZA 5TQIA 3RPZA 3NC9A 3UMPA 3QAIA 5C3ZA 4K8TA 1GC5A 2VARA 5CGEA 4KADA 4DU5A 1VK4A 5CM5A 4GM6A 4S1MA 2AA0A 3RTDA 2C4EA 2DCNA 1LIKA 3B3LA 4K8CA 3JULA 4LCAA 1RK2A 3RSQA 3RTCA 3PL2A 4S1IB 5BYEA 2PKMA 2I5BA 3NM3A 3RQHA 3HYOA 4E8ZA 3RM5A 3RQQA 4KANA 1GQTA 1TZ3A 4XDAA
chains in the Genus database with same CATH superfamily
1ESJA 2NWHA 4S1IA 2YXUA 3B1NA 3UQ6A 1P31A 5F11A 1RKSA 4LBXA 3RSSA 2DDMA 2AM1A 3LJSA 3K9EA 3LK7A 3RTEA 3ZM6A 3B1PA 3RQ5A 5C3ZA 1LHPA 2XPCA 3DRWA 1TZ6A 2QHPA 3PYZA 3RS8A 4B8RA 4E8YA 5BYFA 4EBUA 2AM2A 3GO6A 3UBOA 4E84A 2C49A 2A9YA 1LIIA 3CQDA 2AWDA 4EN4A 2JG1A 3RRBA 1C3QA 3RS9A 2Y67A 2Y68A 2X5OA 3IH0A 3RQ8A 2AJRA 3B1RA 4YWRA 2R3EA 5C40A 5C41A 1LHRA 2GCBA 4C5LA 3RY7A 1W78A 1V1SA 2RBCA 2UAGA 1VM7A 3RTBA 4HV4A 3NCAA 3UQEA 1YHJA 4E8WA 3UQDA 4B8SA 2JFFA 5B6AA 1RKDA 1TYYA 1JBWA 2AB8A 3NBVA 3UAGA 3RSFA 1JBVA 3W4SA 3RO4A 2HLZA 5COJA 1TD2A 4K8KA 1JXIA 2I6AA 4U7XA 4KAHA 3RT7A 2HW1A 2VTDA 3GO7A 4JJPA 3KEUA 3ZS7A 3HPDA 4XCKA 3QCZA 4C5MA 5F0ZA 4K8PA 4KBEA 3QA2A 4WJMA 4XF7A 3RREA 5CGAA 1EKQA 4EUMA 3IE7A 4KALA 3K5WA 2AJPA 2JFHA 5EYNA 2AFBA 1L2LA 3VAQA 3RU3A 3FHYA 1VI9A 3RQXA 5TRWA 1U2XA 1YGJA 5BYDA 4JKSA 2DDWA 3RTGA 2XJAA 2JGVA 3B1OA 2I6BA 3B1QA 3IKHA 3NL6A 4K9IA 3RQ6A 1JXHA 4X8FA 4XF6A 3HJ6A 4JKUA 3Q92A 4K93A 3ZL8A 4LBGA 3ZM5A 3I3YA 2R3BA 2VTEA 2JG5A 3NL3A 3NM1A 2GC5A 2PKFA 3BGKA 4QDIA 3UQ9A 3OTXA 4N09A 3RQ2A 3H49A 2F02A 3KD6A 2AX3A 1P3DA 1J6UA 1V1AA 2ABSA 3GBUA 3PZSA 4C13A 5TQIA 3RRJA 1ESQA 4DC3A 2YXTA 3NRSA 3RRFA 3NBWA 1UB0A 3KTNA 3LKIA 4BUCA 1V1BA 4C5JA 3LOOA 2JFGA 1E8CA 5C3YA 3DZVA 1LIJA 2HQQA 2F00A 1O5ZA 1UAGA 2V78A 4EOHA 2ABQA 3RU2A 4YL5A 3RT9A 1DGMA 4C12A 4C5NA 5A5FA 3VASA 4UAGA 3IN1A 4O1LA 4O1GA 4E3AA 4LC4A 1KYHA 4CVMA 1GQYA 5EY7A 1WYEA 3EWMA 2UUPA 3IBQA 4BUBA 2FV7A 3RTAA 3HICA 3BF5A 3HN7A 4CVLA 4UBEA 4N08A 1RFUA 3N2AA 5BYCA 1W7KA 3RPZA 3H74A 3NL2A 3KZHA 4S1HA 1RKAA 2QCVA 2F7KA 2PKKA 2XTBA 3UMOA 3FHXA 3IQ0A 1RFVA 1EKKA 2DDOA 3RPHA 4E69A 1RFTA 3MBJA 1V19A 3NL5A 4PVVA 2PKNA 1EEHA 2Y66A 3NC2A 2GC6A 4C5KA 3RSGA 3Q1YA 4ZIYA 4K9CA 1YGKA 1LIOA 1BX4A 1FGSA 1UA4A 2Q5RA 1GQQA 2UUOA 2VOSA 2A9ZA 3LHXA 2WTZA 2VORA 2Y1OA 3MBHA 3N1CA 3NC9A 1E0DA 3QAIA 3UMPA 3EAGA 4K8TA 1GC5A 2VARA 5CGEA 4KADA 4DU5A 1GG4A 1VK4A 4GM6A 5CM5A 4CVKA 4S1MA 2AA0A 3RTDA 2C4EA 2DCNA 1LIKA 3B3LA 4K8CA 3JULA 4LCAA 1RK2A 3RSQA 3RTCA 5A5EA 3PL2A 2WJPA 4S1IB 5BYEA 2PKMA 2I5BA 3NM3A 3RQHA 3HYOA 4QF5A 4E8ZA 3RM5A 3RQQA 2GCAA 4KANA 1GQTA 1TZ3A 4XDAA
chains in the Genus database with same CATH topology
1ESJA 2NWHA 4S1IA 2YXUA 3B1NA 3UQ6A 5F11A 1RKSA 4LBXA 3RSSA 2DDMA 3LJSA 3K9EA 3RTEA 3B1PA 3RQ5A 1LHPA 3DRWA 1TZ6A 2QHPA 3RS8A 4B8RA 4E8YA 5BYFA 4EBUA 3GO6A 3UBOA 4E84A 2C49A 2A9YA 1LIIA 3CQDA 2AWDA 4EN4A 2JG1A 3RRBA 1C3QA 3RS9A 3RQ8A 3IH0A 2AJRA 3B1RA 4YWRA 2R3EA 5C40A 5C41A 1LHRA 4C5LA 3RY7A 1V1SA 2RBCA 3RTBA 1VM7A 3NCAA 3UQEA 1YHJA 4E8WA 3UQDA 4B8SA 5B6AA 1RKDA 1TYYA 2AB8A 3NBVA 3RSFA 3W4SA 3RO4A 2HLZA 5COJA 1TD2A 4K8KA 1JXIA 2I6AA 4U7XA 4KAHA 3RT7A 2HW1A 3GO7A 4JJPA 3KEUA 3ZS7A 3HPDA 4XCKA 4C5MA 5F0ZA 4K8PA 4KBEA 3QA2A 4WJMA 4XF7A 3RREA 5CGAA 1EKQA 4EUMA 3IE7A 4KALA 3K5WA 2AJPA 5EYNA 2AFBA 1L2LA 3VAQA 3FHYA 1VI9A 3RQXA 5TRWA 1U2XA 1YGJA 5BYDA 4JKSA 2DDWA 3RTGA 2JGVA 3B1OA 2I6BA 3B1QA 3IKHA 3NL6A 4K9IA 3RQ6A 1JXHA 4X8FA 4XF6A 3HJ6A 4JKUA 3Q92A 4K93A 4LBGA 3I3YA 2R3BA 3NL3A 2JG5A 3NM1A 2PKFA 3BGKA 3UQ9A 3OTXA 4N09A 3RQ2A 3H49A 2F02A 3KD6A 2AX3A 1V1AA 3GBUA 2ABSA 3PZSA 3RRJA 1ESQA 4DC3A 2YXTA 3RRFA 3NBWA 1UB0A 3KTNA 3LKIA 1V1BA 4C5JA 3LOOA 5C3YA 3DZVA 1LIJA 2HQQA 2V78A 4EOHA 2ABQA 3RU2A 4YL5A 3RT9A 1DGMA 4C5NA 3VASA 3IN1A 4O1LA 4O1GA 4E3AA 4LC4A 1KYHA 5EY7A 1WYEA 3EWMA 3IBQA 2FV7A 3RTAA 3HICA 3BF5A 4UBEA 4N08A 1RFUA 5BYCA 3H74A 3NL2A 3KZHA 4S1HA 1RKAA 2QCVA 2F7KA 2PKKA 2XTBA 3UMOA 3FHXA 3IQ0A 1RFVA 1EKKA 2DDOA 3RPHA 4E69A 1RFTA 3MBJA 1V19A 3NL5A 4PVVA 2PKNA 4C5KA 3NC2A 3RSGA 3Q1YA 4K9CA 1YGKA 1LIOA 1BX4A 1UA4A 2Q5RA 3RU3A 3N1CA 3MBHA 3LHXA 2A9ZA 5TQIA 3RPZA 3NC9A 3UMPA 3QAIA 5C3ZA 4K8TA 1GC5A 2VARA 5CGEA 4KADA 4DU5A 1VK4A 5CM5A 4GM6A 4S1MA 2AA0A 3RTDA 2C4EA 2DCNA 1LIKA 3B3LA 4K8CA 3JULA 4LCAA 1RK2A 3RSQA 3RTCA 3PL2A 4S1IB 5BYEA 2PKMA 2I5BA 3NM3A 3RQHA 3HYOA 4E8ZA 3RM5A 3RQQA 4KANA 1GQTA 1TZ3A 4XDAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ESJ A;  2NWH A;  4S1I A;  2YXU A;  3B1N A;  3UQ6 A;  5F11 A;  1RKS A;  4LBX A;  3RSS A;  2DDM A;  3LJS A;  3K9E A;  3RTE A;  3B1P A;  3RQ5 A;  1LHP A;  3DRW A;  1TZ6 A;  2QHP A;  3RS8 A;  4B8R A;  4E8Y A;  5BYF A;  4EBU A;  3GO6 A;  3UBO A;  4E84 A;  2C49 A;  2A9Y A;  1LII A;  3CQD A;  2AWD A;  4EN4 A;  2JG1 A;  3RRB A;  1C3Q A;  3RS9 A;  3RQ8 A;  3IH0 A;  2AJR A;  3B1R A;  4YWR A;  2R3E A;  5C40 A;  5C41 A;  1LHR A;  4C5L A;  3RY7 A;  1V1S A;  2RBC A;  3RTB A;  1VM7 A;  3NCA A;  3UQE A;  1YHJ A;  4E8W A;  3UQD A;  4B8S A;  5B6A A;  1RKD A;  1TYY A;  2AB8 A;  3NBV A;  3RSF A;  3W4S A;  3RO4 A;  2HLZ A;  5COJ A;  1TD2 A;  4K8K A;  1JXI A;  2I6A A;  4U7X A;  4KAH A;  3RT7 A;  2HW1 A;  3GO7 A;  4JJP A;  3KEU A;  3ZS7 A;  3HPD A;  4XCK A;  4C5M A;  5F0Z A;  4K8P A;  4KBE A;  3QA2 A;  4WJM A;  4XF7 A;  3RRE A;  5CGA A;  1EKQ A;  4EUM A;  3IE7 A;  4KAL A;  3K5W A;  2AJP A;  5EYN A;  2AFB A;  1L2L A;  3VAQ A;  3FHY A;  1VI9 A;  3RQX A;  5TRW A;  1U2X A;  1YGJ A;  5BYD A;  4JKS A;  2DDW A;  3RTG A;  2JGV A;  3B1O A;  2I6B A;  3B1Q A;  3IKH A;  3NL6 A;  4K9I A;  3RQ6 A;  1JXH A;  4X8F A;  4XF6 A;  4K93 A;  4JKU A;  3Q92 A;  4LBG A;  3I3Y A;  2R3B A;  3NL3 A;  2JG5 A;  3NM1 A;  2PKF A;  3BGK A;  3UQ9 A;  3OTX A;  4N09 A;  3RQ2 A;  3H49 A;  2F02 A;  3KD6 A;  2AX3 A;  1V1A A;  3GBU A;  2ABS A;  3PZS A;  3RRJ A;  1ESQ A;  4DC3 A;  2YXT A;  3RRF A;  3NBW A;  1UB0 A;  3KTN A;  3LKI A;  1V1B A;  4C5J A;  3LOO A;  5C3Y A;  3DZV A;  1LIJ A;  2HQQ A;  2V78 A;  4EOH A;  2ABQ A;  3RU2 A;  4YL5 A;  3RT9 A;  1DGM A;  4C5N A;  3VAS A;  3IN1 A;  4O1L A;  4O1G A;  4E3A A;  4LC4 A;  1KYH A;  5EY7 A;  1WYE A;  3EWM A;  3IBQ A;  2FV7 A;  3RTA A;  3HIC A;  3BF5 A;  4UBE A;  4N08 A;  1RFU A;  5BYC A;  3H74 A;  3NL2 A;  3KZH A;  4S1H A;  1RKA A;  2QCV A;  2F7K A;  2PKK A;  2XTB A;  3UMO A;  3FHX A;  3IQ0 A;  1RFV A;  1EKK A;  2DDO A;  3RPH A;  4E69 A;  1RFT A;  3MBJ A;  1V19 A;  3NL5 A;  4PVV A;  2PKN A;  4C5K A;  3NC2 A;  3RSG A;  3Q1Y A;  4K9C A;  1YGK A;  1LIO A;  1BX4 A;  1UA4 A;  2Q5R A;  3RU3 A;  3N1C A;  3MBH A;  3LHX A;  2A9Z A;  5TQI A;  3RPZ A;  3NC9 A;  3UMP A;  3QAI A;  5C3Z A;  4K8T A;  1GC5 A;  2VAR A;  5CGE A;  4KAD A;  4DU5 A;  1VK4 A;  5CM5 A;  4GM6 A;  4S1M A;  2AA0 A;  3RTD A;  2C4E A;  2DCN A;  1LIK A;  3B3L A;  4K8C A;  3JUL A;  4LCA A;  1RK2 A;  3RSQ A;  3RTC A;  3PL2 A;  4S1I B;  5BYE A;  2PKM A;  2I5B A;  3NM3 A;  3RQH A;  3HYO A;  4E8Z A;  3RM5 A;  3RQQ A;  4KAN A;  1GQT A;  1TZ3 A;  4XDA A; 
#chains in the Genus database with same CATH topology
 1ESJ A;  2NWH A;  4S1I A;  2YXU A;  3B1N A;  3UQ6 A;  1P31 A;  5F11 A;  1RKS A;  4LBX A;  3RSS A;  2DDM A;  2AM1 A;  3LJS A;  3K9E A;  3LK7 A;  3RTE A;  3ZM6 A;  3B1P A;  3RQ5 A;  5C3Z A;  1LHP A;  2XPC A;  3DRW A;  1TZ6 A;  2QHP A;  3PYZ A;  3RS8 A;  4B8R A;  4E8Y A;  5BYF A;  4EBU A;  2AM2 A;  3GO6 A;  3UBO A;  4E84 A;  2C49 A;  2A9Y A;  1LII A;  3CQD A;  2AWD A;  4EN4 A;  2JG1 A;  3RRB A;  1C3Q A;  3RS9 A;  2Y67 A;  2Y68 A;  2X5O A;  3IH0 A;  3RQ8 A;  2AJR A;  3B1R A;  4YWR A;  2R3E A;  5C40 A;  5C41 A;  1LHR A;  2GCB A;  4C5L A;  3RY7 A;  1W78 A;  1V1S A;  2RBC A;  2UAG A;  1VM7 A;  3RTB A;  4HV4 A;  3NCA A;  3UQE A;  1YHJ A;  4E8W A;  3UQD A;  4B8S A;  2JFF A;  5B6A A;  1RKD A;  1TYY A;  1JBW A;  2AB8 A;  3NBV A;  3UAG A;  3RSF A;  1JBV A;  3W4S A;  3RO4 A;  2HLZ A;  5COJ A;  1TD2 A;  4K8K A;  1JXI A;  2I6A A;  4U7X A;  4KAH A;  3RT7 A;  2HW1 A;  2VTD A;  3GO7 A;  4JJP A;  3KEU A;  3ZS7 A;  3HPD A;  4XCK A;  3QCZ A;  4C5M A;  5F0Z A;  4K8P A;  4KBE A;  3QA2 A;  4WJM A;  4XF7 A;  3RRE A;  5CGA A;  1EKQ A;  4EUM A;  3IE7 A;  4KAL A;  3K5W A;  2AJP A;  2JFH A;  5EYN A;  2AFB A;  1L2L A;  3VAQ A;  3RU3 A;  3FHY A;  1VI9 A;  3RQX A;  5TRW A;  1U2X A;  1YGJ A;  5BYD A;  4JKS A;  2DDW A;  3RTG A;  2XJA A;  2JGV A;  3B1O A;  2I6B A;  3B1Q A;  3IKH A;  3NL6 A;  4K9I A;  3RQ6 A;  1JXH A;  4X8F A;  4XF6 A;  3HJ6 A;  4JKU A;  3Q92 A;  4K93 A;  3ZL8 A;  4LBG A;  3ZM5 A;  3I3Y A;  2R3B A;  2VTE A;  2JG5 A;  3NL3 A;  3NM1 A;  2GC5 A;  2PKF A;  3BGK A;  4QDI A;  3UQ9 A;  3OTX A;  4N09 A;  3RQ2 A;  3H49 A;  2F02 A;  3KD6 A;  2AX3 A;  1P3D A;  1J6U A;  1V1A A;  2ABS A;  3GBU A;  3PZS A;  4C13 A;  5TQI A;  3RRJ A;  1ESQ A;  4DC3 A;  2YXT A;  3NRS A;  3RRF A;  3NBW A;  1UB0 A;  3KTN A;  3LKI A;  4BUC A;  1V1B A;  4C5J A;  3LOO A;  2JFG A;  1E8C A;  5C3Y A;  3DZV A;  1LIJ A;  2HQQ A;  2F00 A;  1O5Z A;  1UAG A;  2V78 A;  4EOH A;  2ABQ A;  3RU2 A;  4YL5 A;  3RT9 A;  1DGM A;  4C12 A;  4C5N A;  5A5F A;  3VAS A;  4UAG A;  3IN1 A;  4O1L A;  4O1G A;  4E3A A;  4LC4 A;  1KYH A;  4CVM A;  1GQY A;  5EY7 A;  1WYE A;  3EWM A;  2UUP A;  3IBQ A;  4BUB A;  2FV7 A;  3RTA A;  3HIC A;  3BF5 A;  3HN7 A;  4CVL A;  4UBE A;  4N08 A;  1RFU A;  3N2A A;  5BYC A;  1W7K A;  3RPZ A;  3H74 A;  3NL2 A;  3KZH A;  4S1H A;  1RKA A;  2QCV A;  2F7K A;  2PKK A;  2XTB A;  3UMO A;  3FHX A;  3IQ0 A;  1RFV A;  1EKK A;  2DDO A;  3RPH A;  4E69 A;  1RFT A;  3MBJ A;  1V19 A;  3NL5 A;  4PVV A;  2PKN A;  1EEH A;  2Y66 A;  3NC2 A;  2GC6 A;  4C5K A;  3RSG A;  3Q1Y A;  4ZIY A;  4K9C A;  1YGK A;  1LIO A;  1BX4 A;  1FGS A;  1UA4 A;  2Q5R A;  1GQQ A;  2UUO A;  2VOS A;  2A9Z A;  3LHX A;  2WTZ A;  2VOR A;  2Y1O A;  3MBH A;  3N1C A;  3NC9 A;  1E0D A;  3QAI A;  3UMP A;  3EAG A;  4K8T A;  1GC5 A;  2VAR A;  5CGE A;  4KAD A;  4DU5 A;  1GG4 A;  1VK4 A;  4GM6 A;  5CM5 A;  4CVK A;  4S1M A;  2AA0 A;  3RTD A;  2C4E A;  2DCN A;  1LIK A;  3B3L A;  4K8C A;  3JUL A;  4LCA A;  1RK2 A;  3RSQ A;  3RTC A;  5A5E A;  3PL2 A;  2WJP A;  4S1I B;  5BYE A;  2PKM A;  2I5B A;  3NM3 A;  3RQH A;  3HYO A;  4QF5 A;  4E8Z A;  3RM5 A;  3RQQ A;  2GCA A;  4KAN A;  1GQT A;  1TZ3 A;  4XDA A; 
#chains in the Genus database with same CATH homology
 1ESJ A;  2NWH A;  4S1I A;  2YXU A;  3B1N A;  3UQ6 A;  5F11 A;  1RKS A;  4LBX A;  3RSS A;  2DDM A;  3LJS A;  3K9E A;  3RTE A;  3B1P A;  3RQ5 A;  1LHP A;  3DRW A;  1TZ6 A;  2QHP A;  3RS8 A;  4B8R A;  4E8Y A;  5BYF A;  4EBU A;  3GO6 A;  3UBO A;  4E84 A;  2C49 A;  2A9Y A;  1LII A;  3CQD A;  2AWD A;  4EN4 A;  2JG1 A;  3RRB A;  1C3Q A;  3RS9 A;  3RQ8 A;  3IH0 A;  2AJR A;  3B1R A;  4YWR A;  2R3E A;  5C40 A;  5C41 A;  1LHR A;  4C5L A;  3RY7 A;  1V1S A;  2RBC A;  3RTB A;  1VM7 A;  3NCA A;  3UQE A;  1YHJ A;  4E8W A;  3UQD A;  4B8S A;  5B6A A;  1RKD A;  1TYY A;  2AB8 A;  3NBV A;  3RSF A;  3W4S A;  3RO4 A;  2HLZ A;  5COJ A;  1TD2 A;  4K8K A;  1JXI A;  2I6A A;  4U7X A;  4KAH A;  3RT7 A;  2HW1 A;  3GO7 A;  4JJP A;  3KEU A;  3ZS7 A;  3HPD A;  4XCK A;  4C5M A;  5F0Z A;  4K8P A;  4KBE A;  3QA2 A;  4WJM A;  4XF7 A;  3RRE A;  5CGA A;  1EKQ A;  4EUM A;  3IE7 A;  4KAL A;  3K5W A;  2AJP A;  5EYN A;  2AFB A;  1L2L A;  3VAQ A;  3FHY A;  1VI9 A;  3RQX A;  5TRW A;  1U2X A;  1YGJ A;  5BYD A;  4JKS A;  2DDW A;  3RTG A;  2JGV A;  3B1O A;  2I6B A;  3B1Q A;  3IKH A;  3NL6 A;  4K9I A;  3RQ6 A;  1JXH A;  4X8F A;  4XF6 A;  3HJ6 A;  4JKU A;  3Q92 A;  4K93 A;  4LBG A;  3I3Y A;  2R3B A;  3NL3 A;  2JG5 A;  3NM1 A;  2PKF A;  3BGK A;  3UQ9 A;  3OTX A;  4N09 A;  3RQ2 A;  3H49 A;  2F02 A;  3KD6 A;  2AX3 A;  1V1A A;  3GBU A;  2ABS A;  3PZS A;  3RRJ A;  1ESQ A;  4DC3 A;  2YXT A;  3RRF A;  3NBW A;  1UB0 A;  3KTN A;  3LKI A;  1V1B A;  4C5J A;  3LOO A;  5C3Y A;  3DZV A;  1LIJ A;  2HQQ A;  2V78 A;  4EOH A;  2ABQ A;  3RU2 A;  4YL5 A;  3RT9 A;  1DGM A;  4C5N A;  3VAS A;  3IN1 A;  4O1L A;  4O1G A;  4E3A A;  4LC4 A;  1KYH A;  5EY7 A;  1WYE A;  3EWM A;  3IBQ A;  2FV7 A;  3RTA A;  3HIC A;  3BF5 A;  4UBE A;  4N08 A;  1RFU A;  5BYC A;  3H74 A;  3NL2 A;  3KZH A;  4S1H A;  1RKA A;  2QCV A;  2F7K A;  2PKK A;  2XTB A;  3UMO A;  3FHX A;  3IQ0 A;  1RFV A;  1EKK A;  2DDO A;  3RPH A;  4E69 A;  1RFT A;  3MBJ A;  1V19 A;  3NL5 A;  4PVV A;  2PKN A;  4C5K A;  3NC2 A;  3RSG A;  3Q1Y A;  4K9C A;  1YGK A;  1LIO A;  1BX4 A;  1UA4 A;  2Q5R A;  3RU3 A;  3N1C A;  3MBH A;  3LHX A;  2A9Z A;  5TQI A;  3RPZ A;  3NC9 A;  3UMP A;  3QAI A;  5C3Z A;  4K8T A;  1GC5 A;  2VAR A;  5CGE A;  4KAD A;  4DU5 A;  1VK4 A;  5CM5 A;  4GM6 A;  4S1M A;  2AA0 A;  3RTD A;  2C4E A;  2DCN A;  1LIK A;  3B3L A;  4K8C A;  3JUL A;  4LCA A;  1RK2 A;  3RSQ A;  3RTC A;  3PL2 A;  4S1I B;  5BYE A;  2PKM A;  2I5B A;  3NM3 A;  3RQH A;  3HYO A;  4E8Z A;  3RM5 A;  3RQQ A;  4KAN A;  1GQT A;  1TZ3 A;  4XDA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...