4C5KA

Structure of the pyridoxal kinase from staphylococcus aureus in complex with adp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
276
structure length
274
Chain Sequence
GALKKVLTIAGSDTSAGAGMQADLKTFQELDTYGMVALTAIVTMDKDTWSHDVTPLPMDVFEKQLETALSIGPDAIKTGMLGTEEIIKRAGEVYEASNAQYFVVDPVMVCKDEVLNPGNTEAMIKYLLPKATVVTPNLFEAGQLSGLGKLNSIEDMKKAATIIFDKGAQHVIIKGGKALDQDKSYDLYYDGQTFYQLTTDMFQQSYNHGAGCTFAAATTAYLANGKSPKEAVISAKAFVASAIKNGWKMNDFVGPVDHGAYNRIEHIDVEVTEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Subfamily of Bacterial Ribokinases Utilizes a Hemithioacetal for Pyridoxal Phosphate Salvage.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Transferase
molecule keywords PHOSPHOMETHYLPYRIMIDINE KINASE
total genus 95
structure length 274
sequence length 276
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.35: Pyridoxal kinase.
pdb deposition date 2013-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08543 Phos_pyr_kin Phosphomethylpyrimidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 4c5kA00
1VI9A 3RRFA 4E84A 3NL3A 3NL2A 3B1QA 3RS8A 3RSSA 4C5LA 4GM6A 4N09A 1LIIA 3IH0A 4DC3A 4E8ZA 2A9YA 3QAIA 4O1LA 4C5KA 3IBQA 4C5NA 4EOHA 2YXUA 3RRJA 3LJSA 4E3AA 5BYFA 1V1BA 1RFTA 1RFVA 3QA2A 4K93A 3RT7A 3RTCA 3B1NA 3RS9A 4E8YA 3NC2A 3RU2A 3NBWA 2I6BA 1TD2A 3UQDA 3Q92A 3PZSA 2F02A 4JKUA 2RBCA 2PKNA 3K9EA 3RT9A 3OTXA 1RFUA 2R3BA 3JULA 3FHXA 1V1AA 3FHYA 1RKDA 2ABQA 4JKSA 4K8KA 4S1MA 3NBVA 4XDAA 2V78A 2JG1A 3W4SA 2AJPA 3NM3A 3KEUA 3KZHA 3RSFA 4S1IA 3RSQA 3RTDA 3IQ0A 4KAHA 3Q1YA 3RTEA 4PVVA 1LIOA 4KALA 4S1HA 4K8CA 3N1CA 3RM5A 3UMPA 2HLZA 2PKMA 4N08A 2A9ZA 1VK4A 3BGKA 3GO6A 3KD6A 4WJMA 5CGEA 1RKAA 3RRBA 3UQ9A 3B1RA 1L2LA 4XF7A 3H74A 3GBUA 3B3LA 2AA0A 2AJRA 3NL6A 3RTGA 1UA4A 4C5JA 1C3QA 1ESQA 2PKFA 3RO4A 5BYEA 2DDMA 2DDOA 4LBXA 3RQXA 3UQ6A 4DU5A 1WYEA 1KYHA 1LHPA 3RQ5A 4LC4A 4B8RA 5C40A 2XTBA 3NM1A 1GQTA 3B1OA 3HICA 3HPDA 3IE7A 3LHXA 4U7XA 4XF6A 5TRWA 3RPHA 3UQEA 4KANA 3RTBA 2C49A 1LIKA 2AWDA 3BF5A 1LHRA 4C5MA 3GO7A 3RQ6A 1BX4A 4K8TA 3RSGA 3H49A 2PKKA 2R3EA 2AFBA 3IKHA 3KTNA 3MBHA 2NWHA 1DGMA 4LBGA 4UBEA 3RQHA 2DDWA 3VAQA 4EBUA 1UB0A 3CQDA 2VARA 4KBEA 4EUMA 3HYOA 1TZ6A 3RY7A 1LIJA 5F0ZA 5TQIA 3RPZA 1RK2A 5COJA 5EY7A 3LOOA 3DZVA 4JJPA 2FV7A 4YL5A 5C3YA 3RU3A 1EKQA 4E8WA 4E69A 1V19A 2AX3A 3UBOA 1TZ3A 2HW1A 2I5BA 4YWRA 3NCAA 4LCAA 3RQ8A 4S1IB 5F11A 3NC9A 4B8SA 4KADA 5B6AA 5CM5A 5BYDA 1TYYA 1YGJA 2JGVA 2JG5A 3NL5A 3ZS7A 1GC5A 5BYCA 2HQQA 1RKSA 3MBJA 2I6AA 1JXHA 3LKIA 1YHJA 5C3ZA 4K8PA 4X8FA 3IN1A 1V1SA 1YGKA 1U2XA 4XCKA 3I3YA 3RTAA 1EKKA 2YXTA 4K9CA 3RQQA 3DRWA 3PL2A 4K9IA 5EYNA 5CGAA 3RREA 3VASA 2QCVA 2QHPA 2AB8A 2F7KA 3EWMA 3UMOA 1JXIA 2ABSA 3B1PA 1ESJA 4O1GA 3RQ2A 1VM7A 2C4EA 2DCNA 2Q5RA 5C41A 3K5WA 4EN4A
chains in the Genus database with same CATH superfamily
1VI9A 1P3DA 3RRFA 1GQYA 2JFGA 3B1QA 3NL2A 3NL3A 1GQQA 1O5ZA 3RS8A 3RSSA 4GM6A 4C5LA 4N09A 1LIIA 2VTDA 3IH0A 4DC3A 4E8ZA 2A9YA 3QAIA 4O1LA 4C5KA 3IBQA 4C5NA 4EOHA 2YXUA 3RRJA 3LJSA 4E3AA 2GC5A 1V1BA 2AM1A 1RFTA 1RFVA 3QA2A 4K93A 3RT7A 1P31A 3B1NA 3RS9A 3RTCA 3LK7A 3NC2A 4E8YA 1J6UA 3RU2A 3NBWA 2I6BA 3ZM6A 1TD2A 2VTEA 3UQDA 3Q92A 3PZSA 2F02A 4JKUA 2RBCA 2PKNA 3K9EA 3RT9A 3OTXA 1RFUA 2R3BA 1GG4A 3JULA 3FHXA 1V1AA 3FHYA 1RKDA 1JBWA 1JBVA 2ABQA 4JKSA 4K8KA 3NBVA 4S1MA 2GCBA 4XDAA 3ZM5A 4C12A 4CVKA 2V78A 2JG1A 3W4SA 2AJPA 3NM3A 3KEUA 3KZHA 3RSFA 4S1IA 3RSQA 2Y68A 3IQ0A 4KAHA 3Q1YA 3RTEA 3RTDA 4PVVA 1LIOA 4KALA 4S1HA 4K8CA 3N1CA 1UAGA 3RM5A 3UMPA 2HLZA 2PKMA 4N08A 2A9ZA 1VK4A 3BGKA 3GO6A 3KD6A 2Y67A 4WJMA 5CGEA 1RKAA 3ZL8A 3RRBA 3UQ9A 3B1RA 4CVLA 1L2LA 4XF7A 1E8CA 2Y1OA 3GBUA 3H74A 4EN4A 3B3LA 2AA0A 2AJRA 2WTZA 3NL6A 3RTGA 1UA4A 4C5JA 4E84A 1C3QA 5A5FA 1ESQA 2AM2A 2PKFA 3RO4A 5BYEA 4CVMA 2DDMA 2DDOA 4LBXA 4ZIYA 3RQXA 2XPCA 3UAGA 4DU5A 3UQ6A 1WYEA 2VORA 1E0DA 1KYHA 3HN7A 1LHPA 3RQ5A 4LC4A 2JFHA 4B8RA 5C40A 2XTBA 3NM1A 1GQTA 3B1OA 3HICA 3HPDA 3IE7A 3EAGA 3LHXA 4QF5A 4U7XA 4XF6A 5TRWA 3RPHA 3UQEA 4KANA 2JFFA 3RTBA 2C49A 1LIKA 2AWDA 3BF5A 1LHRA 4C5MA 3GO7A 3RQ6A 1BX4A 4K8TA 3PYZA 2Y66A 2PKKA 3H49A 2R3EA 2AFBA 3IKHA 3KTNA 3MBHA 2NWHA 1DGMA 4LBGA 4UBEA 3RQHA 2DDWA 3VAQA 4EBUA 1UB0A 2X5OA 3CQDA 2VARA 4KBEA 4EUMA 3HYOA 1TZ6A 3RY7A 2VOSA 1LIJA 2UUPA 1W78A 5F0ZA 5TQIA 3RPZA 3RSGA 1RK2A 5COJA 5EY7A 3LOOA 3HJ6A 3DZVA 4JJPA 2FV7A 4YL5A 5C3YA 4UAGA 3QCZA 1EKQA 1W7KA 3RU3A 4E8WA 4E69A 1V19A 2AX3A 3UBOA 1TZ3A 2HW1A 2I5BA 4YWRA 2GCAA 4HV4A 3NCAA 4LCAA 3RQ8A 4S1IB 5F11A 3NC9A 2XJAA 4B8SA 4KADA 2GC6A 5CM5A 5B6AA 5BYDA 1TYYA 1YGJA 2JGVA 2JG5A 3NL5A 3ZS7A 1GC5A 3N2AA 5BYCA 2UUOA 2HQQA 5BYFA 1EEHA 1RKSA 3MBJA 2I6AA 1JXHA 3LKIA 4BUCA 1YHJA 5C3ZA 1FGSA 4K8PA 4X8FA 3IN1A 1V1SA 1YGKA 1U2XA 4XCKA 3I3YA 3RTAA 1EKKA 2YXTA 4K9CA 3RQQA 4C13A 3DRWA 3PL2A 4K9IA 2F00A 5EYNA 5CGAA 3RREA 3VASA 2QCVA 2QHPA 2AB8A 2F7KA 3EWMA 3NRSA 1JXIA 3UMOA 4BUBA 2ABSA 3B1PA 1ESJA 4O1GA 4QDIA 2WJPA 1VM7A 2C4EA 2DCNA 2Q5RA 3RQ2A 3K5WA 5A5EA 5C41A 2UAGA
chains in the Genus database with same CATH topology
1VI9A 3RRFA 4E84A 3NL3A 3NL2A 3B1QA 3RS8A 3RSSA 4C5LA 4GM6A 4N09A 1LIIA 3IH0A 4DC3A 4E8ZA 2A9YA 3QAIA 4O1LA 4C5KA 3IBQA 4C5NA 4EOHA 2YXUA 3RRJA 3LJSA 4E3AA 5BYFA 1V1BA 1RFTA 1RFVA 3QA2A 4K93A 3RT7A 3RTCA 3B1NA 3RS9A 4E8YA 3NC2A 3RU2A 3NBWA 2I6BA 1TD2A 3UQDA 3Q92A 3PZSA 2F02A 4JKUA 2RBCA 2PKNA 3K9EA 3RT9A 3OTXA 1RFUA 2R3BA 3JULA 3FHXA 1V1AA 3FHYA 1RKDA 2ABQA 4JKSA 4K8KA 4S1MA 3NBVA 4XDAA 2V78A 2JG1A 3W4SA 2AJPA 3NM3A 3KEUA 3KZHA 3RSFA 4S1IA 3RSQA 3RTDA 3IQ0A 4KAHA 3Q1YA 3RTEA 4PVVA 1LIOA 4KALA 4S1HA 4K8CA 3N1CA 3RM5A 3UMPA 2HLZA 2PKMA 4N08A 2A9ZA 1VK4A 3BGKA 3GO6A 3KD6A 4WJMA 5CGEA 1RKAA 3RRBA 3UQ9A 3B1RA 1L2LA 4XF7A 3H74A 3GBUA 3B3LA 2AA0A 2AJRA 3NL6A 3RTGA 1UA4A 4C5JA 1C3QA 1ESQA 2PKFA 3RO4A 5BYEA 2DDMA 2DDOA 4LBXA 3RQXA 3UQ6A 4DU5A 1WYEA 1KYHA 1LHPA 3RQ5A 4LC4A 4B8RA 5C40A 2XTBA 3NM1A 1GQTA 3B1OA 3HICA 3HPDA 3IE7A 3LHXA 4U7XA 4XF6A 5TRWA 3RPHA 3UQEA 4KANA 3RTBA 2C49A 1LIKA 2AWDA 3BF5A 1LHRA 4C5MA 3GO7A 3RQ6A 1BX4A 4K8TA 3RSGA 3H49A 2PKKA 2R3EA 2AFBA 3IKHA 3KTNA 3MBHA 2NWHA 1DGMA 4LBGA 4UBEA 3RQHA 2DDWA 3VAQA 4EBUA 1UB0A 3CQDA 2VARA 4KBEA 4EUMA 3HYOA 1TZ6A 3RY7A 1LIJA 5F0ZA 5TQIA 3RPZA 1RK2A 5COJA 5EY7A 3LOOA 3HJ6A 3DZVA 4JJPA 2FV7A 4YL5A 5C3YA 3RU3A 1EKQA 4E8WA 4E69A 1V19A 2AX3A 3UBOA 1TZ3A 2HW1A 2I5BA 4YWRA 3NCAA 4LCAA 3RQ8A 4S1IB 5F11A 3NC9A 4B8SA 4KADA 5B6AA 5CM5A 5BYDA 1TYYA 1YGJA 2JGVA 2JG5A 3NL5A 3ZS7A 1GC5A 5BYCA 2HQQA 1RKSA 3MBJA 2I6AA 1JXHA 3LKIA 1YHJA 5C3ZA 4K8PA 4X8FA 3IN1A 1V1SA 1YGKA 1U2XA 4XCKA 3I3YA 3RTAA 1EKKA 2YXTA 4K9CA 3RQQA 3DRWA 3PL2A 4K9IA 5EYNA 5CGAA 3RREA 3VASA 2QCVA 2QHPA 2AB8A 2F7KA 3EWMA 3UMOA 1JXIA 2ABSA 3B1PA 1ESJA 4O1GA 3RQ2A 1VM7A 2C4EA 2DCNA 2Q5RA 5C41A 3K5WA 4EN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VI9 A;  3RRF A;  4E84 A;  3NL3 A;  3NL2 A;  3B1Q A;  3RS8 A;  3RSS A;  4C5L A;  4GM6 A;  4N09 A;  1LII A;  3IH0 A;  4DC3 A;  4E8Z A;  2A9Y A;  3QAI A;  4O1L A;  4C5K A;  3IBQ A;  4C5N A;  4EOH A;  2YXU A;  3RRJ A;  3LJS A;  4E3A A;  5BYF A;  1V1B A;  1RFT A;  1RFV A;  3QA2 A;  4K93 A;  3RT7 A;  3RTC A;  3B1N A;  3RS9 A;  4E8Y A;  3NC2 A;  3RU2 A;  3NBW A;  2I6B A;  1TD2 A;  3UQD A;  3Q92 A;  3PZS A;  2F02 A;  4JKU A;  2RBC A;  2PKN A;  3K9E A;  3RT9 A;  3OTX A;  1RFU A;  2R3B A;  3JUL A;  3FHX A;  1V1A A;  3FHY A;  1RKD A;  2ABQ A;  4JKS A;  4K8K A;  4S1M A;  3NBV A;  4XDA A;  2V78 A;  2JG1 A;  3W4S A;  2AJP A;  3NM3 A;  3KEU A;  3KZH A;  3RSF A;  4S1I A;  3RSQ A;  3RTD A;  3IQ0 A;  4KAH A;  3Q1Y A;  3RTE A;  4PVV A;  1LIO A;  4KAL A;  4S1H A;  4K8C A;  3N1C A;  3RM5 A;  3UMP A;  2HLZ A;  2PKM A;  4N08 A;  2A9Z A;  1VK4 A;  3BGK A;  3GO6 A;  3KD6 A;  4WJM A;  5CGE A;  1RKA A;  3RRB A;  3UQ9 A;  3B1R A;  1L2L A;  4XF7 A;  3H74 A;  3GBU A;  3B3L A;  2AA0 A;  2AJR A;  3NL6 A;  3RTG A;  1UA4 A;  4C5J A;  1C3Q A;  1ESQ A;  2PKF A;  3RO4 A;  5BYE A;  2DDM A;  2DDO A;  4LBX A;  3RQX A;  3UQ6 A;  4DU5 A;  1WYE A;  1KYH A;  1LHP A;  3RQ5 A;  4LC4 A;  4B8R A;  5C40 A;  2XTB A;  3NM1 A;  1GQT A;  3B1O A;  3HIC A;  3HPD A;  3IE7 A;  3LHX A;  4U7X A;  4XF6 A;  5TRW A;  3RPH A;  3UQE A;  4KAN A;  3RTB A;  2C49 A;  1LIK A;  2AWD A;  3BF5 A;  1LHR A;  4C5M A;  3GO7 A;  3RQ6 A;  1BX4 A;  4K8T A;  3RSG A;  3H49 A;  2PKK A;  2R3E A;  2AFB A;  3IKH A;  3KTN A;  3MBH A;  2NWH A;  1DGM A;  4LBG A;  4UBE A;  3RQH A;  2DDW A;  3VAQ A;  4EBU A;  1UB0 A;  3CQD A;  2VAR A;  4KBE A;  4EUM A;  3HYO A;  1TZ6 A;  3RY7 A;  1LIJ A;  5F0Z A;  5TQI A;  3RPZ A;  1RK2 A;  5COJ A;  5EY7 A;  3LOO A;  3DZV A;  4JJP A;  2FV7 A;  4YL5 A;  5C3Y A;  3RU3 A;  1EKQ A;  4E8W A;  4E69 A;  1V19 A;  2AX3 A;  3UBO A;  1TZ3 A;  2HW1 A;  2I5B A;  4YWR A;  3NCA A;  4LCA A;  3RQ8 A;  4S1I B;  5F11 A;  3NC9 A;  4B8S A;  4KAD A;  5B6A A;  5CM5 A;  5BYD A;  1TYY A;  1YGJ A;  2JGV A;  2JG5 A;  3NL5 A;  3ZS7 A;  1GC5 A;  5BYC A;  2HQQ A;  1RKS A;  3MBJ A;  2I6A A;  1JXH A;  3LKI A;  1YHJ A;  5C3Z A;  4K8P A;  4X8F A;  3IN1 A;  1V1S A;  1YGK A;  1U2X A;  4XCK A;  3I3Y A;  3RTA A;  1EKK A;  2YXT A;  4K9C A;  3RQQ A;  3DRW A;  3PL2 A;  4K9I A;  5EYN A;  5CGA A;  3RRE A;  3VAS A;  2QCV A;  2QHP A;  2AB8 A;  2F7K A;  3EWM A;  3UMO A;  1JXI A;  2ABS A;  3B1P A;  1ESJ A;  4O1G A;  3RQ2 A;  1VM7 A;  2C4E A;  2DCN A;  2Q5R A;  5C41 A;  3K5W A;  4EN4 A; 
#chains in the Genus database with same CATH topology
 1VI9 A;  1P3D A;  3RRF A;  1GQY A;  2JFG A;  3B1Q A;  3NL2 A;  3NL3 A;  1GQQ A;  1O5Z A;  3RS8 A;  3RSS A;  4GM6 A;  4C5L A;  4N09 A;  1LII A;  2VTD A;  3IH0 A;  4DC3 A;  4E8Z A;  2A9Y A;  3QAI A;  4O1L A;  4C5K A;  3IBQ A;  4C5N A;  4EOH A;  2YXU A;  3RRJ A;  3LJS A;  4E3A A;  2GC5 A;  1V1B A;  2AM1 A;  1RFT A;  1RFV A;  3QA2 A;  4K93 A;  3RT7 A;  1P31 A;  3B1N A;  3RS9 A;  3RTC A;  3LK7 A;  3NC2 A;  4E8Y A;  1J6U A;  3RU2 A;  3NBW A;  2I6B A;  3ZM6 A;  1TD2 A;  2VTE A;  3UQD A;  3Q92 A;  3PZS A;  2F02 A;  4JKU A;  2RBC A;  2PKN A;  3K9E A;  3RT9 A;  3OTX A;  1RFU A;  2R3B A;  1GG4 A;  3JUL A;  3FHX A;  1V1A A;  3FHY A;  1RKD A;  1JBW A;  1JBV A;  2ABQ A;  4JKS A;  4K8K A;  3NBV A;  4S1M A;  2GCB A;  4XDA A;  3ZM5 A;  4C12 A;  4CVK A;  2V78 A;  2JG1 A;  3W4S A;  2AJP A;  3NM3 A;  3KEU A;  3KZH A;  3RSF A;  4S1I A;  3RSQ A;  2Y68 A;  3IQ0 A;  4KAH A;  3Q1Y A;  3RTE A;  3RTD A;  4PVV A;  1LIO A;  4KAL A;  4S1H A;  4K8C A;  3N1C A;  1UAG A;  3RM5 A;  3UMP A;  2HLZ A;  2PKM A;  4N08 A;  2A9Z A;  1VK4 A;  3BGK A;  3GO6 A;  3KD6 A;  2Y67 A;  4WJM A;  5CGE A;  1RKA A;  3ZL8 A;  3RRB A;  3UQ9 A;  3B1R A;  4CVL A;  1L2L A;  4XF7 A;  1E8C A;  2Y1O A;  3GBU A;  3H74 A;  4EN4 A;  3B3L A;  2AA0 A;  2AJR A;  2WTZ A;  3NL6 A;  3RTG A;  1UA4 A;  4C5J A;  4E84 A;  1C3Q A;  5A5F A;  1ESQ A;  2AM2 A;  2PKF A;  3RO4 A;  5BYE A;  4CVM A;  2DDM A;  2DDO A;  4LBX A;  4ZIY A;  3RQX A;  2XPC A;  3UAG A;  4DU5 A;  3UQ6 A;  1WYE A;  2VOR A;  1E0D A;  1KYH A;  3HN7 A;  1LHP A;  3RQ5 A;  4LC4 A;  2JFH A;  4B8R A;  5C40 A;  2XTB A;  3NM1 A;  1GQT A;  3B1O A;  3HIC A;  3HPD A;  3IE7 A;  3EAG A;  3LHX A;  4QF5 A;  4U7X A;  4XF6 A;  5TRW A;  3RPH A;  3UQE A;  4KAN A;  2JFF A;  3RTB A;  2C49 A;  1LIK A;  2AWD A;  3BF5 A;  1LHR A;  4C5M A;  3GO7 A;  3RQ6 A;  1BX4 A;  4K8T A;  3PYZ A;  2Y66 A;  2PKK A;  3H49 A;  2R3E A;  2AFB A;  3IKH A;  3KTN A;  3MBH A;  2NWH A;  1DGM A;  4LBG A;  4UBE A;  3RQH A;  2DDW A;  3VAQ A;  4EBU A;  1UB0 A;  2X5O A;  3CQD A;  2VAR A;  4KBE A;  4EUM A;  3HYO A;  1TZ6 A;  3RY7 A;  2VOS A;  1LIJ A;  2UUP A;  1W78 A;  5F0Z A;  5TQI A;  3RPZ A;  3RSG A;  1RK2 A;  5COJ A;  5EY7 A;  3LOO A;  3HJ6 A;  3DZV A;  4JJP A;  2FV7 A;  4YL5 A;  5C3Y A;  4UAG A;  3QCZ A;  1EKQ A;  1W7K A;  3RU3 A;  4E8W A;  4E69 A;  1V19 A;  2AX3 A;  3UBO A;  1TZ3 A;  2HW1 A;  2I5B A;  4YWR A;  2GCA A;  4HV4 A;  3NCA A;  4LCA A;  3RQ8 A;  4S1I B;  5F11 A;  3NC9 A;  2XJA A;  4B8S A;  4KAD A;  2GC6 A;  5CM5 A;  5B6A A;  5BYD A;  1TYY A;  1YGJ A;  2JGV A;  2JG5 A;  3NL5 A;  3ZS7 A;  1GC5 A;  3N2A A;  5BYC A;  2UUO A;  2HQQ A;  5BYF A;  1EEH A;  1RKS A;  3MBJ A;  2I6A A;  1JXH A;  3LKI A;  4BUC A;  1YHJ A;  5C3Z A;  1FGS A;  4K8P A;  4X8F A;  3IN1 A;  1V1S A;  1YGK A;  1U2X A;  4XCK A;  3I3Y A;  3RTA A;  1EKK A;  2YXT A;  4K9C A;  3RQQ A;  4C13 A;  3DRW A;  3PL2 A;  4K9I A;  2F00 A;  5EYN A;  5CGA A;  3RRE A;  3VAS A;  2QCV A;  2QHP A;  2AB8 A;  2F7K A;  3EWM A;  3NRS A;  1JXI A;  3UMO A;  4BUB A;  2ABS A;  3B1P A;  1ESJ A;  4O1G A;  4QDI A;  2WJP A;  1VM7 A;  2C4E A;  2DCN A;  2Q5R A;  3RQ2 A;  3K5W A;  5A5E A;  5C41 A;  2UAG A; 
#chains in the Genus database with same CATH homology
 1VI9 A;  3RRF A;  4E84 A;  3NL3 A;  3NL2 A;  3B1Q A;  3RS8 A;  3RSS A;  4C5L A;  4GM6 A;  4N09 A;  1LII A;  3IH0 A;  4DC3 A;  4E8Z A;  2A9Y A;  3QAI A;  4O1L A;  4C5K A;  3IBQ A;  4C5N A;  4EOH A;  2YXU A;  3RRJ A;  3LJS A;  4E3A A;  5BYF A;  1V1B A;  1RFT A;  1RFV A;  3QA2 A;  4K93 A;  3RT7 A;  3RTC A;  3B1N A;  3RS9 A;  4E8Y A;  3NC2 A;  3RU2 A;  3NBW A;  2I6B A;  1TD2 A;  3UQD A;  3Q92 A;  3PZS A;  2F02 A;  4JKU A;  2RBC A;  2PKN A;  3K9E A;  3RT9 A;  3OTX A;  1RFU A;  2R3B A;  3JUL A;  3FHX A;  1V1A A;  3FHY A;  1RKD A;  2ABQ A;  4JKS A;  4K8K A;  4S1M A;  3NBV A;  4XDA A;  2V78 A;  2JG1 A;  3W4S A;  2AJP A;  3NM3 A;  3KEU A;  3KZH A;  3RSF A;  4S1I A;  3RSQ A;  3RTD A;  3IQ0 A;  4KAH A;  3Q1Y A;  3RTE A;  4PVV A;  1LIO A;  4KAL A;  4S1H A;  4K8C A;  3N1C A;  3RM5 A;  3UMP A;  2HLZ A;  2PKM A;  4N08 A;  2A9Z A;  1VK4 A;  3BGK A;  3GO6 A;  3KD6 A;  4WJM A;  5CGE A;  1RKA A;  3RRB A;  3UQ9 A;  3B1R A;  1L2L A;  4XF7 A;  3H74 A;  3GBU A;  3B3L A;  2AA0 A;  2AJR A;  3NL6 A;  3RTG A;  1UA4 A;  4C5J A;  1C3Q A;  1ESQ A;  2PKF A;  3RO4 A;  5BYE A;  2DDM A;  2DDO A;  4LBX A;  3RQX A;  3UQ6 A;  4DU5 A;  1WYE A;  1KYH A;  1LHP A;  3RQ5 A;  4LC4 A;  4B8R A;  5C40 A;  2XTB A;  3NM1 A;  1GQT A;  3B1O A;  3HIC A;  3HPD A;  3IE7 A;  3LHX A;  4U7X A;  4XF6 A;  5TRW A;  3RPH A;  3UQE A;  4KAN A;  3RTB A;  2C49 A;  1LIK A;  2AWD A;  3BF5 A;  1LHR A;  4C5M A;  3GO7 A;  3RQ6 A;  1BX4 A;  4K8T A;  3RSG A;  3H49 A;  2PKK A;  2R3E A;  2AFB A;  3IKH A;  3KTN A;  3MBH A;  2NWH A;  1DGM A;  4LBG A;  4UBE A;  3RQH A;  2DDW A;  3VAQ A;  4EBU A;  1UB0 A;  3CQD A;  2VAR A;  4KBE A;  4EUM A;  3HYO A;  1TZ6 A;  3RY7 A;  1LIJ A;  5F0Z A;  5TQI A;  3RPZ A;  1RK2 A;  5COJ A;  5EY7 A;  3LOO A;  3HJ6 A;  3DZV A;  4JJP A;  2FV7 A;  4YL5 A;  5C3Y A;  3RU3 A;  1EKQ A;  4E8W A;  4E69 A;  1V19 A;  2AX3 A;  3UBO A;  1TZ3 A;  2HW1 A;  2I5B A;  4YWR A;  3NCA A;  4LCA A;  3RQ8 A;  4S1I B;  5F11 A;  3NC9 A;  4B8S A;  4KAD A;  5B6A A;  5CM5 A;  5BYD A;  1TYY A;  1YGJ A;  2JGV A;  2JG5 A;  3NL5 A;  3ZS7 A;  1GC5 A;  5BYC A;  2HQQ A;  1RKS A;  3MBJ A;  2I6A A;  1JXH A;  3LKI A;  1YHJ A;  5C3Z A;  4K8P A;  4X8F A;  3IN1 A;  1V1S A;  1YGK A;  1U2X A;  4XCK A;  3I3Y A;  3RTA A;  1EKK A;  2YXT A;  4K9C A;  3RQQ A;  3DRW A;  3PL2 A;  4K9I A;  5EYN A;  5CGA A;  3RRE A;  3VAS A;  2QCV A;  2QHP A;  2AB8 A;  2F7K A;  3EWM A;  3UMO A;  1JXI A;  2ABS A;  3B1P A;  1ESJ A;  4O1G A;  3RQ2 A;  1VM7 A;  2C4E A;  2DCN A;  2Q5R A;  5C41 A;  3K5W A;  4EN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...