3RSQA

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima soaked with nadh
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
490
structure length
490
Chain Sequence
b'HMKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative uncharacterized protein
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
total genus 175
structure length 490
sequence length 490
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rsqA01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3rsqA02
2DDMA 4KANA 4S1IB 3NBVA 4K8TA 3RRJA 3NL2A 2HLZA 4GM6A 4LCAA 4LBGA 3RS8A 1LIOA 5C40A 1TD2A 1UB0A 3RTEA 2F02A 2HQQA 1YGKA 2QHPA 4UBEA 4X8FA 3RO4A 4E8ZA 1ESQA 1DGMA 3I3YA 3K5WA 4EUMA 3UQ9A 1U2XA 5C3YA 1RKAA 1RFUA 1UA4A 3RRBA 4K9IA 4PVVA 3K9EA 4XF6A 1RFVA 3Q1YA 3B1OA 2AA0A 2ABQA 1LIIA 3B1PA 2A9ZA 3RQ2A 2I6BA 3EWMA 3IKHA 3RM5A 2R3BA 5BYEA 3UMOA 3FHYA 5F0ZA 3QA2A 3H49A 4K8CA 3D3JA 2FV7A 2HW1A 3UQDA 1LHPA 1ESJA 4LBXA 4C5JA 1RKSA 3RQ6A 1YGJA 3RTAA 2I6AA 1V1SA 3RO7A 4JJPA 2DG2A 3NM1A 3B1RA 3ROXA 5BYCA 3RTDA 2DCNA 3RSFA 1BX4A 2JGVA 3RQQA 1C3QA 1EKKA 3CQDA 3H74A 3LKIA 4EBUA 1V19A 3NCAA 3ROGA 1RKDA 3RQ8A 4XF7A 3NL3A 5B6AA 2AJPA 3ZS7A 4KAHA 3RQ5A 3RQHA 3NC9A 2NWHA 4C5KA 3HYOA 1LIJA 4KALA 1JZTA 3DZVA 3OTXA 4K93A 3ROEA 2A9YA 3D3KA 4XCKA 5CM5A 5EY7A 4N09A 3JULA 1TZ6A 3UQ6A 3RTBA 4O1GA 1L2LA 1V1AA 3RT9A 3NM3A 3RPZA 3RY7A 4C5NA 3LJSA 2F7KA 3RREA 1KYHA 3MBHA 1LHRA 2DDWA 3MBJA 1VK4A 4DC3A 3RU3A 3RSSA 3N1CA 4LC4A 3KD6A 3KTNA 3NBWA 4N08A 1RFTA 4XDAA 3NL5A 3UBOA 5C3ZA 1YHJA 3KZHA 4E84A 1TZ3A 5BYDA 4S1HA 4S1MA 3RPHA 4E8YA 4KADA 2YXTA 3NC2A 3IBQA 3LHXA 3ROZA 3RSQA 2QCVA 2V78A 5TQIA 4C5MA 4DU5A 2PKFA 2R3EA 1WYEA 2VARA 4B8RA 2C4EA 3IH0A 4K9CA 1VM7A 3B3LA 4E8WA 3RSGA 1RK2A 4K8KA 3RS9A 4JKSA 3NL6A 2AWDA 3PZSA 3FHXA 3RRFA 4KBEA 4O1LA 2Q5RA 1EKQA 4E3AA 3KEUA 3IE7A 4B8SA 3IN1A 1JXHA 1VI9A 3LOOA 5COJA 2PKMA 3BGKA 5EYNA 3RTGA 3RQXA 3UQEA 4C5LA 2I5BA 5CGEA 3RTCA 1TYYA 4EOHA 4U7XA 3IQ0A 4S1IA 3RU2A 1GQTA 5BYFA 3B1NA 3RNOA 4K8PA 3HPDA 5CGAA 2AB8A 1GC5A 3UMPA 3VAQA 2XTBA 2JG1A 4EN4A 1LIKA 5F11A 2JG5A 3W4SA 4WJMA 4JKUA 2AX3A 1JXIA 2ABSA 2PKKA 2O8NA 5TRWA 2PKNA 3DRWA 2AFBA 4YWRA 3BF5A 3PL2A 4YL5A 3GO6A 2YXUA 5C41A 3Q92A 1V1BA 2RBCA 3GO7A 3RT7A 2C49A 2DDOA 3HICA 4E69A 3GBUA 2AJRA 3QAIA 3B1QA 3VASA
chains in the Genus database with same CATH superfamily
3SQXA 1LDNA 1MIHA 1SCDA 1Z0DA 4K8TA 2Z2KA 1M54A 5FOWA 3RS8A 2ZWVA 1NJ6A 4ZOAA 1A9XB 2B1QA 3I1IA 3NX4A 2PXCA 4JCCA 4NQRA 4V0ME 2I7CA 1G0NA 5I6DA 2PA0A 3F3YA 5DGIA 4UTZA 1YQQA 2EC5A 2QLNA 1DCTA 1YBHA 7MDHA 2FLVA 3L18A 3S28A 5IULC 2FSVA 2JAQA 3EA5A 1IUPA 2BMEA 1PS9A 2FPGB 3HDGA 4EUFA 3NBAA 3DE7X 3NVMB 3BTSA 4J0CA 1L4KA 4JLAA 1D6SA 5DM4A 4KN5A 1X7YA 1XIVA 3UV6A 4IHKA 3ZGXA 2ZK7A 2REQB 4FFMA 4N5IX 4O4HF 3TL6A 2Z83A 4EDFA 4IIXA 3ZU2A 4YT5A 4GYKA 3DAHA 1Z47A 3WK8A 2CJPA 4Q24A 4NKRA 2XI4A 2WT8A 3DNMA 3L7LA 2GPAA 5IBQA 3ONDA 1PD0A 3ZWBA 1QH0A 5DXJA 4ARZB 4IUCS 3FDIA 1PNVA 1PI3A 4DB2A 3HI4A 4MIYA 5HMMA 3HJCA 1GARA 4LE2A 4RAQA 3AWDA 5ADVA 3AEXA 4BECA 1DXHA 1XHLA 4XCKA 1JKJB 1NBWB 1A7KA 2HMAA 4EYKA 2HEIA 1XXHE 4LY3A 3HB1A 5JWOA 4GMDA 4NVRA 3H2ZA 3RHZA 1IXSB 4KW7A 1NYRA 3AVPA 1IOWA 3EODA 4QEZA 4WK0B 4JK3A 4EENA 4YRGA 4RE6A 1SU6A 2XJ4A 2GCEA 3H86A 4LGCA 2L17A 4C6HA 3CJTA 4QSMA 5J2UA 1GGJA 4LF8B 1T0UA 421PA 2XYRA 1BHQ1 2PY6A 2W2LD 1EX9A 1XP8A 2ZKIA 5E0OA 2CLLB 4NEHB 1EM6A 3VAZA 4C5MA 3FYSA 3BMQA 3QFFA 1KJ9A 4Q02A 5T67A 3WO0A 3OZ7A 3V80A 6NULA 3BIJA 3BCSA 1CP3A 1E98A 3QNWA 3L82B 5BR8B 3O8CA 1ZM2A 3Q3VA 4CIVA 4D43A 5AIAA 3K9QO 5G0SA 4D9EA 3N07A 3OQHA 3Q8WA 4RU1A 5AYVA 3T1HB 5DM0A 1JG1A 2OZVA 1GU1A 3G9QA 4GMKA 3LBFA 4AJNA 4B9AA 2PKMA 5DWVA 5CYOA 3USES 1LS1A 4NSNA 4ROTA 4EFMA 8ABPA 4MV1A 2GJAA 3H42B 5KAMA 2BBOA 4P5DA 5LZ4A 1EQUA 3H17A 2M9MA 3F1LA 3QSYA 4OA5A 4D56A 4FIDA 5CXUA 4ZZ0A 1G1MA 3ZDRA 3DBLB 1LX6A 3IUPA 3S29A 2CNLA 7AT1A 1Q3TA 1NQ5A 4LRSB 5K4GA 1NW7A 2OZLB 1QG4A 1JTEA 2BGLA 3R7SA 2FSVC 1DBPA 1KAGA 4IHJB 4TV9A 3FKSD 3O90A 4DNFA 3ZYZA 4LI3X 3AR2A 1CUEA 3HXKA 2J5KA 2CXTA 2R4TA 4CQMD 1AKVA 1WBBA 2GBCA 3DBRB 4PZPA 5BQ3A 1JU4A 3DFFA 3ZE2B 4V0NA 4GS5A 4NJEB 5SV2A 4QRDA 3FGZA 5LFAA 3RVQA 1SVUA 1DWQA 1Q1AA 1HDOA 4HF7A 4I5EA 3DNPA 5ETJA 1U1IA 1QIMA 4WVLA 3TEJA 4FXOA 3T3EA 5LQKA 1JR2A 2PZ8A 2CJWA 4EZBA 3HCEA 3I9V1 4OJYA 2X1LA 4XYEA 4JXXA 2IYYA 1IEVA 3RW9A 1MOQA 1OOEA 2I76A 2YYSA 2W42A 1EK6A 2Z5VA 3V42A 1W5TA 3Q3IA 4WLOA 5JAHA 1HM5A 3F5FA 2OBYA 4IFIA 3MWKA 1CZUA 2OFOA 1Q6YA 4OUDB 1LJLA 1AHIA 4KDCA 5FA6A 5AVQA 3ZHQA 5COQA 3UMGA 2W83A 1N78A 1K3FA 1WCXA 4KFCA 4LYGA 5JVDA 1V48A 5DHPA 3BMNB 5KVAA 1JR3A 4LJSA 2VPXA 4BMOB 2YYYA 2YZ2A 4B6SA 2A33A 1ORDA 3EBOA 3NM5A 2COEA 3LZCA 3UAWA 1QRSA 4JC8A 3BRCA 4XEHA 4Q7LA 1CUHA 1JQKA 3FETA 1JLRA 3E9ZA 4L85A 1IBRA 3W5CA 2AJPA 3V4FA 5JNLA 5C31A 4Q19A 2AR9A 4AO7A 2BKEA 2Q62A 3CURA 2C7VA 4H15A 4TV8A 1DO2A 5ESDA 4R40A 1E9AA 4LXQA 3SS7X 3TSCA 1NRXA 2F1IA 1XRQA 4IIJA 3MCZA 1T6YA 2WAOA 3VR2A 2CFCA 4CHTA 3HVKA 3F7MA 2NXCA 3VUEA 3N0TA 2CLHB 1S2GA 2AZMA 4TWZA 4ZQGA 3RIHA 3SC2A 5AW3A 5IAAA 4ND8B 3ZGOA 2VF8A 1RPZA 1ORTA 1FP7A 2CB9A 1XCPA 3IMFA 2X14A 2I65A 3PGXA 5FLKA 2ZEJA 1XDWA 4EMUA 1BD3A 1DKUA 2NUBA 3HNPA 5M7EA 2HXGA 3EE6A 4QYXA 1K5PA 1QO0D 1KETA 3DP7A 4JJKA 2EJTA 5AVSA 5AVTA 1CUZA 4B2LA 2WSIA 4EYSA 1VG0B 3WY9A 2G3YA 4FDTA 3GOQA 1Z6XA 1PZGA 1CJMA 2WG2A 3I30X 2KQUA 1SVOA 4UTXA 5KC8A 3K9HA 2VH1A 3A7DA 3D9QX 4HDMA 4HQRA 1I1HA 4M83A 1YB6A 3NOXA 1G0OA 4JA0A 4D74A 4B8SA 2IELA 2ADMA 3DV9A 1I2AA 2XGOA 4TLCA 1BH2A 4BO0A 2BJVA 4E5MA 2IX3A 6AT1A 2D5LA 2HU2A 4KXUA 4S0XA 1TO6A 4I1YA 3L7MA 3DEHA 1NBHA 2F2TA 4MP6A 3NH9A 4KXFB 4W9MC 3O03A 1UJBA 3I64A 1ZHHA 4ZANA 4QGSA 1V6AA 2GZRA 4P3PA 4WQMA 1Z17A 1Q2XA 4O1IA 2PMDA 1DX6A 3VU3A 2QW1A 4C0LA 5KDDA 1MNAA 2A3NA 4RDIA 1HSZA 3U4CA 2LTAA 5LXTF 1ZRSA 1I4DD 2V6GA 4LHEA 4R8RA 5LU8A 3CPHA 1PYGA 4JQCA 3WLOA 4FHGA 5AVZA 2HH9A 3LPDA 3V4OA 2VYFA 4JU8A 2KMLA 1VI5A 5KWJA 1WZEA 4YJ3B 3GJ8A 2PGNA 5FBRB 2HNAA 1GNPA 4O4IB 5GPBA 1F2UA 3LBIA 3TAHA 1JG2A 4GPD1 3LSTA 1RHUA 2C7GA 3CX3A 1CZKA 2XMCA 3QWIA 3WDLA 4F91B 3NVDA 1NDQA 4V0MA 1YGKA 2WV9A 4UUNA 2WD8A 2XQKA 1LLCA 3CPEA 3H7AA 3L8HA 2JAHA 4QOSA 2VTVA 4XYGA 3WGGA 1K75A 1JBEA 1V5WA 1VCMA 3C5EA 1M2VA 5E1BA 4RSHA 5ARCA 3S1AB 4BZQA 3ZZMA 4D6XA 3KQUA 1GZHB 3HL0A 4GYYA 4CM5A 5DHQA 4YAUA 3L43A 1OXTA 5LQDA 4MW4A 5C8VA 2H5EA 4QIHA 2NN3C 4LOLA 3QUSA 1XMIA 4ZI5A 3GXBA 3GPCA 1LNSA 1RYFA 3QI2A 4Y18A 1CEQA 1Y8CA 1L5YA 1CEEA 3AIMA 5TC4A 4PWYA 4URFA 2AQKA 1MGOA 3KYCA 3NONA 4WKCA 5TEVA 4ZMSA 3JATA 4P0PB 1EWKA 3GNTA 5JXWA 1H05A 2CNWD 4XI9A 3ZHYA 2NUAB 1N6PA 1P7CA 2HQBA 2W2KB 4B8ZA 4MUGA 2O5VA 2ZYWX 2VRNA 3F6BX 3IAHA 4P98A 2ZB3A 3RQQA 3ABZA 2ICAA 5KYYB 3SBEA 4EF5A 1YMQA 2JLZA 4ZVOA 1GKYA 1PF7E 1RLJA 1S2OA 1EX1A 1BEUB 3IDSA 1KDYA 3ZM6A 3QV1A 1C7JA 4B6RA 1FJGB 3B51X 4PZZA 4RULA 1ZJ4A 2NZYA 1JJBA 3ZK7A 1ZBQA 1FFXA 3NBKA 3CN7A 3C3EA 1XXHA 1Q57A 3PYLA 3GEMA 4MCHA 3SOPA 1HT1E 1W36D 4HS9A 3MUOA 2FQXA 3DAOA 4BCCA 1TXGA 2VQFB 1P7YA 1YOVB 2VPZA 5A6SB 2YV4A 4Q1FA 5EZYF 4GLOA 3R4CA 3Q3HA 3I34X 3OUZA 4DARA 2D0IA 2JFQA 3F78A 5LZ5A 1IJEA 2IHZA 4HXFB 5BYDA 2Q28A 3G6WA 1UKCA 4FW9A 4OQPA 2HA7A 2AMLA 4ZDJA 2BD0A 1Z82A 2VFAA 1C0KA 2JGLA 3QU9A 4P33A 5AK6A 1TF5A 1JU3A 2C3OA 3IOEA 1I4WA 1EDBA 2J6CA 2R8BA 2W2OA 1T9GR 1CIVA 2IOHA 1OT5A 4DW8A 3FMFA 3U17A 3IVMA 3H1PA 221PA 2VJKA 4HH1A 4JVNA 5FBWB 2JI7A 2PZLA 4S04A 3BAFA 1EKQA 2ECOA 4L8FA 4RZHA 2DH5A 2I33A 2I2WA 5JT1A 4QWWA 3CZ4A 1Z0AA 3KQYA 2XBUA 4G0XA 2HWUA 3NW9A 2C04A 1GQRA 3SDBA 3UWKA 1KF0A 4CKZA 3UHJA 3B1FA 1IHOA 4K6MA 3O9ZA 3QMPA 4YAWA 1EJBA 1M6NA 1T13A 1L5MA 4IDDA 5FUXA 1A4RA 3A8TA 3IT2A 4XYMA 3QENA 1RYHA 3OSUA 4HFMA 4UHFA 1RIFA 4MWDA 2Z3WA 2C9BA 3KJFA 1N9GA 4LY6A 2Q99A 4KFUA 5IDVA 4N6OA 1XOIA 3L02A 2RGGA 4M21A 4MR7B 4D96A 4K05A 1RBMA 1Z36A 3L1VA 2OHXA 4EGCB 2J08A 3ZNNA 2XH8A 1RWNA 2IHNA 2YXUA 4FEYA 4J0QA 3NCHA 4N5DA 3CH7A 3OSZA 3QJYA 1B23P 2RHMA 5DYYA 2D13A 5FAXA 2LP4Y 2C0PA 4GQIA 1C1DA 3ETCA 2PS9A 1UCFA 5GJBA 3D1JA 3U4QA 2RGAA 4PQFA 1K6MA 1WCV1 4JN6B 2UVQA 4N18A 3ZGVA 4TL8A 4FW8A 3WMRA 1COWA 1KS9A 4LVNA 2M1XA 2OV3A 3LGSA 2F55A 4OCZA 1LB1B 1T2FA 2VT6A 4MPDA 5IT5A 1G3IA 3BGDA 2Q41A 1H2HA 2CLCX 1Z0ZA 4QUAA 4WESB 3UENA 4CM9A 5IABA 2WTUA 2Z8XA 1E4EA 3HHPA 4ZO9A 4MUAA 1IIRA 1SZCA 3K9GA 3LH5A 3LFHA 4OXQA 3U9LA 2C9YA 3BE4A 3JCZA 4PX3A 3ZBQA 5DI3A 3JALA 4JI4B 1JLKA 1RXIA 3QFCA 5KC9A 5L7TA 4FGKA 2AVDA 4W7IA 2IKQA 3BJMA 3W5AA 3MOIA 2FR8A 1SOWA 3BA6A 1QNFA 3AIKA 3WLIA 1DCMA 4K1LA 4DR6B 3ANYB 1YI8A 5JAMA 1N6LA 3K0KA 2LKDA 5HKBA 5AVUA 4QVIA 1ZITA 1XC7A 3IAM1 4JUDX 2QIPA 5CT9A 4UPEA 2QP3A 2GETA 3I9NA 4DYHA 1VL8A 2H52A 1POXA 3E5NA 1TYCA 4GQAA 5FF9A 5BV1A 2ZPTX 1HQDA 4EGSA 1KKMA 2D5AA 5A4AA 1PJRA 4MVJF 5KQGA 1NKSA 4KZPA 3NWOA 1XJQA 1KZ9A 4C5NA 1LY1A 1X14A 3K6JA 1WE2A 5LUAA 1W85A 4DNXA 2DRIA 3N2AA 1RXCA 2Q1YA 4MI6A 4MQFB 4YLYA 1MX1A 2Q3DA 4AL4A 4HMOA 4PC6A 3CIFA 4WW0A 5H81A 5A4FS 2Q2VA 3H5RA 4X71A 3I04M 1UZNA 1KORA 4L08A 4UDNA 2FUKA 2J7PA 2ILTA 2WU1A 1GTSA 2ZYIA 2P40A 3AI2A 4F04A 2FQWA 3A1TA 2NPIA 3K6KA 4CVMA 5HR5A 3Q5DA 2WVGA 3H16A 1KOGA 2BOVA 3S0JA 1GAXA 1WB5A 3T3MB 4NCIA 4ZVUA 5KTNA 2ZSBA 3V33A 2B4TO 1QHFA 1AE1A 1RAFA 1XRMA 4IXNA 4RQUA 4EI9A 2ZIUB 5JDIC 5K4HA 1L7RA 1QHHA 1MDBA 5IM5A 3KUCA 2P9EA 4FQ8A 2CZGA 2C9OA 1PKXA 4FJ1A 4L78A 3TSZA 1VPLA 5J2UB 3NDBB 3RQXA 1ZN2A 2Q07A 2QMYA 4EKYA 5FA5A 5A3VA 3ZD8A 4GGMX 1S0UA 5GGXA 5TS2A 4FHZA 2JA1A 2A7QA 3PI7A 3BMQB 1KRWA 2AEMA 2HA2A 3ZCQA 1LC3A 1VJ5A 3EVNA 3WNCA 2CV1A 2RSLA 4JQZA 4CF7A 1BFUA 3LRXA 3HCAA 4JKUA 1L7MA 1NV8A 3B2EA 1WPRA 3PLRA 2CLDX 2JFWA 4J7UA 5F4ZA 4EX7A 5JCXA 2AJBA 1W19A 4Y2QA 2CC2A 1E7RA 4HEA1 3RSHA 5JISA 4GKVA 5CJ2A 3WKDA 4KV9A 2ZS9A 1FZQA 4JASB 4B3TB 2OP0A 3LP6A 3RFXA 1D0SA 4I2VA 4TS3A 1EVEA 2H4HA 2XUIA 4MV8A 3B48A 3DL0A 2BAGA 3RJ9A 1GL7A 4X61A 4CZ2A 5JYDA 1T1IA 1YS1X 2XUFA 2O4CA 1T2UA 1EX6A 4N1AA 2FR8C 1I2MA 2BGNA 3OIGA 2ZJAA 1B2LA 5EOVA 4LWZA 4E5NA 2GAAA 3QA3E 2NV0A 4WBNF 3NHZA 1EJ0A 1K66A 4EGJA 4CIDA 4TKVA 5F7XA 5K2OA 4WK6A 2QX7A 4TV9B 4ND6A 1CUWA 1GKUB 2WSSD 3ZIUA 4Q66C 2O8VA 3DE2X 3ENVA 4ARZA 1FFEA 2PV7A 2VRCA 1DI0A 1NRWA 2R68A 3EUEA 4RJKA 1E2NA 4WECA 2B7BA 2OD9A 1YULA 1H66A 3G9TA 4OG2A 3NV9A 3PNPA 4NBKA 4NI5A 3FSRA 1EFDN 2O2CA 4JT9A 3TOSA 1UC5B 1YE8A 3UQYS 2GN0A 2AOTA 4ZEXA 4QAJA 2XVXA 3F90A 2CJWB 2QM0A 3KUUA 1KP2A 2B0JA 4IUDS 4ZAZA 2ODBA 2QXUA 3IHKA 3NTXA 1LKZA 2O3QA 3TB4A 3IAS1 4C7JA 5H02A 2APJA 1X7ZA 3M33A 3C8HA 4QO7A 3LWDA 3H65A 4FCVA 1XK6A 2JFZA 2J41A 4W4TA 1LIJA 4IDOA 5DBFA 3SHWA 3FGPA 4DQDA 4ARVA 8AT1A 1GDDA 2DHQA 2K5UA 1BGVA 2VWGA 3MJCA 5JVDB 4J4TA 2O2GA 2Q9AA 3D5TA 3NPMA 4IFEA 4E12A 2V0NA 1PT9A 3LA6A 2PKCA 4UE2A 3IERA 4BEVA 2VYQA 1QQTA 4KO8A 4HK4A 4LBZA 2FEKA 2Q21A 3GQVA 1U3GA 4F71A 3G2OA 2XOKD 4B5LA 3Q2IA 1XTJA 2JCSA 4CMJA 1NUHA 4W5TA 3FOCA 4TV8B 3Q85A 2JAPA 2F1KA 4IIJB 4KQKA 4OP3A 2CLIB 3AINA 2CUTA 3NUZA 3K1YA 2X5JO 3UMMA 1RTKA 2DMRA 4GZ5A 5DHFA 1FF9A 3OAAA 4Z9FA 2XWBF 4ZZ2A 1SXJD 1PG5A 3DR5A 3L0CA 5HZGA 2ZJOA 4Q9LA 3SC2B 5EHNA 3EPHA 1M1YE 2ALJA 3JD2A 5BSKA 3QFRA 1T6ZA 1FX0A 4D8YA 4HV4A 3OPMA 3IIMA 1JKMA 3R0XA 3ISJA 1MQ8B 1U7WA 4X00A 5DSZA 4MGKR 3U3XA 2OOKA 3EQ6A 4LC9A 3ZWKA 4YAFA 4AMGA 4KQ6A 5LM3A 1GTRA 4ZIYA 3WYDA 2BGTA 4DLAA 3NGXA 4XDYA 1LFDB 2ADOA 2B37A 3PQFA 4K8PA 3LNCA 3W2EA 2B6HA 2GC5A 4LRUA 5DRYA 5F3DA 3V1NA 2OCGA 3O75A 2AK3A 3ZS8A 1SBYA 1VB3A 2GCNA 4KQHA 3R7LA 3VV2A 4LEIA 2XVAA 1BEZA 1WQ3A 1PQPA 4HDMB 1PR6A 4QXRA 1O6GA 4GBMA 4D99A 1E3MA 3M6MD 5K09A 5DHRA 5AQEA 1CY2A 4DNQA 1NE7A 5K05A 3PT9A 1FMJA 2X3FA 1AG9A 1WSDA 3VNUA 1XVLA 4MICA 4JYPA 2IPXA 2NOAA 3H4TA 4CN9A 3COJA 4TTVA 1I3CA 3DZGA 1E77A 4LBGA 3VJKA 1GOTA 4OHOA 4CR8A 3N6VA 1CUGA 3HEMA 4OJMX 4W1RA 1M2FA 1W96A 3MK31 4XWKA 3EF0A 1E2JA 3L7OA 1ZN9A 3UQ9A 4IWXA 4Q3CA 4D4JA 2H2HA 1U81A 1F0PA 3MYYA 5FOXA 4CLEA 4CKWA 3BH6A 4NNPA 3ZXIA 1RFVA 3WK6A 4BNXA 3SEFA 2XTZA 3UK6A 4NFHA 5FYQA 1HETA 5I4IA 1DADA 4RA6A 4WASA 1XQ1A 3BWDD 3SG0A 3LY8A 4A10A 4BO5A 4EKEA 2CZQA 2IKSA 5K7SA 1JFFA 1EU1A 4R7GA 1U8CB 4F4JA 5JD4A 3ORSA 1APBA 2RMKA 4GLFA 4XDZA 1G8PA 3S8MA 3T9CA 3LUFA 2Q7XA 3PKIA 3LYLA 3HN7A 5EE0A 1HO3A 1FE8A 1NFRA 5D85A 4QPDA 2O6HA 1VHTA 3V1TC 4O4IF 4KLRA 1QMGA 4F8YA 4Z9AA 3PU6A 3ZVKA 2FPIA 1E1MA 2PCLA 1SUAA 4BUCA 1YTUA 1QRDA 3LHKA 1JYEA 2A9RA 1FYWA 3CVOA 2I87A 4I0WB 3PD0A 2PRKA 2QJOA 1VP9A 2SKEA 5L3SA 5JD6A 2Z4RA 1EJ6A 2M6KA 1T9BA 3HZRA 3KLPX 5PNTA 3VUFA 3TBKA 2BGRA 1NDUA 1U9IA 1AGYA 5K0JA 3IQZA 3NIFB 4GZ3A 3ZI7A 1TYAE 3NEYA 3CG0A 2J7KA 2QSJA 3B3JA 3K4PA 3E2MA 3OE7D 3QGMA 1D2CA 4MNTA 5CYPA 4CLOB 3JATB 3KCQA 4DCOA 3SHQA 3V8VA 4DVGA 4J1TA 1RAIA 3OTOB 2WP0A 2HDNB 4E5YA 1J20A 1Y8RA 4AT1A 4Y6RA 1EFKA 1K8QA 1OWNA 2IT1A 1Z5WA 1Y4ZA 2QZSA 2JKYA 4NG4A 4P81A 2XLBA 3QKWA 5A0VA 1YCHA 3KR2A 4FDAA 2O06A 1MC4A 2J9XB 2BKAA 3I1FA 3AHHA 1W7KA 4MUJA 4PC1A 2QE7A 2P62A 2YQ4A 4GDMA 1XE3A 3CLKA 3PJFA 4H7PA 3EZXA 5JH7A 2HPZA 2NMVA 3OJOA 1T9GS 3NHLA 3UIEA 2CMGA 2JLSA 2QXYA 4ZALA 1G291 1FFXB 4G09A 3NM6B 3TD2A 4YCMA 1DAOA 1RRGA 1XSEA 1XXHB 2PGDA 1MHTA 2PT6A 2OB1A 4LZJA 4OATA 4OHWA 3BXHA 1JJ7A 2FEOA 4RESA 3ICCA 2DR2A 3R5HA 1A8SA 3FDJA 3OD1A 1IEXA 4YRZA 5L3VA 1A50B 3K9BA 4NCHA 1CY8A 1QPGA 2P8SA 3E3MA 3DMNA 3ZHBA 4ARBA 4UTPA 2H1OA 4MRSA 4LKRA 3FPSA 6GPBA 4UQLA 5IZ4A 3G2MA 1SIBE 1L7VC 4P3NA 3FIUA 3W78A 4DXHA 1PV4A 1YJ8A 4FZRA 1R7RA 1XZAA 2WT9A 3IILA 3BZUA 3K6RA 2Q4EA 3UK7A 4L0QA 1F2VA 1JKFA 1C9MA 4D9BA 1HT0A 4KR9A 1KSFX 4K46A 4UHCA 2RB4A 2R9VA 4MDHA 1ELOA 1OXUA 5FWAA 3RUDA 4D4KA 2PR7A 2QOEA 4H1HA 4JUIA 1ZSVA 3NEJA 1IJBA 1C9YA 3C6ZA 3LQ4A 3T1TA 4UBOA 1K5GA 2WDPA 2PM8A 5KYUB 4K26A 2FKAA 2BGUA 3GEGA 1U2EA 4H4DA 1OAOA 3HUUA 5FBLB 1BTOA 3IP5A 1LK7A 1Z0SA 3U7JA 4EMTA 1CRQA 3PQ2A 1FBTA 3IAUA 4ND7A 3UA4A 1XPRA 5JHGB 1CQXA 1FDOA 4AULA 1TVKA 1L5VA 2CJYA 4PYNA 2XMZA 3AR8A 3BOSA 2NO0A 4OK5A 3RIYA 1G8AA 5AESA 5CIQA 2NQ8A 4XM1A 3AQ4A 4X8MA 1QGOA 2QAGA 1SU4A 2PL9A 3IPXA 3KOZA 4Q01A 1HG0A 3RYTC 1N9GB 4Z2YA 2HWKA 3PNLA 2IZ7A 2WHRA 3VDNB 1KYZA 1V5EA 1PAUA 4Q3NA 1N5IA 1C3JA 4HDNA 1RQGA 1IL0A 5JLJA 5A7GA 1RVDA 2H1SA 1U9IC 3F8WA 3Q3JB 4IV5A 3WI7A 1MDFA 3OU6A 4WBSA 2C8JA 5FPYA 3NWJA 4PHCA 1C1DB 1EDZA 1Q1ZA 1H5QA 1VG1A 1UQRA 2HJSA 2KYRA 3CR3C 4WN9A 3JPWA 4NEQA 3BFJA 4ZVTA 3QWFA 4J1TC 2FCRA 2FG7C 3U4QB 2QR5A 4AY6A 2IYAA 4HAZA 4DBLE 1E94E 1XAHA 3AWIA 3BXEA 1SHKA 2PSEA 4OHXA 5K4AA 3WYGA 1FTGA 1USWA 2ZXUA 4BKPA 3U4GA 2I4IA 5HVNA 1ZI9A 3V7YA 3ZBPA 1E3SA 2R7AA 4IFBA 3RYIA 1E4EB 3R0ZA 3LCCA 1OLUA 1U80A 3E3OA 1L1QA 5DCWA 3VU1A 1RXVA 4Z0TA 5IAJA 1KVSA 1GGMA 2K4MA 4WVFA 3T7RA 3U1BA 1D5CA 2ZDHA 5HQ3A 1TZ6A 1Q44A 1ZNWA 3IQFA 3Q6NA 4LTDA 3ET5A 5DI3B 3JALB 5CUQA 1Y4SA 3TRFA 3C0KA 1DBSA 3LO8A 4HNVA 2SHKA 1Q74A 2O3RA 2HBYA 4H3VA 4NBSA 1NTOA 3IA2A 1UBEA 3VR0A 3PNYA 3AM4A 1RYZA 3S3TA 4C4XA 4XIIA 1PT7A 3FD8A 2QJWA 3R7WA 1WA5A 3VI4B 4DC0A 1J39A 2YQ5A 1XTKA 1XL0A 3GVIA 1W4RA 2WUVA 2QVXX 3C24A 4P4GA 3FSGA 4KFSA 4MMZB 4U7WA 2QCVA 2IYNA 2FUG6 1HY3A 5E8JA 5E8RA 3FM9A 4Y9RA 4KAJA 5J5AA 3VNBA 4F1JA 2GS9A 5T6MA 1E0DA 2GA9A 4NHOA 3BRWA 2W2PA 2F90A 1DQYA 3BUSA 3I72A 3NS7A 4JQOA 4QHYA 3J80A 1EI9A 1XPJA 3PWKA 3P0JA 4IGFA 2WZBA 3IULA 1V45E 4M46A 3SX2A 2ZIGA 1W85B 3I39X 3WZ2A 4EHKA 1GCAA 1TK3A 1ATIA 1OAOC 1M1YA 3BC1A 1FY2A 4XJVA 3RS0A 1KJQA 1JMYA 2NNLD 5FBHA 2IDZA 2JH8A 3TXXA 1XZNA 1PG2A 1ZQ9A 4XLLA 2Q5EA 4GOLD 1Y81A 2PXAA 5AKGA 4P38A 3W1WA 1Q3KA 4Y7CA 1LSSA 3GRUA 2W5UA 4YUZA 4KWCA 1PEKE 3DEIA 3U0BA 3AGPA 4BVFA 2IU6A 4RVFA 2AD1A 4QL3A 5U9CA 4EL0A 2COUA 2X3UA 1PLLA 1K9SA 3D8HA 1LIKA 1XRJA 3LOQA 4WA8A 1NPTO 5TGDA 1TT5A 2H5JA 4JXZA 2ZSIA 4O33A 3CM0A 2BBTA 1TYBE 2ID8A 2BUBA 2CXSA 4EGQA 3QA2A 1YS2X 1TCVA 1OT3A 2YXLA 2HI0A 4QDJA 1ZCAA 5DXAA 4D8XA 4ZV4A 4E69A 4HFRA 2FZWA 2J59A 4LE0A 2C7BA 2VN8A 1K7XB 1DX9A 3HCOA 1SUBA 4D4IA 1VE7A 3O8QA 4YCDA 5J2UF 5C40A 2Z09A 3T4EA 1Q83A 5CHEA 3IEPA 3R3SA 2O2SA 1MPXA 3IBSA 4J94A 4WWHA 3CV3A 4I4TA 5CXXA 4BMSA 2ZU0C 5KNCH 1DQZA 2Z2YA 4FE3A 2XD4A 1G3RA 1F6BA 4RS3A 5KYVA 1NYTA 5DVZA 3NRBA 5J4VA 2I0FA 2RHJA 2ST1A 2IK8A 2RD2A 1S89A 2QNIA 2XVMA 2NTJA 3WLAA 5ICEA 4PZ0A 5AVYA 3IKHA 2HSWA 3N2NA 4TTPA 3IVCA 4I4NA 4ZQEA 1ISSA 4B7ZA 4JSRA 4N47A 4RJJA 3VJLA 1PR1A 4QM6A 2P5TB 4LXGA 3EXG2 2FFQA 5LIPA 3TQHA 1THTA 2HU8A 1PWXA 3FIJA 3H0KA 1U7OA 3I5UA 1DZ3A 3CONA 1Q7CA 3AUYA 3HB0A 4D3YA 3IPLA 4M1KA 3F7OA 2C5AA 2IQ5A 2BL4A 2V7EA 3DJFA 4C7MA 4DA6A 3PXCX 4LCEA 4F11A 2JC3A 3WHLA 4EBFA 3F0TA 4TKVB 1QQ5A 1LPAB 5THXA 5TQVA 3NHJA 4RTLA 2GZ3A 2XXAA 4CV0A 2EX1A 3B1YA 3PCXA 1MD9A 2IHTA 4E2ZA 2TMDA 4TV9F 1LI5A 2PUJA 1AK9A 2D1YA 3CUWA 3IXQA 3LGAA 4G1MB 4ZI7A 3LC0A 3SGLA 1P17A 4GMGA 4HRXA 4K93A 3FTQA 3WLSA 4C5BA 3SMVA 4DCTA 4IIBA 2JFBA 3MGAA 5TF4A 3W7AA 2GO7A 2X1HA 4LF4B 3UAVA 3WGJA 1OFTA 2X2FA 2L69A 3DP9A 2JDID 2XYVA 3ILXA 3KPVA 1DKRA 3UVEA 2AOTB 2QMZA 3ZZUA 3RNLA 1A72A 1ND5A 3AHEA 2GPWA 1OKKA 3RVPA 2PLWA 2OMKA 5A4DA 2PSJA 3UBOA 5JPDA 1WETA 4E84A 3ZHZA 1OMOA 3KKZA 5JSUA 2NQTA 2GC6A 2YUIA 4M9SA 3K3PA 3CO5A 1X7ZB 2QMHA 1U11A 2J67A 3DHVA 1QS0A 4LJAA 3R7AA 1U4NA 3C3JA 4E1VA 1MO6A 4NR0A 3AL3A 1TADA 2ZR9A 4RHEA 3B3LA 2F3TA 4HBZA 1X3LA 4DWVA 1HE1C 2SCUA 1CY4A 2ZJ5A 3SICE 3O2QB 1F6WA 1P0FA 3R74A 4BC1A 1EE2A 3EFHA 3IKVA 3UUFA 2DX7A 1DIAA 4MWSA 4DDKA 1XZCA 4M0MA 4GYJA 4MVJH 4NYIQ 5E1DA 5K6TA 4C22A 2ZP1A 2VHEA 2LR0A 1VA4A 4HAWA 2EFJA 4H1UA 4YI3A 5BSFA 5ICCA 5LOVA 2YXDA 1KRHA 4PFSA 3UPDA 4F60A 1QX4A 3CE9A 1LBIA 3DHYA 3OFND 1N3BA 3DDNA 4LVUA 2WU0A 4P3OA 4EX6A 2JHGA 1W36B 1JHUA 3GJ6A 1C3LA 2WKRA 3TLKA 2PLFA 3SYRA 3MQ4A 3QEJA 3L46A 1P9OA 1XG5A 4TV8F 1YRLA 3C87A 1YA4A 1RYBA 1ZCFA 3FCOA 3LVFO 4IMJB 1PBTA 2YJ5A 4D97A 1NAHA 4JBGA 1B8UA 1E32A 1XJWA 3KB1A 2P2ZA 2Z95A 3FOBA 3BEOA 3AOEA 4Q34A 3PXGA 4E46A 1NULA 2ZYDA 3D0RA 4F8EA 1MVNA 5ISMA 4QNNA 2ON6A 5K51A 2I1QA 2AMYA 1BS9A 6Q21A 3ENQA 4FKBA 3WYEA 5JBQA 3IP3A 2H59A 2ODTX 2Y68A 1H2XA 2O0LA 4D8UA 1K8YB 5BSUA 5HUJA 2HLZA 4NFLA 1Y4DE 5I47A 3DBIA 3RTEA 1JA9A 1ULAA 3OLZA 2DBYA 5JCPA 3L4BA 4GRDA 4OSPA 1AKNA 1SK8A 2PKWA 5KQLA 3FX2A 4XF6A 1Y9DA 2D7CA 3R3UA 3RQ2A 4WRRA 2HPHA 1Y3HA 3BH0A 1R37A 1VLQA 2GVDC 3C5CA 3D8NA 1OWPA 3GAZA 5HIIA 1BWPA 2G5PA 1R6DA 2GPSA 1HC7A 3H3XA 5B7NA 4F8JA 4NULA 2EZ8A 1XK7A 3D3WA 4EWLA 4PYQA 1M8PA 2CL5A 5AKLA 3E9EA 3TGPA 3VPXA 3BMCA 4NARA 3DTYA 3LDAA 1UJ6A 3QWBA 4A23A 1RKSA 4UU1A 1SC4A 4AKIA 2DZDA 3AHJA 2O8EA 3GLUA 1SCIA 4DTIA 2J8ZA 3AP1A 3RTDA 4QE3A 3DONA 1RXEA 2JZCA 4DT1B 2EF0A 1DE0A 5MN6A 1ODCA 4LQDA 2XGJA 1GV1A 2QAJA 3AEZA 4CKWB 2RJOA 3EIEA 3RQ8A 1L7XA 3IX7A 1ES9A 3L0OA 3QHQA 4S24A 1XZMA 3E22A 4DEXA 3G0HA 4RA6B 1T9CA 3ER6A 1Z07A 4IQ8A 4W1QA 1V35A 4O2LA 1JFFB 3GCGA 1HUQA 1NXSA 1EP1B 5TY0A 3V1YA 3BEDA 4ZCLA 3P2IA 4DLNA 3E82A 3EG5A 5TSDA 3JULA 3CRW1 2GXAA 2XW6A 3TLCA 3BRQA 2FP4A 2YN2A 4KQFA 4XKJA 4S3MA 5I7AA 5LDDC 3MGBA 2B61A 2DDWA 2FWIA 3SX0A 2VDJA 5EP1A 3M6XA 2IUEA 1MO4A 1RAAA 1KIFA 2N0SA 2VHYA 3PB3A 1A9QA 3OZEA 1XPOA 4HDSA 3A2KA 2P3QA 3Q7RA 3VA7A 5JR3A 2GJKA 3EDOA 1VCOA 2YZKA 2HLPA 2YXTA 4ZOLF 4RQBA 1AY0A 4Q12A 3B3QA 4R71A 5T6BA 5BN3A 4PYIA 3DDSA 1U7DA 1YWGO 5CH8A 2HRZA 1C29B 4J3FA 4KDRA 5T5QA 3EW7A 4NCAA 1AGPA 1X42A 3PXUA 1R2QA 2J0EA 1LD3A 2WAXA 2H2FA 3FPCA 3HS3A 1Y8RB 2ROQA 1E5TA 2DOKA 4IDEA 4KJXA 3CINA 5CVCA 3P7MA 3S2SA 4GXQA 1H0RA 1IAQA 3GI1A 2HM7A 5J40A 2XTJA 1GNRA 3RSLA 3TSOA 4ENWA 1QH8A 3KX2A 3W2GA 1JIVA 4M8SA 4C43A 4D9IA 4PONA 1XJ5A 5IAGA 5JH7B 4N0QA 5HM8A 1H8ED 2AQHA 2GLXA 4F92B 1CUJA 2RH5A 3L4BC 4ISBA 3RAEC 1RJEA 5AD1A 1YV9A 2WJPA 3UGJA 1EEXB 3UMFA 3ZZNA 4NXMB 4NG5A 3N2LA 1N7IA 2QZ4A 2WKSA 4KI7A 3UNXA 3V6LA 2PX4A 4E5UA 1ZU5A 2JVIA 1SURA 1OFGA 2PR2A 1MLDA 1V3QE 3F9CA 2Z6UA 4UW9A 1PFGA 4FMCB 5HRAA 1FTWA 4MS4B 4IYJA 1JPNA 1SMKA 3MJVA 2RI6A 1QV9A 5K0CA 2IFTA 5CA1F 3FNRA 3K8ZA 3OJEA 1OTYA 1SK9A 2YVLA 4PGAA 2QA5A 2V59A 5JYEA 1ILEA 3CPJB 3JVDA 4J49A 4QUEA 1KIMA 1X13A 4J7AA 4DBLC 3EUAA 4FCTA 1FYEA 1NUPA 2LRHA 5EJ8A 2BCJQ 4IDBA 4XJSA 3K5WA 4F4UA 4I1PA 1K2VN 5EHGA 1O0BA 1P2VA 3RRBA 4QU5A 2NSYA 2BFNA 2YY6A 5H4GA 1J56A 3BJZA 4E4RA 5T64A 4XRRA 3NEPX 1ZI6A 3R5TA 4IV8A 4ZT2A 2JI6A 1J49A 5LQAA 4GOMD 5H5JA 3TM4A 1OX6A 4LF9B 5AI0A 1AXGA 1XQWA 3HHEA 4RABA 1OLOA 3D7KA 4FKMA 5EWJA 4O2BA 2HV8A 1JQ3A 1TVKB 4M88A 3GFQA 4Z0NA 3PQDA 4F4HA 5ALHA 2DXIA 5HJ2A 3G0GA 2Q5FA 4HXGA 1XDZA 4RK7A 2XTMA 1RZRA 1XQ9A 4RVSA 4YJHA 3U5TA 2OHOA 5A2GA 1T5SA 3USZA 5JQGF 3KLNA 3HXQA 2B99A 3QW4B 5D8DA 5ALIA 5EP4A 2MOKA 4D3XA 3VZCA 1FFDA 4HDNB 4PXAA 4WZAE 4XVUA 2PXHA 1U0BB 3AI3A 2GJ4A 5EL0A 2P91A 2V6MA 3NBQA 4ENRA 3IQWA 5G0VA 3MHPA 4BJ6A 3GVXA 3AVOA 1UC9A 3ABQB 3QOXA 4WN9B 2GBPA 4EL5A 1TECE 3HPQA 3SR4A 1IVNA 3AEUA 3R20A 4TVSA 2WU8A 2XMBA 3MBOA 1VPEA 5IDWA 1WKCA 3O8BA 2AC2A 2PG3A 1C4OA 2RI0A 2J85A 3QMMA 1RRPA 4BWVA 1JXAA 4Q9IA 1TA4A 3VU9A 3WLRA 3X2SA 4E07A 2AN4A 4IO0A 5EI5A 2AMVA 5K0ZA 1YXMA 4PO3X 2WJYA 4OKSA 1KZYC 4E11A 3X2EA 1K3UB 2SKCA 2JARA 3O92A 5I3CA 3GFPA 3ZDQA 3QKRA 1KMNA 3RYIB 4ESVA 4BB9A 1OLUB 2BZGA 2EWMA 4GU5A 4M1EA 1XEWY 1B6SA 3AG6A 3GD7A 4P0QB 3OP4A 3SXJA 4M7PA 3UYKA 5HQ3B 3ELYA 5KREA 4BHTA 2MCFA 4RTSA 2PPLA 4Q7MB 2C2OA 3WNZA 3QVGA 3PC2A 4GM1A 2IXGA 1M0SA 2BFEA 1QIIA 3BTOA 4JXJA 5HF6A 3AZPA 4ZYZA 3HFRA 1FSSA 2DHDA 4H35A 4N6NA 4QXQA 1JEQA 1NZDA 1P1IA 3ODGA 1JDZA 1XZFA 2ZLBA 1OPXA 3FZNA 3R7WB 4DQXA 4N8EA 3IP6A 1L1RA 3F9IA 4MINA 2RAPA 4Y2XA 2A94A 1SCBA 1ZIOA 1ADJA 1D1TA 3QF7A 5EIBC 1TEZA 5C7LO 3WWCA 2P4EA 4H7JA 3CG4A 2HD4A 4FNMA 4MKGA 4MV3A 3UJBA 4IEFB 1PEYA 5BR7A 4CLXA 5AFSA 1UMDA 2I2FA 3D7MA 1D7AA 1GUAA 4MV5A 4ER6A 4F46A 3HUEA 4ZHSA 4ZO4A 5A1JA 4BJ1A 2EQAA 4HLDA 3AEKA 2VP9A 2J3IA 3HGTA 5ILQA 5EE9A 2ZTSA 2JEZA 3H6HA 3RVSA 1ZJWA 1P77A 3M1LA 3OUUA 4D79A 3QAIA 4R01A 1DAKA 3LS2A 3A32A 4GLJA 2FK8A 1DINA 2Q49A 1GQQA 3A4LA 4NEGA 2FZLA 4E33A 3ICQB 2AFRA 2I6XA 3AFHA 4D4HA 2QY9A 5IC4A 1WABA 1GZ4A 4M8KA 4ZVNA 1XVVA 3S2FA 3F6RA 1X8LA 2B5WA 4AJ1A 2IY7A 2QQEA 4Q4JA 3L84A 3DFMA 1FBNA 3BWBA 3FCUB 4HUQA 4CV3A 4QXMA 1TT5B 1AK1A 2Y05A 4UDYX 4MKRA 5EJ5A 5CM2Z 4PCLA 3SZLA 4Z9YA 2YV3A 3MBIA 1N3YA 4WKGA 4I1RA 2SECE 4B5KA 3ZXSA 4B73A 1IATA 2Y2VA 3V2UA 4WUTA 3NMUF 3AR7A 3O8QB 3MD9A 1ZU4A 2VSNA 1NVWQ 1W1WA 3GLTA 3PDHA 5C34B 4BMVA 4XWTA 3ESXA 1T36A 3TNYA 1AJEA 4CMHA 3EDMA 1OIVA 4WJZA 2ZS7A 3JARA 3U4DA 4I4TB 3TFOA 4X85A 3CF4A 3QEBZ 1I7NA 1A9YA 1K97A 2O9JA 4FFBA 2VUIB 4JL5A 3UBMA 4E3ZA 1OB5A 3D6JA 2GF0A 4NOLA 5CX1A 5TPZD 3OOJA 4KO3S 3DB1A 2J33A 4MDYA 2IIQA 5KTPA 5L6LB 2G4LA 3C41J 4ZT3A 1RC8A 2YWHA 4K9RA 3JQGA 1SQGA 3PNQA 1V5IA 4UMFA 1T3SA 2HEGA 3W7VA 1ADFA 3EH2A 4WXEA 5ALZA 4TWRA 2GEBA 2GNAA 4RETA 1NV9A 4X90A 4EKGA 2FVXA 3JQ8A 4GMHA 2GUWA 4FEAA 4UEQA 1WNFA 2ZSDA 3OLWA 4R54A 1HRDA 3O84A 1DUIA 3LG2A 3I9OA 4UNPA 2VBIA 5DDIP 3OOEA 3EDRA 2YHSA 3TNFA 3OP1A 1GNLA 1PZMA 4FD3A 5EIXA 2XXAB 2ZUVA 2JF0A 2RJNA 3HUFA 2HX1A 3NWEA 3ZY6A 3RADC 1T3TA 2O5CA 4RHTA 4JJ7A 5JNUA 1BIFA 4S1PA 4G0MA 4ZI7B 2UYHA 1J2EA 2PKFA 4IWNA 2V7QD 3QLJA 3LYUA 1KI2A 4TWIA 1JJAA 4PPGA 5G02A 2WAMA 2TMKA 4PM4A 1E4YA 1EFCA 1AF7A 2QVBA 4D0LB 1TU0A 2Z08A 3EIXA 3NOQA 4F3CA 1QAOA 2PNFA 3KTAA 5C8YF 3NI2A 1V5FA 4UU7A 1M6EX 4JEIA 1E2UA 2W2LA 4C2TA 2HDHA 2LKCA 3R3HA 4XD2A 3KFVA 4F3NA 1RR6A 4EOHA 4YP9A 5BNZA 4BYGA 3E48A 4NIMA 3QXSA 3AI7A 4S1WA 3R7FA 4FTWA 1GNTA 3DC7A 4RLFA 2D2VA 3GRAA 5AOCA 3HZZA 2JRLA 3PDIB 3E2PA 2P2CA 2G1PA 3LVRE 3K8QA 4ZWNA 2FDCA 2QUZA 1RZUA 3TXAA 4MCAA 1JFLA 4UOEA 3VHRA 3MWGA 2SCUB 2PVSA 3G9XA 3IE0A 4JLVA 2R1ZA 3SLKA 4LOHA 2JK0A 1ESDA 5FOTA 3CW8X 3VTKA 1RD4A 3A6JA 1J0DA 2ZSFA 1FTQA 2V6FA 3OEHD 2V4ZA 4Y2HA 3LTNC 3AILA 1UT6A 1P9LA 3EVZA 1PT5A 4JLUA 4MQ4A 2F9MA 2VZ0A 5LOVB 3TW8A 1A97A 1KKUA 2QTZA 2CBXA 3D5EA 4LMPA 4QDIA 1YU6A 4Y2GA 1XU4A 5JAOA 4ZXFA 4F45A 3FKSA 4Q9AA 3O8NA 4CDMA 1FQKA 2OM2A 3HH8A 3T6KA 3ZQ4A 1ML4A 3N2ZB 3UHPA 3ZD6A 4CQMA 4RTRA 3B1JA 1YQEA 3K0BA 2CDNA 4QTZA 4MLDA 3T7DA 1ILWA 1GUFA 4NAUA 4BV9A 5CFNA 4JI7B 1T9AA 1ZOOA 2PRSA 5AUQA 3TPFA 1NU6A 3VR1A 2AE1A 5CNKA 1T24A 5LZ8A 2VTKA 3L7KA 1XTUA 3V8BA 2MT9A 1E1DA 3AO0B 2WNIA 3OBIA 3CXRA 1M2EA 3OQMA 4KPYA 4RVHA 2II6A 4B09A 3GBPA 4K3UA 3P2JA 3WHPA 3PFWO 4MVJG 4GPTA 1VE9A 4O4LA 3MFYA 3ZE8A 4JBIA 3A70A 4BJHB 2AF4C 1P2GA 3MRTA 1Z83A 3VZPA 4EARA 2ZJZA 3OQPA 4NICA 1ZH6A 1I1QB 1NY6A 3R3YA 4WZAA 1YJXA 3D3WB 4XD7D 2JNWA 3HYCA 3M1AA 2W6PA 4PYMA 4DM3A 4AMUA 3PEVA 3PXAA 3QE9Y 3TQIA 2FPPA 1QYXA 1YL5A 1ESCA 3KJQA 3TQSA 3NZEA 4RPLA 2XGGA 4BUZA 4MKHA 5AXCA 3UK2A 4K8KA 3T1VA 1NQVA 2C5HA 2I3GA 4GWKA 2O8EB 2FVYA 3U19A 3NFYA 1MOSA 3RJZA 3N86A 2YZMA 1A76A 1BWQA 2PO7A 3PF8A 4G1UC 4WGGA 3ZU4A 4DC3A 2RI1A 1JTFA 3SC4A 3WZLA 2O2HA 3EZFA 4KRXA 4RKFA 3NR2A 4QFMA 5BUCA 2AUTA 3T5BA 3NHUA 1EGMB 3MCAA 4HX5A 4LYYA 3TXYA 2Q5RA 1DRUA 3E22B 1Q1QA 3LIPA 2RHHA 5EJFA 3OZUA 5G4LA 4OMCA 2P68A 4DYVA 2GF9A 3GDHA 2I6GA 1N7JA 1FP6A 4XQCA 1TO2E 1YZHA 3P4YA 4M1TA 4AF6A 2FMTA 2HMTA 3GT3A 3T95A 1YFJA 3NO4A 2QG6A 1OB2A 2Q7DA 4F4FA 4MP3A 5J2TA 1JE0A 2FP4B 1AHHA 2O1XA 2AMFA 3N3BC 2JLCA 3OUTA 3FRJA 3IN1A 3B38A 2I6QA 5CGZA 4R3UC 3NTQA 3OQIA 2WVJA 2D1RA 3CR7A 3LC2O 1E62A 5FPSA 4Q37A 4HDSB 5A9TA 5SYNA 5CEFA 3H8VA 1QO0A 4AMVA 3V4SA 5CDFE 1FNSA 3BB4A 3H8SA 1XBTA 2A9FA 1NQUA 2AXPA 2WTBA 1EK1A 1IOVA 1Q6ZA 1CX9B 1SBCA 2LIPA 1XFAA 1L5SA 3EGXA 3FHJA 3L9WA 3LL4A 4M3NA 4C4YA 3HPDA 3W1VA 4N82A 4WFQA 5BN3B 3ROTA 5F11A 3OIDA 2C07A 3ZIAA 4H16A 5ALMA 2X8WA 3H3FA 1PVVA 3OURA 4JSYA 4M99A 3TVDA 3G1WA 2FHPA 3QPDA 1D0VA 3CF0A 1CV2A 2AG1A 5TQJA 3TX2A 4P93A 4P2BA 521PA 2FOXA 1I4OA 3LLCA 4QREA 3S27A 3LHIA 1ZBDA 3PUHA 1U0OC 4PLPA 5ILGA 2ARKA 2C8LA 2GZMA 3B7WA 3OD5A 4NFSA 4IMPA 1PFYA 3T61A 2IYEA 3CGWA 3N58A 3X1ZA 1Y3CE 4BZXA 5IJ0B 1QH8B 2UYGA 4OBEA 4KL8S 2V5UA 3WLNA 5I7HA 1NXPA 3PFFA 4G4SP 2ZM6B 4JJ8A 2GX6A 1N2IA 2I7TA 2WUGA 1G7TA 3MMZA 3JVVA 1OIXA 1BROA 3PICA 5JH7F 1EHIA 2BRUC 5AOAA 2MJLA 3D6VA 4X3OA 2EP5A 3UGKA 2YRFA 1Y7PA 3HZHA 1H2BA 1Z6QA 3QU7A 4GOOD 4N7JA 4G24A 4Q1CA 3QYPA 3IALA 4HPWA 1P31A 3CZQA 2EWVA 3IRVA 4JGGA 3AUUA 4KWEA 4LVCA 4B3XA 1QDEA 4LRTB 4R0VA 3RUEA 1R00A 1KC1A 3Q0TA 1GUBA 2GM3A 3HXMA 4YVFA 1ZMRA 3HA7A 4HNAA 1P2TA 1PJCA 1ZJJA 4RPIA 4AKSA 3F3MA 1VJGA 3O4IA 4DM4A 3RVNA 4E15A 3SC6A 4FHFA 4R2WA 2OFXA 5AKIA 1ZKDA 2V65A 2W6CX 4MV0A 1EK5A 2IOFK 4BEBA 3PNBA 4UDXX 4ZCQA 1NP6A 1PIWA 3B13B 1IEQA 5AW2A 2Q6OA 4EG7A 4JLKA 5F3RA 4CM4A 5HCNA 2CLEB 4K8OA 5FLEX 3RKUA 4E03A 1BD4A 5DWDA 2IUSA 1UBCA 4YS6A 4I8IA 2O3JA 2RGWA 1TKCA 2DERA 4JP2A 5M34A 2JEOA 2ZJFA 1ZHFA 4KUEA 2CNWA 2RJ3A 4O2BB 3C3KA 1HI9A 2VXBA 1IPFA 1B3BA 4JVMA 3UMVA 2ATEA 4DJEC 121PA 2RHGB 4IQGA 1V25A 3RRYA 1NPDA 1L5HA 5E9AA 2NP7A 2ZW9A 3WZMA 5I9NA 1ISHA 1VSQA 4YJHB 3LU1A 4IXDA 2Y9PB 1VL5A 4U6NA 1U8YA 4XA8A 4DREA 4ZTZB 4LJ9A 1F0YA 3KZHA 1WXEA 2ZIVB 5DB4A 3WK7A 2ODAA 3FBWA 3QPVA 4XIFA 1VC2A 3N28A 5AJYA 1QHGA 5K3AA 3ZN2A 1MFZA 3QFHA 5JECA 3I0MA 4YQYA 1NHGA 3BFPA 1QIJA 3U0VA 3WGHA 4YCSA 4UEWA 1B14A 3FVTA 4U5XA 1JYFA 1D9XA 1LCIA 2JLQA 3KVOA 1IN5A 4L8WB 2AJ8A 4AMZA 4CCYA 3QLEA 2B25A 3TZKA 1WXXA 2AG6A 2FPRA 4MQ5A 1V16A 3RRFA 3AEUB 4D8VA 3CEPB 5KKNB 1I1OA 1RKUA 1R50A 4PYRA 2GLTA 3E7PA 3SR3A 1FLDA 2FW1A 2RKOA 1RAHA 5FTKA 2I54A 1F9EA 3JTMA 2Z4TA 4PHHA 4XXHA 1OBVA 2P4UA 3H5IA 4FQ7A 1SO8A 5IDYA 4RMJA 4LJRA 1UH5A 1U1DA 3V2IA 5I5EA 3ZHSA 3D8BA 4DXAA 1L7PA 2OP1A 2C2ZA 1Q0RA 3QKRB 4D41A 4N54A 1DC6A 5IC5A 1WW2A 1BJTA 2H3HA 1SXJE 3EEYA 4COOA 2VNJA 1DQRA 4G85A 3ZM5A 3WISA 3JYLA 2FZ4A 2VSOA 1X77A 5ELXA 3CUVA 4GGOA 1ZMXA 3Q7PA 5FB3A 1RYDA 1ZVQA 4X20A 1CUIA 1L9KA 3IA7A 4A3SA 4YL5A 2G77B 2BFEB 4TL7A 2QROA 5E38A 1G3UA 3H9BA 3VPSA 3OM8A 2IVFA 3PPIA 1WR8A 3ZGZA 3Q10A 2R751 1CVIA 3HO8A 3A3OA 3ZH9B 4BFCA 2LDBA 4D44A 2B8EA 1R6VA 2OENG 3H9EO 3N0XA 4D9JA 1ODSA 5D01A 1YBFA 2E21A 2GN6A 2PTGA 3MJEA 4JR1A 2MSEB 3OF3A 5LLSA 1A7UA 1L8OA 1S2DA 2PD6A 1KQNA 2PZEA 4MV6A 1UMDB 4JKYA 3GH3A 1AK2A 4FT4A 2VHQA 4OX9Y 1VLVA 2AYYA 1IY0A 3LC1O 3TPCA 3FAKA 3TW4A 3OX1A 1G4UR 1T5TA 5C51B 3IE1A 2DHRA 1FSPA 2BMFA 1DEHA 1DC5A 2V0CA 4MITA 5SICE 4B3DA 3WLMA 5BVGA 1E8DA 2GUGA 4QBKA 4U6QA 4CCWA 1U3WA 2JAXA 2JFXA 1CQJA 2UZAA 3GLRA 5C3MA 5C7OO 1P0CA 2Y27A 5FA8A 1A04A 2PT9A 4IRMA 1UR5A 4QUDA 5IZCA 5K8IA 2C29D 5KQMA 3LLVA 1Y42X 4NZYA 4M37A 5DX8A 3TD6A 4BP9A 1KH3A 2BM9A 1ZVMA 4JCOA 4AF8A 2ODPA 4D5GA 4Q4JB 1SAYA 5FUVA 1F8UA 4HUQB 4F0JA 1E66A 1GEGA 4J9UE 3KC2A 3ELUA 4R8VA 1ZNQO 3LQYA 3O8OA 4R8KA 5GOZA 4B2YA 5BMVB 5IH7A 1GLVA 4Q03A 2F3SA 4D3ZA 1QRUA 3SKXA 4DJTA 2JGAA 1K7FB 3E9MA 4WY2A 3LVQE 1J5EB 1W36C 4EZIA 3HJ6A 1KE2A 1J07A 1BA3A 1EZZA 2W8BA 3JD0A 4YGYA 5FBZA 3RTBA 2I7VA 4C4AA 1SELA 1R0WA 3UWSA 1QPZA 1T36B 5AXBA 4XUEA 3JARB 4ZYWA 5BV7A 4BZPA 1VIMA 2OCAA 2NX2A 3WSWA 1NAIA 2AOVA 4FFBB 5J9FA 3KD6A 2J0SA 1AO3A 3ESQA 2OXRA 3GT7A 3D4PA 4I4TF 3H5AA 5CX1B 1ZKMA 3B9QA 3U2QA 3WNQA 2QT0A 4XYLA 4J6FA 5K0NA 3I6IA 1E20A 1NN1A 2QX4A 3GGCA 2VUTA 1M8FA 1C0LA 1WLSA 1RE0A 4K9CA 1AKWA 1E89A 1QUFA 1LSOA 2Y4OA 5IAKA 2VUSA 3RBAA 3RC8A 3ESZA 1OY1A 3DOEA 3DMRA 3WQHA 1C1HA 1WMBA 2DUMA 2ZYSA 4RPJA 3UEOA 1J97A 3KSBC 1WKBA 1RTTA 3N8GA 2ZCUA 4IS2A 2HOQA 5HA5A 5E0KB 4EG6A 3A4YA 1LRLA 4X93A 4B3HA 4R0MA 5B7GA 1HBJA 1E9BA 4GX1A 4KV7A 2JIBA 2NYAA 3KG2A 2V3VA 4M98A 4QJBA 2HJRA 4TSFD 4CL0A 4QQFA 4RVNA 1D7OA 1NBEA 1TQDA 4YUYA 5CDFA 2FGKA 2IS1A 1SBIA 3C7KA 1NBOA 1WG8A 3MJRA 2DCUA 2AB8A 3DGEC 4PF1A 1WF3A 2JG1A 4O63O 4C0HA 4EN4A 2X2OA 3T34A 5IVHA 3L07A 4ZI7F 5BUZA 5CFZA 3V3KA 4AP5A 1TFUA 4AG5A 5LD2C 2C4UA 4FSXA 5AM1A 3QKUA 1SVWA 4TMYA 2GEUA 2NU6A 2ENUA 4S35A 5TMEA 3U4AA 1QVRA 1XROA 2DUWA 4TM8A 5ALLA 3WWOA 3KUXA 4TPKA 3NHWA 3KTAB 1HDEA 1OAKA 4WNYA 5KKAA 4LUCA 5EGNA 4XVCA 4JOSA 1L5WA 1RWVA 4I9NA 3DAPA 4D3DA 5EE3A 3ZV6A 3FBGA 2VJMA 3MS7A 1FRNA 1GU7A 1VE6A 1UK9A 4BMXA 3UJHA 5IZCC 1M1NA 2XYPA 4PO8A 1ZUIA 2ZROA 4J90A 5FBVB 4UUOA 1SOAA 3M81A 3V7UA 1QOPB 1CHDA 2D8MA 1YR7A 2EJCA 2G9VA 3LL7A 3EC2A 2PZKA 1N0HA 3T3PB 1PZEA 5EHZA 3W5UA 3CKKA 3WIVA 1N1GA 1NRIA 4HGRA 4M55A 3RC2A 1HOXA 3PIRA 4EECA 1UQTA 2BEVA 4ND3A 1LQUA 1Z6GA 4J0JA 2WU3A 4EHIA 2GNOA 5KIAA 5KOYA 2VTEA 3U60B 4DLZA 5ICFA 4A92A 2C03A 2PIAA 4IUYA 4AN4A 3FFAA 5HBRA 4RV9A 1KJZA 1RCUA 3BFKA 3QXCA 3GGGA 4R8SA 4BLQA 5KBYA 4TWJA 4EGAA 3ED5A 4TLEA 3TW8B 1II0A 4C07A 5IAOA 4PGMA 5E7JA 1ZUWA 5LOVF 4V24A 3EUWA 4V39A 3Q1LA 2MTBA 1Z5PA 2R8OA 2WJZB 1KWKA 2WSSA 2AZ4A 2BE9A 1MQ9A 4FC7A 1HA3A 3PYMA 2GFIA 5IJWA 3OOYA 3KKNA 4U0JA 4HDAA 5DW0A 3TNLA 1FXSA 1EM8A 3V8RA 4CQMB 1NP7A 3AG5A 4B43A 2JG3A 3STTA 4H6XA 4R2JA 1OIWA 1Y3AA 4TYMA 5AVVA 1ID8A 5F12A 3ROPA 3OICA 2GTPA 2PMEA 3PVCA 2XTNA 3GD5A 3NTOA 2I03A 1Q12A 5IEBA 3F96A 5H0IA 1S4MA 2OFWA 1YT5A 4F3TA 1S7CA 1YFZA 3EWSA 2YNMD 4GYWA 4L4XA 5HFNA 3VC2A 2HLDD 3NOVA 2QQ5A 1W6UA 2FMUA 2VRBA 3UT0A 1HOTA 3KWFA 4EI7A 4OLFA 3TUIC 2HJHA 4O4LB 4YIKA 5KPJA 4A15A 3EQ8A 3O7MA 1XA4A 3A6EA 3QWAA 1GPYA 4LI0A 4P3KA 1TMOA 2I1VB 4WZAB 4YCAA 1BVHA 1Z13A 1IEWA 3C74A 4OK6A 1Z2NX 5CXSA 1YBAA 4E5SA 1MIOA 3OOWA 2FPPB 5BRAA 4JJZA 1N6KA 3GDFA 4J9VA 4WLEA 2IXFA 2REBA 3AEYA 3WLTA 3OI7A 1VHDA 1NMEA 5AW5A 3MS2A 4LISA 1X8JA 1T8TA 3K8YA 2BFWA 2Q6VA 2EATA 3DVQX 4MVJP 5A71A 2PUEA 2NV6A 2Q5OA 4G6ZA 4QFBA 5FFNA 6YASA 2ZJ2A 1CUCA 3A1WA 5FDFA 4NPAA 2X13A 3EQ7A 5CGAA 2DB3A 3RJTA 1TJ5A 2FW6A 4D4GA 4JH0A 5HPYB 3C3XA 3H5NA 4AWAA 4OX9B 1Z6YA 4RNCA 1AOXA 1SXJA 5LQNA 5CT8A 3TMYA 2C9DA 4DUPA 1ZW6A 3LM8A 5CFPA 1KDOA 1SBHA 3BGWA 5J2TB 3MAGA 3DRWA 3I58A 4U5QA 1Q0HA 4QLOA 1T9DA 1UXHA 3EGEA 4NRDA 3FG9A 4OU5A 4JBHA 5DNYB 4EA6A 4LJ8A 3OQIB 3IOBA 2VJBA 4DV4B 4IZHA 2WT4A 2NT3A 2BSAA 3FRHA 4QDZA 5DKFA 4CEIA 2HJVA 1WDTA 3KT3A 4MAFA 1X8KA 2J5RA 5LYYA 4F9FA 3H87A 4FMDF 4ZCPA 4DHWA 3EGXB 5FLYA 1BNCA 1U0JA 4JKOA 3HJFA 3V32A 1D1SA 4B6FA 4BNZA 3DZKA 1IN7A 3SSOA 1QHIA 3VAYA 3S70A 1VTKA 4JD5A 4Y3UA 3TRJA 1H3EA 1BC5A 2XIJA 4XWGA 1R9MA 2DLNA 5CNMA 3UXYA 3WOHA 4B4UA 1VLMA 2VJAA 4GXTA 1HNWB 4JJAA 1TRKA 3LX4A 4L5IA 4IF4A 3RVJA 3D7NA 1RJ9A 3DL7A 3OJXA 5HEKA 3SBOA 3U81A 2IU0A 4B33A 4EPVA 4Z7NB 5A6VA 2G04A 1DCKA 2I3ZA 2Y1EA 4QUBA 2R0QC 4TLDA 1LI7A 4R68A 2WSBA 2FSIA 1GR1A 4V0QA 5ALYA 4CM1A 4E08A 2EZ4A 2QBYA 4TKLA 3DM5A 1GT6A 3SX4A 1P4JA 2OG2A 3OMLA 4GSKA 2N46A 1Q84A 4HWKA 1WZIA 3D1LA 4CKBA 3H4IA 2ZBRA 1Q0ZA 2P41A 5KSOA 2QX8A 3THOA 5L40A 4IBOA 1AGNA 3UO8B 1EKKA 2CN1A 1T0JB 3DAFA 5JMPA 4D9MA 4EIWA 3HG7A 1CULC 3QVUA 2BGKA 3SSNA 3PPWA 1KFEB 3SJZA 4LECA 3M2PA 2QT9A 4U7GA 4QX6A 3WAGA 3G1TA 2FQ1A 1DKPA 3G5UA 4FFVA 4KP7A 5T57A 5TX7A 4AO6A 4TS9A 3CVYA 3DZVA 2IEYA 1PWZA 1OYVA 2ZIZA 2CW5A 3GJ3A 2YJ6A 4WV3A 2ZE7A 5F77A 4UATA 4DG9A 4RD0A 2ZQZA 5IUNC 4HNAB 3NRCA 4L8GA 4JWTA 3LDHA 4LHVA 4O5OA 4RJ2A 2VJOA 5GV8A 5B58T 3RREA 3E7WA 2FCAA 4CF4A 4BBJA 1X9IA 3PQEA 5CDGA 1VXOA 5BWMA 3P97A 1TAHA 2R85A 1TTQB 5U4QA 4KQWA 5C3UA 3GAFA 3WQSB 3P8ZA 5JBIA 5IARA 1JX6A 1PK9A 4B3BA 1K89A 1XL1A 2P11A 3T0IA 4CM4B 2E82A 4FSHA 1C5KA 5B4VA 4DJJA 3KHUA 2GERA 3GG9A 1EBFA 3OE7A 4K6OA 4E32A 4MLCA 3TZCA 5IM4F 2R3EA 4FOTA 3R9KA 4X1IB 5CEEA 4K9KA 2GYWA 1Z45A 2H0QA 3DKVA 2WF7A 3ACDA 3H0CA 4I3GA 2FPXA 1DGQA 1TUBB 1THGA 2YDXA 4CMEA 1TF2A 2HRDA 2VPTA 1NC3A 1ZD4A 2FSHA 2BC9A 3O1JC 4O2BF 2WA1A 4NYMR 3PE4A 4OF4A 2Z0MA 1N5LA 4TXHA 1VI2A 3Q12A 3ZC3A 5F2NA 3HK2A 4YRDA 4HYQA 3ZZ0A 2G28A 1BYUA 3ROQA 1JAXA 4RFLA 1MH9A 4YMSA 3RAGA 4AG6A 4LIPD 2NXEA 2HSEA 3P5SA 2OHIA 1TT7A 5JEDA 3U3JA 4MUBA 2C0QA 2WB4A 2WKPA 3KYJB 3O21A 4QHTA 2Q6LA 4M1YA 4QVGA 3SXUA 3ZE0B 3L6BA 4ZV7A 2WIAA 2VPQA 4B6QA 4TKZA 1ZR4A 2BDEA 1K98A 3B1NA 1JDUA 3HLTA 1YQWA 4YONB 1V16B 4AUKA 3DDZX 3KT0A 4DQ0A 2CSXA 2G63A 1LVUA 1CF2O 1XB2A 2BI4A 2CJFA 4XWAA 3ZLVA 1TB4A 2IZ1A 4FYJA 5KEIA 3JZFA 3DXFA 1SU7A 2Y71A 2FHSA 1JB1A 1NNEA 3GO4A 4E5VA 2UVPA 3C45A 2P9ZA 1I3NA 3W77A 3S2UA 2Y1FA 3PA6A 3G8YA 2PGAA 2JPDA 3NRJA 3CVXA 2NU8A 1JU9A 3UMCA 4ENQA 3I3YA 4PGHA 5J59A 4PR3A 4CF6A 1ZJYA 1IHDA 4JC0A 3PPVA 4UVDA 4ZAGA 5JI2E 1U7XA 3NAQA 5D84A 2Q3BA 1J0BA 1NW6A 3GFVA 3GY0A 4M86A 5A02A 2R3BA 2RB5A 1Z7EA 3EXAA 1WW3A 2XA2A 3FAZA 4CEJA 1EUDA 5BV0A 1Y8ZA 1V41E 1O77A 1ZWKA 3VYVA 1N5OX 3DL2A 3FJ1A 3VVMA 2CVQA 1Z25A 4PG5A 2B78A 2TMGA 1XEAA 2OD7A 3NU1A 3ZDAA 4YDQA 5JS8A 3R77A 4CXMA 2TYSB 1U7TA 2GN2A 1G8KA 4QOJA 3WKCA 2Z98A 1C7QA 1UOPA 1Z62A 3LCUA 2OECA 1FRVA 3EY9A 3DMGA 2C95A 3QXJA 4WPGA 1J1UA 3UUEA 4M38A 5CNIA 2HLNA 5JXJA 1FFBA 4EBUA 2AJTA 3CH5A 5LD2B 2HQOA 4M0FA 3EF3A 1DFIA 3OIFA 2FKNA 4LNHA 2OGTA 4HN2A 5K8VA 1KZ7B 4BDTA 1OX4B 3A04A 3VKFA 3H9UA 3THRA 1QKKA 3EISA 1X7XA 3CISA 3EBPA 3OCCA 4JZKA 5BVGB 4DMHA 3K8OE 1CQJB 1GGNA 5D3KA 4HVLA 2Q0XA 4CMEC 2EW8A 1PR9A 1FMTA 1V1AA 2P9FA 1Q0QA 1IB0A 1PJLA 1CRWG 4CQLA 4GKBA 3ZUGA 3S4YA 4EUSA 3HBAA 2VAWA 3R7DA 2NSJA 2Q2WA 3RLIA 1N33B 2QU7A 4FOLA 1MJFA 4S2EA 1RFTA 3KJHA 5INTA 2JBAA 5ELLA 4ENVA 1Z5UA 2PS0A 3AUAA 2I80A 1AUOA 2AK2A 4JFRA 3O8OB 5AM5A 4GC5A 3ONVA 4M22A 2IDJA 1F2TA 1KYIA 3JYNA 4GE3A 4G4JA 4QYIA 1ADGA 3K6SB 4OU4A 4KUHA 1YO6A 3CO0S 1PGNA 4HHEA 4AP6A 3IH0A 4UMVA 1ZVVA 2Q3FA 4B3CA 2W8BB 4G0NA 4HQ0A 5H3CA 4ZOQI 3PZSA 1SBTA 5GONA 1DZIA 2IDKA 5IXSA 4HDRB 3WNVA 5IEJA 2M32A 2VA8A 3QNMA 1U0HC 1Z5NA 3R2JA 4D45A 1CW2B 1P18A 1IM2A 3JRXA 4MYRA 3COVA 4RK4A 4QGFA 2AG5A 2DECA 4REQA 4IG9A 5KCMA 4LJYA 4B85A 4MVJM 4DLPA 5CFLA 4TZ0A 1NXVA 4ATNA 4RM3A 4EG1A 3HTXA 3A1DA 1B76A 3H05A 1LLFA 3NHYA 2X42A 1YR1A 1Y63A 5BR4A 2P9YA 3NLLA 5DJ5A 4PSAA 1OWMA 4OYHA 1T1SA 2V45A 2FMHA 2WWWA 2XCUA 4ADSG 1MRSA 3QHPA 2Z43A 5AKHA 1DS6A 2HTEA 2YWJA 3VAAA 2VHZA 4D1YA 2GHRA 1JRLA 3GA0A 4CMAA 2XZOA 2RK6A 1FMFA 2BH9A 3TTXA 4EF4A 2D74A 3BHNA 1JWAB 2RG1A 5ECDA 1SWVA 2GZHA 1OI7A 1OSNA 4G0ZA 3DO5A 2PWPA 3N9IA 4GICA 2ANBA 3CZAA 2YV5A 1JG4A 1H3NA 4MRNA 2EZUA 3IS3A 4HGPA 3WAKA 3O1IC 3OIWA 1NR7A 1EVLA 5J23A 2PGXA 3VC3A 2GAFA 1JSXA 3OX4A 1XN4A 2VJCA 3Q7EA 5CVJA 2XNCA 4P84A 1VGQA 4ZGWA 5CTAA 4YRRA 4KVAA 3D8SA 3OC0A 4Y9SA 3ZDDA 3QU5A 5EEGA 2WFMA 3IVXA 2JFHA 2V7BA 1PWHA 1IHPA 2AQIA 3L1IA 4NH0A 4J07A 3EWMA 3N2GA 3HDVA 3ITEA 4HNQA 2PAAA 3WGKA 1RXSA 3JQQA 2M6SA 2Y9MB 4GO1A 4EA9A 2YMQA 4C4OA 1XU9A 3WGNA 5CR9A 2I4LA 3W06A 2HIMA 4HJRA 2QSUA 4ITRC 3C8ZA 2J4FA 2NO7A 2VJMB 2BY4A 3B8EA 3EPRA 3SZOA 1HE8B 1C0PA 1MC1A 2AN3A 2OCLA 1M1NB 4BMNA 1CB0A 4KAFA 1DJMA 3NHBA 2O0HA 4FK8A 1E9EA 4FFOA 4Q1AA 5JFGA 3AI1A 3MWEB 5F73A 3P9XA 4GNKA 4HBGA 3BX1A 1QC5A 4GOXA 4QJIA 2I6TA 3QYJA 1OZ0A 4G0QA 1DT5A 4RD6A 1HTWA 2BEVB 4F21A 1VIVA 1R27A 4WY8A 2G6BA 4ML3A 4KI0A 3ZGNA 4D6PA 8OHMA 2XMGA 4XDHA 1EXVA 1F17A 2P6NA 3B20A 3VZQA 3F5SA 5HOQA 2Y66A 3WADA 2BMJA 5DNAA 3PD1A 4MIKA 4FJ2A 3OECA 5AHWA 5L45A 2DQYA 4G0PA 5ESWA 1QLWA 4LRWA 3FYCA 1N5DA 4A6DA 2QM3A 5BRJA 4DBZA 4P36A 3GCWA 4OP2A 3W3AH 5I9MA 2D3WA 2Z56A 5FV4A 4J1NA 3RU3A 2GM4A 2JEYA 5HUQA 3UM9A 3ND9A 1C50A 3AHDA 2HB6A 4YYEA 3OHSX 5AW7A 4RHCA 3U9SA 1NVKA 3LA8A 2BDUA 2WYWA 2E4UA 4CWAA 1EM8B 2GK6A 1E9DA 4YECA 1GRQA 3MXOA 4HNUA 1R1DA 3ZUPA 3L1JA 2Q3EA 2PEYA 4JJGA 1DWPA 1KNQA 3TNJA 1MJGM 1RRFA 2VARA 4JS0A 1WQ4A 2R8XA 4LCBA 1KO7A 1N4AA 2GBLA 4ABTA 3PUYA 2XD9A 3GK3A 3VYTB 5TIIA 1ZONA 4OQ4A 2JDIA 2Q0SA 2YXEA 4X3PA 4YT2A 3RS9A 1EJ2A 1UXGA 3RFTA 3UICA 3GEPA 3EX7C 2XF8A 2H1LA 4TTRA 4AF7A 1AD2A 2M6RA 4PO9A 3T38A 1OAAA 4WZ6A 5KNLA 3UCFA 2FRVA 1OZHA 1WL8A 4QQKA 5LMNB 4QLAA 2R25B 2COKA 1NW9B 1TKBA 1PE0A 4L9SA 1J24A 4B8YA 2CMHA 4B0OA 4DEVA 3VHLB 5FLXA 2PRIA 5H4HA 5B55A 1NUTA 1ZH4A 1RRKA 3IQ0A 1G9TA 2LXNA 4KX5A 4O4LF 4OHZA 1B4DA 2HN9A 2GPBA 1QE5A 5DLYA 3FWNA 3TL2A 3ZIDA 4AZTA 1GKLA 1KK3A 2GYVA 4G5HA 4INPA 2YHUA 3R0IA 3E03A 2IVZA 2C8VA 1MIOB 1E8NA 1MB3A 1Y3IA 2FPKA 3B9BA 2QMUA 3IBTA 1R0SA 2O52A 3VOAA 1VKJA 3MCWA 4BKUA 4IMIB 5BMOA 1ZYUA 1YNSA 1P1RA 5EXXA 1JDJA 5HFAA 1MZPA 4JI8B 5EUCA 2BBWA 3OFNA 1YHYA 4MEJA 2HW8A 4KANA 2ZYRA 3TLMA 1GRNA 1PZNA 4FOSA 1YDMA 4MO2A 4FE7A 4HAUA 1SXGA 2PH3A 2WMDA 4R8LA 2HCTA 4TLLB 1SUDA 3PEWA 1ZK0A 3D64A 4WOJA 2P77A 3DMHA 3ZE9A 1P1HA 3DWFA 4P4LA 4K9PA 1OBCA 1C3EA 3VPCA 2HDWA 4K9IA 4BNMA 4R9UC 3I5XA 3BBPA 2X2EA 5IUJC 1N6IA 3A1VA 3RM5A 1RC1A 1U8ZA 2WYOA 3FVWA 3Q7SA 2X5KO 1BKSB 2X7JA 4AQYB 2F1OA 1QP0A 1K6EA 2XOXA 1D1QA 2QJFA 3KAKA 4RKWA 3GWGA 3A0RB 2Q2QA 4RIEA 2O7SA 1YKGA 1ZIPA 3K4QA 3E3AA 5C1OA 4CEIB 4OHFA 2X3YA 1KDVA 1R4NA 2P2SA 3HDHA 5K8LA 1QYDA 3S1SA 1JG6A 2A35A 1ESZA 1P81A 1WBJB 5EXTA 5F76A 2YXNA 2EL7A 4LDZA 2KW5A 2B34A 4L9AA 2AB0A 1KAQA 1SIUA 4J7XA 3ZV3A 1NYLA 4MB0A 4Z4CA 1D1PA 2PMKA 1KPGA 3GJTA 4GMFA 4FBLA 1AQJA 3DZJA 1RJ9B 1R5BA 5H1YA 1L3CA 3UG6A 2UUBB 5FL7D 7ADHA 5JSQA 2E9SA 2HUPA 3ZWDA 2GBLC 2HK6A 3OO0A 2Q8NA 3OTXA 3HACA 5M3BA 2QBYB 1JDNA 1YDHA 2JGEA 2P5UA 1WWKA 3W2HA 1NG1A 4UEKA 5C32A 5ECYA 2A67A 1CHNA 3ZOKA 2H29A 4WNCA 3DFKA 3TCXB 3R5JA 4QPJC 4ZGGA 3HWRA 7YASA 5TR9A 4L0CA 1OU0A 5E3JA 3W8EA 4OSEA 2B4RO 5BNFA 4HNSA 1IU9A 4R1OA 2X9NA 1V9CA 3WRVA 1O95D 4IXMA 4YMHA 3T5MA 4BASA 2FH5B 2LE0A 4B8WA 1YOBA 2FGJA 2JFFA 3O3MB 4P4SB 3KR0A 4CTJA 1UT5A 3WJ7A 1BS1A 2DETA 3FYDA 4DVJA 1F14A 1E1YA 1PN3A 2ZPUA 4LGVA 5TPWA 3OWHA 4TX1A 3QRWA 1GAQA 1Y6ZA 4TXLA 3WLHA 3KV1A 1JEYB 1XPUA 1KZ6A 2ZT6A 3PFHA 4GR9A 2Q2NA 3U7IA 4QG7A 2Q4OA 4XB1A 5F2KA 5TMPA 4O1LA 5B1DA 1POWA 1R4AA 1JPJA 1FLNA 1BE1A 2V9ZA 3P0HA 1M6WA 3D2LA 4KLZA 3PTAA 5ALWA 3RV3A 4D8TA 1XMXA 2ISSD 2ZYGA 5H68A 3J7AC 4RF4A 1R9GA 4A1OA 3RSCA 1EFHA 3SFVA 1UPCA 4DMCA 3DBVO 2YZ7A 4BVEA 4PX2A 2B4QA 3E4DA 1Z8HA 1BSVA 4L0DA 4D7AA 2IPLA 3LZDA 1LU9A 1V8DA 4GZLA 2NZJA 4JA2A 3SK0A 1V4BA 2VUHB 3BDIA 1Q7TA 5FPQA 1XTSA 4DILA 2VKQA 4HUTA 3MAJA 4N3BA 2PJZA 1UOOA 2AVNA 4KLCA 2FQYA 3FB4A 4KLNA 5JRZA 5BW8A 2JJYA 2CYCA 2CHEA 4OQQA 2J6IA 3ZU6A 1VZ3A 3LPCA 5B36A 4U7DA 4D25A 4H77A 2WWRA 1H8EA 4R2IA 5JPIA 1EP3B 1ISFA 2X9QA 5B12A 3RRJA 2VQEB 1PVDA 2HLHA 2Q9BA 1DQPA 1J8VA 2R86A 1VSVA 2WHEA 5BRNA 1DOAA 1W5SA 3ND8A 3SXUB 3IBGA 4D57A 2JJ2D 2AEEA 3WL3A 2O2EA 3MLAA 3JQAD 4BBZA 3IEKA 2QRNA 3OPYI 3QG1A 2OQIA 4OXKA 1FDSA 2W58A 1T2DA 2B6NA 2EDAA 3RBZA 1T4DA 1NX9A 3AVVA 1VM6A 2AC7A 3I6BA 3PXBA 3R5KA 3ND7A 3R6TA 4B83A 3TJMA 1E6LA 1PKEA 1OXXK 2Y0CA 4I5FA 4JLBA 5DMHA 3C43A 2WF9A 3FLMA 3OIUA 3HSSA 3TKAA 5G1OA 3AK4A 2QRKA 4LZLA 3G9ZA 3VOBA 3A28A 4F7DA 3COPA 3MQFA 2UVPB 1TE2A 2JHAA 2X6QA 3NDJA 2A84A 3F7TA 5T4FA 3STUA 4BWFB 2NVBA 3PIIA 2NU8B 5EMNA 2ZVDA 1WRBA 1WXIA 2O2JA 3PK0A 1UXIA 4KB5A 3EZ9A 3IT1A 4OQZA 4R1NA 2IPMA 1W34A 3AHCA 2N1BA 3GBVA 1JMKC 1Z34A 1NOJA 3ZS7A 3MCVA 4ZOEA 4CEJB 1EUDB 3I6MA 4UUQA 4HPJB 3P9SA 2CV0A 2ZIFA 2XCOA 3I1JA 2DFVA 1YR9A 4RQTA 1W1IA 2IYSA 2C3MA 2RIRA 3HMKA 3V8QA 4QPCA 5F78A 4BUJA 3A6KA 3VTZA 2V97A 4HXEB 1X2EA 1TCBA 2YXPX 4LWOA 5SZIA 5CCXA 1TQHA 3CUYA 3P9YA 1J2JA 5D3MA 5D5HA 5DE3A 2I7DA 3PDCA 3VKWA 1K5DA 3IDQA 1S1CA 2GJSA 4QECA 1J5XA 1PSWA 1EP2B 1QIGA 3TSYA 3JWGA 5DM60 5JFTA 2Y0EA 5JADA 2V4MA 1D9ZA 2JH9A 3KOUA 1A9PA 3PEEA 4TQGA 5JZSA 5AUPB 1AUQA 4JROA 1TQ6A 3UB4A 1X7XB 3MJSA 3G6KA 4EB6A 5EMMA 1WUTA 2FE1A 1DIRA 1EB8A 1HE3A 1GPBA 3ZLUA 3K2BA 3ZV4A 5JEEA 1HPLA 4LW8A 2UUAB 2DAPA 3RVOA 4LA4A 2ZRAA 5P8WA 2H0RA 4CQLB 1Z4IA 4OGFA 5CLIA 3SHTA 4X45A 4C5AA 1V9SA 1XTPA 1ZS9A 2QV0A 4EUKA 5KWVA 2WJ3A 2ORIA 3MWJA 4C12A 2ZAYA 4LF5B 3A4VA 4WLFA 4Z8YA 3W6ZA 1H2ZA 2WJJA 3OZTA 2EX0A 1Z0UA 3CVJA 4II7A 4X91A 4NYJQ 1RACA 2C97A 4QYIB 3A37A 2QG9A 3DEYX 2R1UA 3IEUA 3NVAA 4W5JA 4CUKA 4A0GA 1TW2A 3UMPA 3BXZA 2CWDA 3C1UA 2O2XA 3A1SA 1G4HA 1G63A 1NUUA 1G1AA 2O2IA 2YX1A 3OCWA 4GVXA 4UHBA 1QR6A 1HYQA 1JN0A 4NE9A 1TOAA 5EIFA 4XGRA 5GONB 5JAUA 3SCZA 4JLNA 5DK6A 4Q1BA 1E64A 5KAPA 5E6RB 3D4IA 4BZWA 1FUEA 1KAEA 2Y1GA 3N59A 2V9PA 1FLAA 2Q5LA 1IVSA