3B1RA

Structure of burkholderia thailandensis nucleoside kinase (bthnk) in complex with amp-mg-amp
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
310
structure length
310
Chain Sequence
ATLICGSIAYDNIMTFEGRFREHILPDQVHLINLSFLVPTMRREFGGCAGNIAYALNLLGGDARMMGTLGAVDAQPYLDRMDALGLSREYVRVLPDTYSAQAMITTDLDNNQITAFHPGAMMQSHVNHAGEAKDIKLAIVGPDGFQGMVQHTEELAQAGVPFIFDPGQGLPLFDGATLRRSIELATYIAVNDYEAKLVCDKTGWSEDEIASRVQALIITRGEHGATIRHRDGTEQIPAVRAERVIDPTGCGDAFRGGLLYGIEHGFDWATAGRLASLMGALKIAHQGPQTYAPTRAEIDARFETAFGYRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Burkholderia thailandensis nucleoside kinase: implications for the catalytic mechanism and nucleoside selectivity
pubmed doi rcsb
source organism Burkholderia thailandensis
molecule tags Transferase
molecule keywords Ribokinase, putative
total genus 105
structure length 310
sequence length 310
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.143: Diphosphate-purine nucleoside kinase.
pdb deposition date 2011-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3b1rA00
3H74A 3LJSA 3RS8A 3IH0A 3RTEA 3QA2A 2AB8A 5TQIA 1ESJA 3GBUA 3MBJA 3Q92A 2ABQA 5EYNA 3RM5A 2F02A 2JG5A 4KAHA 3FHYA 4KANA 4XF7A 4JKUA 3RPZA 1DGMA 5TRWA 1UB0A 4LBXA 3B1PA 3RREA 1GC5A 1YHJA 3RQ5A 1LIOA 1V1BA 1V19A 4JKSA 4O1GA 1TZ3A 3RQ8A 3RS9A 3RQ6A 5CGAA 3PZSA 2I6BA 4WJMA 3NBWA 3KZHA 4KALA 4LCAA 3EWMA 3UQ6A 4K9CA 4EN4A 5BYDA 5C40A 1TD2A 1RFVA 3K9EA 2HLZA 4K8KA 4C5KA 4B8RA 1RKAA 4U7XA 2DCNA 3HYOA 2AJRA 3RQHA 1VM7A 5B6AA 4B8SA 2AA0A 3KTNA 2A9ZA 3CQDA 2ABSA 4N09A 5BYEA 3JULA 5CGEA 1EKKA 3NL3A 5CM5A 4O1LA 3VASA 1LHPA 4YL5A 5C41A 4K8TA 3I3YA 1TZ6A 3HICA 3RRBA 1U2XA 2PKMA 3QAIA 3UQEA 1RKSA 3IBQA 2I6AA 2HW1A 4EBUA 2AFBA 2RBCA 3H49A 4XF6A 4E3AA 3RRFA 2VARA 3RTDA 1KYHA 1LIJA 3RO4A 4E8ZA 3NM1A 1LHRA 2AWDA 3IE7A 4UBEA 1EKQA 3NL5A 5BYCA 4KADA 3NC9A 4K9IA 2DDWA 3OTXA 3RPHA 1ESQA 3RSSA 4E8YA 4DU5A 2YXUA 2AJPA 3DRWA 4K8CA 3W4SA 4EOHA 4PVVA 3B1NA 3BGKA 1YGJA 2JGVA 4LBGA 4E84A 3UBOA 3FHXA 4K93A 3GO7A 1RFTA 3RQ2A 3RQQA 3UMOA 1UA4A 3UMPA 3UQDA 2R3EA 3KEUA 3RSGA 3B3LA 3KD6A 3K5WA 1RK2A 1YGKA 3NCAA 4S1MA 3RQXA 1RKDA 4N08A 1BX4A 2Q5RA 5F0ZA 2V78A 1WYEA 4LC4A 3RSQA 3B1QA 2F7KA 3NL6A 4K8PA 2DDOA 1JXHA 4C5MA 4S1IA 4JJPA 4E69A 1V1SA 5F11A 3RTCA 4E8WA 3VAQA 4EUMA 4KBEA 2HQQA 3Q1YA 3RSFA 3ZS7A 3RTAA 2JG1A 2QHPA 3NBVA 4YWRA 2I5BA 5COJA 3RTGA 4C5LA 1C3QA 3LKIA 4GM6A 2QCVA 1TYYA 3UQ9A 1RFUA 3BF5A 3GO6A 3NC2A 3LHXA 4C5NA 3MBHA 4XCKA 1L2LA 2NWHA 3RY7A 4DC3A 5C3ZA 3RT9A 3B1RA 1VK4A 3RTBA 2A9YA 1VI9A 3RT7A 4S1IB 3RU3A 1GQTA 2FV7A 2AX3A 2PKFA 3RRJA 1JXIA 2PKKA 3PL2A 3NM3A 1V1AA 4XDAA 3HPDA 5BYFA 3B1OA 2R3BA 5EY7A 3NL2A 4X8FA 2XTBA 2YXTA 1LIKA 2PKNA 3N1CA 3IKHA 3LOOA 3RU2A 3IN1A 2C4EA 2DDMA 5C3YA 4S1HA 1LIIA 4C5JA 2C49A 3IQ0A 3DZVA
chains in the Genus database with same CATH superfamily
3H74A 3LJSA 3RS8A 3IH0A 3RTEA 2VOSA 3QA2A 2AB8A 5TQIA 3HN7A 1GG4A 4CVKA 3PYZA 1ESJA 3GBUA 3MBJA 3Q92A 2ABQA 5EYNA 4ZIYA 2F02A 2JG5A 3RM5A 2Y68A 4KAHA 3FHYA 4KANA 4XF7A 3ZM6A 2VTDA 4JKUA 3RPZA 1J6UA 1DGMA 5TRWA 1UB0A 4LBXA 3B1PA 3NRSA 3RREA 1GC5A 1YHJA 3RQ5A 1LIOA 1V1BA 1V19A 4JKSA 4O1GA 1TZ3A 1FGSA 1W78A 3RQ8A 3RS9A 2JFGA 3RQ6A 3PZSA 2I6BA 1JBWA 1GQYA 2F00A 4WJMA 3NBWA 4CVMA 3KZHA 2GC6A 4KALA 3EWMA 4LCAA 4K9CA 4EN4A 5BYDA 5C40A 1TD2A 1RFVA 3K9EA 2HLZA 4K8KA 4C5KA 2GC5A 4B8RA 1RKAA 4U7XA 2DCNA 3HYOA 2AJRA 3RQHA 3UAGA 3UQ6A 2Y1OA 2Y66A 1VM7A 3HJ6A 5B6AA 4B8SA 1O5ZA 2AA0A 3KTNA 1EEHA 2A9ZA 2ABSA 3CQDA 4N09A 3ZL8A 3JULA 4BUCA 5BYEA 2WJPA 1EKKA 3NL3A 5CGEA 5CM5A 1P3DA 4O1LA 4HV4A 3VASA 1LHPA 4YL5A 5C41A 4K8TA 3I3YA 4QF5A 1TZ6A 3HICA 3RRBA 1U2XA 2PKMA 3QAIA 3QCZA 3UQEA 1RKSA 3IBQA 2I6AA 2HW1A 4EBUA 2AFBA 2RBCA 2XPCA 3H49A 4XF6A 3RRFA 4E3AA 2VARA 2WTZA 3RTDA 1KYHA 1LIJA 3RO4A 4E8ZA 3NM1A 1LHRA 2AWDA 3IE7A 4UBEA 1EKQA 3NL5A 5BYCA 4KADA 3NC9A 5A5EA 4K9IA 2DDWA 3OTXA 3RPHA 1ESQA 3RSSA 1E8CA 4E8YA 4DU5A 2JFFA 2YXUA 2AJPA 4C13A 2XJAA 3DRWA 4K8CA 3W4SA 4EOHA 4PVVA 3B1NA 3BGKA 2UUPA 2AM1A 1YGJA 2JGVA 4LBGA 1UAGA 4E84A 3UBOA 3FHXA 4K93A 3GO7A 1RFTA 3RQ2A 3RQQA 3UMOA 1UA4A 3UMPA 3UQDA 2R3EA 3KEUA 3RSGA 2Y67A 3B3LA 3K5WA 1RK2A 1YGKA 3KD6A 3NCAA 4S1MA 3RQXA 2GCAA 1RKDA 4N08A 1BX4A 2X5OA 2Q5RA 5F0ZA 2VTEA 2V78A 1WYEA 4LC4A 3RSQA 3B1QA 2F7KA 3NL6A 4K8PA 2DDOA 1JXHA 4C5MA 4S1IA 4JJPA 4E69A 1V1SA 5F11A 3RTCA 4E8WA 1P31A 3ZM5A 3VAQA 1W7KA 4EUMA 4KBEA 2HQQA 3N2AA 2GCBA 2VORA 3Q1YA 3RSFA 3ZS7A 3RTAA 1JBVA 2JG1A 5A5FA 2QHPA 4UAGA 3NBVA 3LK7A 4YWRA 2I5BA 4BUBA 5COJA 3RTGA 4C5LA 1C3QA 3LKIA 4GM6A 2QCVA 1TYYA 3UQ9A 1RFUA 3EAGA 3BF5A 3GO6A 3NC2A 3LHXA 1GQQA 4C5NA 3MBHA 4XCKA 1L2LA 2NWHA 3RY7A 4DC3A 5C3ZA 3RT9A 3B1RA 1VK4A 2UAGA 2UUOA 3RTBA 2A9YA 1VI9A 3RT7A 4S1IB 3RU3A 1GQTA 2FV7A 2AX3A 2PKFA 3RRJA 1JXIA 2PKKA 3PL2A 1E0DA 1V1AA 3NM3A 4XDAA 3HPDA 5BYFA 4C12A 3B1OA 2R3BA 5CGAA 5EY7A 3NL2A 4X8FA 2XTBA 2JFHA 1LIKA 2PKNA 2YXTA 3IKHA 3LOOA 3N1CA 3RU2A 3IN1A 2C4EA 2DDMA 5C3YA 2AM2A 1LIIA 4S1HA 4CVLA 4C5JA 4QDIA 2C49A 3IQ0A 3DZVA
chains in the Genus database with same CATH topology
3H74A 3LJSA 3RS8A 3IH0A 3RTEA 3QA2A 2AB8A 5TQIA 1ESJA 3GBUA 3MBJA 3Q92A 2ABQA 5EYNA 3RM5A 2F02A 2JG5A 4KAHA 3FHYA 4KANA 4XF7A 4JKUA 3RPZA 1DGMA 5TRWA 1UB0A 4LBXA 3B1PA 3RREA 1GC5A 1YHJA 3RQ5A 1LIOA 1V1BA 1V19A 4JKSA 4O1GA 1TZ3A 3RQ8A 3RS9A 3RQ6A 5CGAA 3PZSA 2I6BA 4WJMA 3NBWA 3KZHA 4KALA 4LCAA 3EWMA 3UQ6A 4K9CA 4EN4A 5BYDA 5C40A 1TD2A 1RFVA 3K9EA 2HLZA 4K8KA 4C5KA 4B8RA 1RKAA 4U7XA 2DCNA 3HYOA 2AJRA 3RQHA 1VM7A 3HJ6A 5B6AA 4B8SA 2AA0A 3KTNA 2A9ZA 3CQDA 2ABSA 4N09A 5BYEA 3JULA 5CGEA 1EKKA 3NL3A 5CM5A 4O1LA 3VASA 1LHPA 4YL5A 5C41A 4K8TA 3I3YA 1TZ6A 3HICA 3RRBA 1U2XA 2PKMA 3QAIA 3UQEA 1RKSA 3IBQA 2I6AA 2HW1A 4EBUA 2AFBA 2RBCA 3H49A 4XF6A 4E3AA 3RRFA 2VARA 3RTDA 1KYHA 1LIJA 3RO4A 4E8ZA 3NM1A 1LHRA 2AWDA 3IE7A 4UBEA 1EKQA 3NL5A 5BYCA 4KADA 3NC9A 4K9IA 2DDWA 3OTXA 3RPHA 1ESQA 3RSSA 4E8YA 4DU5A 2YXUA 2AJPA 3DRWA 4K8CA 3W4SA 4EOHA 4PVVA 3B1NA 3BGKA 1YGJA 2JGVA 4LBGA 4E84A 3UBOA 3FHXA 4K93A 3GO7A 1RFTA 3RQ2A 3RQQA 3UMOA 1UA4A 3UMPA 3UQDA 2R3EA 3KEUA 3RSGA 3B3LA 3KD6A 3K5WA 1RK2A 1YGKA 3NCAA 4S1MA 3RQXA 1RKDA 4N08A 1BX4A 2Q5RA 5F0ZA 2V78A 1WYEA 4LC4A 3RSQA 3B1QA 2F7KA 3NL6A 4K8PA 2DDOA 1JXHA 4C5MA 4S1IA 4JJPA 4E69A 1V1SA 5F11A 3RTCA 4E8WA 3VAQA 4EUMA 4KBEA 2HQQA 3Q1YA 3RSFA 3ZS7A 3RTAA 2JG1A 2QHPA 3NBVA 4YWRA 2I5BA 5COJA 3RTGA 4C5LA 1C3QA 3LKIA 4GM6A 2QCVA 1TYYA 3UQ9A 1RFUA 3BF5A 3GO6A 3NC2A 3LHXA 4C5NA 3MBHA 4XCKA 1L2LA 2NWHA 3RY7A 4DC3A 5C3ZA 3RT9A 3B1RA 1VK4A 3RTBA 2A9YA 1VI9A 3RT7A 4S1IB 3RU3A 1GQTA 2FV7A 2AX3A 2PKFA 3RRJA 1JXIA 2PKKA 3PL2A 3NM3A 1V1AA 4XDAA 3HPDA 5BYFA 3B1OA 2R3BA 5EY7A 3NL2A 4X8FA 2XTBA 2YXTA 1LIKA 2PKNA 3N1CA 3IKHA 3LOOA 3RU2A 3IN1A 2C4EA 2DDMA 5C3YA 4S1HA 1LIIA 4C5JA 2C49A 3IQ0A 3DZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H74 A;  3LJS A;  3RS8 A;  3IH0 A;  3RTE A;  3QA2 A;  2AB8 A;  5TQI A;  1ESJ A;  3GBU A;  3MBJ A;  3Q92 A;  2ABQ A;  5EYN A;  3RM5 A;  2F02 A;  2JG5 A;  4KAH A;  3FHY A;  4KAN A;  4XF7 A;  4JKU A;  3RPZ A;  1DGM A;  5TRW A;  1UB0 A;  4LBX A;  3B1P A;  3RRE A;  1GC5 A;  1YHJ A;  3RQ5 A;  1LIO A;  1V1B A;  1V19 A;  4JKS A;  4O1G A;  1TZ3 A;  3RQ8 A;  3RS9 A;  3RQ6 A;  5CGA A;  3PZS A;  2I6B A;  4WJM A;  3NBW A;  3KZH A;  4KAL A;  4LCA A;  3EWM A;  3UQ6 A;  4K9C A;  4EN4 A;  5BYD A;  5C40 A;  1TD2 A;  1RFV A;  3K9E A;  2HLZ A;  4K8K A;  4C5K A;  4B8R A;  1RKA A;  4U7X A;  2DCN A;  3HYO A;  2AJR A;  3RQH A;  1VM7 A;  5B6A A;  4B8S A;  2AA0 A;  3KTN A;  2A9Z A;  3CQD A;  2ABS A;  4N09 A;  5BYE A;  3JUL A;  5CGE A;  1EKK A;  3NL3 A;  5CM5 A;  4O1L A;  3VAS A;  1LHP A;  4YL5 A;  5C41 A;  4K8T A;  3I3Y A;  1TZ6 A;  3HIC A;  3RRB A;  1U2X A;  2PKM A;  3QAI A;  3UQE A;  1RKS A;  3IBQ A;  2I6A A;  2HW1 A;  4EBU A;  2AFB A;  2RBC A;  3H49 A;  4XF6 A;  4E3A A;  3RRF A;  2VAR A;  3RTD A;  1KYH A;  1LIJ A;  3RO4 A;  4E8Z A;  3NM1 A;  1LHR A;  2AWD A;  3IE7 A;  4UBE A;  1EKQ A;  3NL5 A;  5BYC A;  4KAD A;  3NC9 A;  4K9I A;  2DDW A;  3OTX A;  3RPH A;  1ESQ A;  3RSS A;  4E8Y A;  4DU5 A;  2YXU A;  2AJP A;  3DRW A;  4K8C A;  3W4S A;  4EOH A;  4PVV A;  3B1N A;  3BGK A;  1YGJ A;  2JGV A;  4LBG A;  4E84 A;  3UBO A;  3FHX A;  4K93 A;  3GO7 A;  1RFT A;  3RQ2 A;  3RQQ A;  3UMO A;  1UA4 A;  3UMP A;  3UQD A;  2R3E A;  3KEU A;  3RSG A;  3B3L A;  3KD6 A;  3K5W A;  1RK2 A;  1YGK A;  3NCA A;  4S1M A;  3RQX A;  1RKD A;  4N08 A;  1BX4 A;  2Q5R A;  5F0Z A;  2V78 A;  1WYE A;  4LC4 A;  3RSQ A;  3B1Q A;  2F7K A;  3NL6 A;  4K8P A;  2DDO A;  1JXH A;  4C5M A;  4S1I A;  4JJP A;  4E69 A;  1V1S A;  5F11 A;  3RTC A;  4E8W A;  3VAQ A;  4EUM A;  4KBE A;  2HQQ A;  3Q1Y A;  3RSF A;  3ZS7 A;  3RTA A;  2JG1 A;  2QHP A;  3NBV A;  4YWR A;  2I5B A;  5COJ A;  3RTG A;  4C5L A;  1C3Q A;  3LKI A;  4GM6 A;  2QCV A;  1TYY A;  3UQ9 A;  1RFU A;  3BF5 A;  3GO6 A;  3NC2 A;  3LHX A;  4C5N A;  3MBH A;  4XCK A;  1L2L A;  2NWH A;  3RY7 A;  4DC3 A;  5C3Z A;  3RT9 A;  3B1R A;  1VK4 A;  3RTB A;  2A9Y A;  1VI9 A;  3RT7 A;  4S1I B;  3RU3 A;  1GQT A;  2FV7 A;  2AX3 A;  2PKF A;  3RRJ A;  1JXI A;  2PKK A;  3PL2 A;  3NM3 A;  1V1A A;  4XDA A;  3HPD A;  5BYF A;  3B1O A;  2R3B A;  5EY7 A;  3NL2 A;  4X8F A;  2XTB A;  2YXT A;  1LIK A;  2PKN A;  3N1C A;  3IKH A;  3LOO A;  3RU2 A;  3IN1 A;  2C4E A;  2DDM A;  5C3Y A;  4S1H A;  1LII A;  4C5J A;  2C49 A;  3IQ0 A;  3DZV A; 
#chains in the Genus database with same CATH topology
 3H74 A;  3LJS A;  3RS8 A;  3IH0 A;  3RTE A;  2VOS A;  3QA2 A;  2AB8 A;  5TQI A;  3HN7 A;  1GG4 A;  4CVK A;  3PYZ A;  1ESJ A;  3GBU A;  3MBJ A;  3Q92 A;  2ABQ A;  5EYN A;  4ZIY A;  2F02 A;  2JG5 A;  3RM5 A;  2Y68 A;  4KAH A;  3FHY A;  4KAN A;  4XF7 A;  3ZM6 A;  2VTD A;  4JKU A;  3RPZ A;  1J6U A;  1DGM A;  5TRW A;  1UB0 A;  4LBX A;  3B1P A;  3NRS A;  3RRE A;  1GC5 A;  1YHJ A;  3RQ5 A;  1LIO A;  1V1B A;  1V19 A;  4JKS A;  4O1G A;  1TZ3 A;  1FGS A;  1W78 A;  3RQ8 A;  3RS9 A;  2JFG A;  3RQ6 A;  3PZS A;  2I6B A;  1JBW A;  1GQY A;  2F00 A;  4WJM A;  3NBW A;  4CVM A;  3KZH A;  2GC6 A;  4KAL A;  3EWM A;  4LCA A;  4K9C A;  4EN4 A;  5BYD A;  5C40 A;  1TD2 A;  1RFV A;  3K9E A;  2HLZ A;  4K8K A;  4C5K A;  2GC5 A;  4B8R A;  1RKA A;  4U7X A;  2DCN A;  3HYO A;  2AJR A;  3RQH A;  3UAG A;  3UQ6 A;  2Y1O A;  2Y66 A;  1VM7 A;  3HJ6 A;  5B6A A;  4B8S A;  1O5Z A;  2AA0 A;  3KTN A;  1EEH A;  2A9Z A;  2ABS A;  3CQD A;  4N09 A;  3ZL8 A;  3JUL A;  4BUC A;  5BYE A;  2WJP A;  1EKK A;  3NL3 A;  5CGE A;  5CM5 A;  1P3D A;  4O1L A;  4HV4 A;  3VAS A;  1LHP A;  4YL5 A;  5C41 A;  4K8T A;  3I3Y A;  4QF5 A;  1TZ6 A;  3HIC A;  3RRB A;  1U2X A;  2PKM A;  3QAI A;  3QCZ A;  3UQE A;  1RKS A;  3IBQ A;  2I6A A;  2HW1 A;  4EBU A;  2AFB A;  2RBC A;  2XPC A;  3H49 A;  4XF6 A;  3RRF A;  4E3A A;  2VAR A;  2WTZ A;  3RTD A;  1KYH A;  1LIJ A;  3RO4 A;  4E8Z A;  3NM1 A;  1LHR A;  2AWD A;  3IE7 A;  4UBE A;  1EKQ A;  3NL5 A;  5BYC A;  4KAD A;  3NC9 A;  5A5E A;  4K9I A;  2DDW A;  3OTX A;  3RPH A;  1ESQ A;  3RSS A;  1E8C A;  4E8Y A;  4DU5 A;  2JFF A;  2YXU A;  2AJP A;  4C13 A;  2XJA A;  3DRW A;  4K8C A;  3W4S A;  4EOH A;  4PVV A;  3B1N A;  3BGK A;  2UUP A;  2AM1 A;  1YGJ A;  2JGV A;  4LBG A;  1UAG A;  4E84 A;  3UBO A;  3FHX A;  4K93 A;  3GO7 A;  1RFT A;  3RQ2 A;  3RQQ A;  3UMO A;  1UA4 A;  3UMP A;  3UQD A;  2R3E A;  3KEU A;  3RSG A;  2Y67 A;  3B3L A;  3K5W A;  1RK2 A;  1YGK A;  3KD6 A;  3NCA A;  4S1M A;  3RQX A;  2GCA A;  1RKD A;  4N08 A;  1BX4 A;  2X5O A;  2Q5R A;  5F0Z A;  2VTE A;  2V78 A;  1WYE A;  4LC4 A;  3RSQ A;  3B1Q A;  2F7K A;  3NL6 A;  4K8P A;  2DDO A;  1JXH A;  4C5M A;  4S1I A;  4JJP A;  4E69 A;  1V1S A;  5F11 A;  3RTC A;  4E8W A;  1P31 A;  3ZM5 A;  3VAQ A;  1W7K A;  4EUM A;  4KBE A;  2HQQ A;  3N2A A;  2GCB A;  2VOR A;  3Q1Y A;  3RSF A;  3ZS7 A;  3RTA A;  1JBV A;  2JG1 A;  5A5F A;  2QHP A;  4UAG A;  3NBV A;  3LK7 A;  4YWR A;  2I5B A;  4BUB A;  5COJ A;  3RTG A;  4C5L A;  1C3Q A;  3LKI A;  4GM6 A;  2QCV A;  1TYY A;  3UQ9 A;  1RFU A;  3EAG A;  3BF5 A;  3GO6 A;  3NC2 A;  3LHX A;  1GQQ A;  4C5N A;  3MBH A;  4XCK A;  1L2L A;  2NWH A;  3RY7 A;  4DC3 A;  5C3Z A;  3RT9 A;  3B1R A;  1VK4 A;  2UAG A;  2UUO A;  3RTB A;  2A9Y A;  1VI9 A;  3RT7 A;  4S1I B;  3RU3 A;  1GQT A;  2FV7 A;  2AX3 A;  2PKF A;  3RRJ A;  1JXI A;  2PKK A;  3PL2 A;  1E0D A;  1V1A A;  3NM3 A;  4XDA A;  3HPD A;  5BYF A;  4C12 A;  3B1O A;  2R3B A;  5CGA A;  5EY7 A;  3NL2 A;  4X8F A;  2XTB A;  2JFH A;  1LIK A;  2PKN A;  2YXT A;  3IKH A;  3LOO A;  3N1C A;  3RU2 A;  3IN1 A;  2C4E A;  2DDM A;  5C3Y A;  2AM2 A;  1LII A;  4S1H A;  4CVL A;  4C5J A;  4QDI A;  2C49 A;  3IQ0 A;  3DZV A; 
#chains in the Genus database with same CATH homology
 3H74 A;  3LJS A;  3RS8 A;  3IH0 A;  3RTE A;  3QA2 A;  2AB8 A;  5TQI A;  1ESJ A;  3GBU A;  3MBJ A;  3Q92 A;  2ABQ A;  5EYN A;  3RM5 A;  2F02 A;  2JG5 A;  4KAH A;  3FHY A;  4KAN A;  4XF7 A;  4JKU A;  3RPZ A;  1DGM A;  5TRW A;  1UB0 A;  4LBX A;  3B1P A;  3RRE A;  1GC5 A;  1YHJ A;  3RQ5 A;  1LIO A;  1V1B A;  1V19 A;  4JKS A;  4O1G A;  1TZ3 A;  3RQ8 A;  3RS9 A;  3RQ6 A;  5CGA A;  3PZS A;  2I6B A;  4WJM A;  3NBW A;  3KZH A;  4KAL A;  4LCA A;  3EWM A;  3UQ6 A;  4K9C A;  4EN4 A;  5BYD A;  5C40 A;  1TD2 A;  1RFV A;  3K9E A;  2HLZ A;  4K8K A;  4C5K A;  4B8R A;  1RKA A;  4U7X A;  2DCN A;  3HYO A;  2AJR A;  3RQH A;  1VM7 A;  3HJ6 A;  5B6A A;  4B8S A;  2AA0 A;  3KTN A;  2A9Z A;  3CQD A;  2ABS A;  4N09 A;  5BYE A;  3JUL A;  5CGE A;  1EKK A;  3NL3 A;  5CM5 A;  4O1L A;  3VAS A;  1LHP A;  4YL5 A;  5C41 A;  4K8T A;  3I3Y A;  1TZ6 A;  3HIC A;  3RRB A;  1U2X A;  2PKM A;  3QAI A;  3UQE A;  1RKS A;  3IBQ A;  2I6A A;  2HW1 A;  4EBU A;  2AFB A;  2RBC A;  3H49 A;  4XF6 A;  4E3A A;  3RRF A;  2VAR A;  3RTD A;  1KYH A;  1LIJ A;  3RO4 A;  4E8Z A;  3NM1 A;  1LHR A;  2AWD A;  3IE7 A;  4UBE A;  1EKQ A;  3NL5 A;  5BYC A;  4KAD A;  3NC9 A;  4K9I A;  2DDW A;  3OTX A;  3RPH A;  1ESQ A;  3RSS A;  4E8Y A;  4DU5 A;  2YXU A;  2AJP A;  3DRW A;  4K8C A;  3W4S A;  4EOH A;  4PVV A;  3B1N A;  3BGK A;  1YGJ A;  2JGV A;  4LBG A;  4E84 A;  3UBO A;  3FHX A;  4K93 A;  3GO7 A;  1RFT A;  3RQ2 A;  3RQQ A;  3UMO A;  1UA4 A;  3UMP A;  3UQD A;  2R3E A;  3KEU A;  3RSG A;  3B3L A;  3KD6 A;  3K5W A;  1RK2 A;  1YGK A;  3NCA A;  4S1M A;  3RQX A;  1RKD A;  4N08 A;  1BX4 A;  2Q5R A;  5F0Z A;  2V78 A;  1WYE A;  4LC4 A;  3RSQ A;  3B1Q A;  2F7K A;  3NL6 A;  4K8P A;  2DDO A;  1JXH A;  4C5M A;  4S1I A;  4JJP A;  4E69 A;  1V1S A;  5F11 A;  3RTC A;  4E8W A;  3VAQ A;  4EUM A;  4KBE A;  2HQQ A;  3Q1Y A;  3RSF A;  3ZS7 A;  3RTA A;  2JG1 A;  2QHP A;  3NBV A;  4YWR A;  2I5B A;  5COJ A;  3RTG A;  4C5L A;  1C3Q A;  3LKI A;  4GM6 A;  2QCV A;  1TYY A;  3UQ9 A;  1RFU A;  3BF5 A;  3GO6 A;  3NC2 A;  3LHX A;  4C5N A;  3MBH A;  4XCK A;  1L2L A;  2NWH A;  3RY7 A;  4DC3 A;  5C3Z A;  3RT9 A;  3B1R A;  1VK4 A;  3RTB A;  2A9Y A;  1VI9 A;  3RT7 A;  4S1I B;  3RU3 A;  1GQT A;  2FV7 A;  2AX3 A;  2PKF A;  3RRJ A;  1JXI A;  2PKK A;  3PL2 A;  3NM3 A;  1V1A A;  4XDA A;  3HPD A;  5BYF A;  3B1O A;  2R3B A;  5EY7 A;  3NL2 A;  4X8F A;  2XTB A;  2YXT A;  1LIK A;  2PKN A;  3N1C A;  3IKH A;  3LOO A;  3RU2 A;  3IN1 A;  2C4E A;  2DDM A;  5C3Y A;  4S1H A;  1LII A;  4C5J A;  2C49 A;  3IQ0 A;  3DZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...