3RSQA

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima soaked with nadh
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
490
structure length
490
Chain Sequence
HMKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative uncharacterized protein
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
total genus 175
structure length 490
sequence length 490
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rsqA01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3rsqA02
2ABQA 4LCAA 1YGJA 2A9YA 4S1HA 2DDOA 3UQ9A 5C40A 3RSGA 3QA2A 3IBQA 3IE7A 3RPZA 4E3AA 1JXIA 4JKSA 1V19A 2JG1A 3N1CA 2I5BA 5EYNA 3RU2A 1V1SA 4EN4A 3B1RA 2AA0A 4K8TA 3EWMA 1L2LA 1VI9A 2PKFA 3HYOA 3FHXA 2JG5A 3PZSA 3RM5A 1LIOA 3DZVA 4JKUA 2F7KA 3B3LA 3JULA 5BYCA 3HICA 1TYYA 3CQDA 1DGMA 2QCVA 3D3JA 2YXUA 2AX3A 4N09A 2DDMA 3VAQA 3BGKA 1EKQA 3D3KA 2AFBA 2DDWA 1GC5A 3NL5A 4KADA 2QHPA 2O8NA 3KTNA 5B6AA 4KANA 1KYHA 3RT9A 3B1OA 1VM7A 3NL3A 1U2XA 3OTXA 3GO6A 4C5NA 3BF5A 4S1IA 4O1GA 1RFUA 2PKNA 3RU3A 4K9CA 5TQIA 4C5KA 3UQDA 3KEUA 1UA4A 4C5MA 1ESJA 2C4EA 4E84A 2A9ZA 4XF7A 3FHYA 1YGKA 3GO7A 3ROZA 3H74A 2V78A 4S1IB 3LHXA 3DRWA 3NM1A 3NL6A 1RFTA 3NCAA 4KALA 4S1MA 1ESQA 3VASA 3HPDA 5CGEA 3RT7A 3K9EA 3W4SA 1V1AA 4K8CA 3MBJA 3NC9A 1TZ3A 2DCNA 3RRFA 2JGVA 3RTAA 4UBEA 3RQXA 2PKKA 3ZS7A 3RS8A 3ROEA 1LHPA 2HQQA 3IKHA 1JXHA 1EKKA 3KD6A 3UQ6A 3RRJA 3RSFA 2Q5RA 3RY7A 3GBUA 3ROXA 1WYEA 3Q1YA 4GM6A 3B1PA 2I6BA 3RTBA 3PL2A 4E8WA 3UMOA 3H49A 3RPHA 5TRWA 2XTBA 3RTEA 3B1QA 3MBHA 1RKDA 2FV7A 4YL5A 2RBCA 1LIJA 3RO7A 2ABSA 2AJRA 3RSSA 2I6AA 3LJSA 3RTGA 3LOOA 4E8ZA 5BYDA 3UQEA 2F02A 1RK2A 4LC4A 1LIIA 5COJA 4DU5A 3IH0A 3RNOA 2PKMA 4YWRA 4EOHA 3K5WA 5F11A 4XCKA 4O1LA 3RQQA 3RSQA 3RO4A 5C41A 4B8SA 1TD2A 2VARA 3NBWA 3NBVA 3UMPA 4EBUA 5BYFA 5BYEA 3B1NA 3RQ2A 3IQ0A 4LBGA 3RQ8A 3QAIA 4JJPA 2R3EA 4K8PA 1GQTA 4K9IA 5CM5A 1RKSA 3RQ6A 4X8FA 4C5JA 4N08A 3RTCA 4XF6A 4U7XA 4DC3A 1LHRA 1BX4A 1JZTA 4XDAA 4KAHA 5C3ZA 2YXTA 4B8RA 2AWDA 5CGAA 4C5LA 1VK4A 2DG2A 2AJPA 4K8KA 2NWHA 1RKAA 3Q92A 5EY7A 3ROGA 2HW1A 3NC2A 3LKIA 5C3YA 5F0ZA 1TZ6A 4PVVA 2R3BA 4EUMA 4K93A 3NL2A 3NM3A 4E8YA 3RRBA 3RQHA 3RS9A 3IN1A 3RREA 3I3YA 4WJMA 3RTDA 1C3QA 1YHJA 2HLZA 1UB0A 2AB8A 3UBOA 4KBEA 3RQ5A 4LBXA 1V1BA 3KZHA 2C49A 1RFVA 4E69A 1LIKA
chains in the Genus database with same CATH superfamily
2C7BA 2EW1A 3PXGA 2V74B 4YJGB 4YV0A 3DKRA 5K51A 5DNCA 1XZNA 4P3PA 1SURA 2FPSA 4HLCA 4E13A 4KR6A 1MQ8B 3U5TA 4HCJA 3QVTA 4DLZA 2HO4A 2HSZA 3QV1A 3ZG6A 4TTRA 5HXAA 3LHXA 1OT3A 2R85A 4A23A 2X7XA 4XPIB 1MC5A 4AURA 2CK3D 5H83A 3DXXA 1L5NA 4PZ9A 1BG6A 3IQWA 3R1IA 1KJIA 2PGNA 5JRDS 1KEEA 2XH8A 4QREA 4UUNA 2ZS8A 2XVZA 5LLDA 3THWB 3OZCA 3R3WA 1W94A 1HFEL 3QP9A 4QUKA 5HMMA 1I8TA 3GJ8A 4FGKA 2CLEB 2R44A 4TTJA 2CNKA 1XNHA 2BGUA 3EXFB 4WINA 3U17A 5T5QA 1D1QA 3FRIA 4FDUA 2XIJA 4S05A 1H66A 1G1MA 2W2OA 4NDZA 3CVXA 4QNMA 1LLDA 2ATVA 4LJSA 1NG9A 2XPCA 4JT8A 4AX8A 1IWOA 1W76A 4LMPA 4G4SO 3AIOA 3IO3A 3UZUA 4R7GA 1W1UA 2CLCX 2JVKA 2NYUA 4UTOA 4II2A 3IRUA 4J7UA 4WKPA 3W8FA 4R16A 2IZ7A 1D0VA 2AB0A 4F56A 1SB9A 4TLDA 2H54A 2QN1A 3PRKE 5EP2A 4HADA 5IT4A 3DG9A 4XD2A 5IYZB 1JXHA 3AVYA 3U19A 3QUQA 1T5TA 5CXXA 3ROXA 2XJAA 2ZANA 5AI0A 2XYGA 2V4ZA 1NM5A 2MSLA 4RGBA 2RAPA 1CQWA 3OEWA 2I7VA 3FGOA 2X1MA 3GEGA 4H7KA 2PU5A 4XOUA 5B1SA 4L5IA 4EW1A 4JJ4A 2VT2A 4C4TA 2IH4A 2I55A 5BOVA 1XWFA 1M6NA 4DAEA 1RRCA 4IHKA 1Y7TA 4YT5A 4Q5IA 4B1FA 3MOGA 2JGFA 2LDXA 4DMLA 1R0CA 1TUBB 5T3UA 4RHYA 1AOXA 2Q07A 4P4SB 3UGQA 3W3ZB 5LVAA 4ARIA 5FOQA 3H5AA 1G9TA 5BSFA 3E8MA 2RCNA 3AF3A 3A3YA 2J6IA 3F6EX 4K2AA 3CG4A 3RRNA 3C1UA 1JSRA 4B9AA 3DZFA 1E2IA 2R3EA 4M0EA 3I09A 1NMXA 4JLMA 2QGZA 3OZAA 3PTLA 1A77A 1POXA 2ZT6A 1I9GA 1P44A 3BK7A 3JAWB 2HD4A 4BNMA 3G5LA 4ZVSA 5GY7A 2Q3BA 3OOEA 1CUDA 4U9UA 5DBFA 1ZQ1A 3CO5A 4DLBA 3TO5A 5KOIA 3ONDA 5E1OA 5KWSA 3TSAA 4M0DA 3L1HA 4OQ4A 1GPUA 1YFZA 3KYJB 4B9EA 1ZQ9A 2AGVA 2IYPA 2PSSA 2C2BA 2VJPA 2B69A 1BVYF 2IYOA 4DLNA 1Y7LA 3PQEA 4LJLA 2PWYA 3RRBA 5A6VA 4XGRA 4ZO7A 3PIIA 4CIWA 2IEYA 2WKRA 3NZEA 4RM3A 3PX3A 3EN0A 3WZ2A 4EHFA 2VBGA 5F21A 2MSEB 4JLOA 3FNEA 4G0WA 1P9NA 1WXDA 3FTPA 4GKAA 4X9XA 721PA 3W5IA 4PXAA 1YGJA 1G20E 2W2XA 2PFKA 1Q14A 4WHMA 5DGTA 5JH7A 1ZK3A 1MZPA 4JKSA 1ISHA 1A04A 1ZN7A 3RU7A 4YRBA 4BO8A 2F8MA 3BIOA 3GRAA 3L84A 3M4NA 5C4MA 4XUDA 2FJPA 2WJWA 4Z4CA 1B6TA 1M1UA 2PH5A 1NN1A 2HWWA 4CXMA 4MTCA 3K70B 5EHGA 4Z9XA 2F7KA 1G66A 1YB1A 2XBLA 4FHZA 1C3OB 3EZ6A 4UHEA 5I8WA 4DPLA 3JXEA 3EWIA 3JQFC 4LK3A 4ONEA 4ARSA 4YMUA 1M8GA 4NKRA 5CGQB 5F1OA 3RODA 1QYRA 2UUPA 2WMDA 1KDOA 3RS2A 1PEDA 2Q5LA 2XDQA 3GCDA 3KEGA 4G0XA 4M1MA 5AT1A 1Q0SA 1BS9A 2DM6A 4JXKA 4LIPD 5FBKA 1CYEA 5K6AC 1YDHA 2PAAA 3ITEA 3MRTA 3EGIA 4OHUA 1VE5A 3INTA 5DI3A 3T1YB 1GAWA 1V9SA 4NJMA 2Z08A 4CKEB 2W98A 5A7FA 1ESJA 2A9ZA 1VL0A 5IASA 3M2PA 3NM1A 2R5FA 1UMBB 3KPVA 2PG3A 3GJ7A 3M4ZA 2I3AA 2ZWPA 4EGQA 2YN2A 4C6RA 1QIDA 1XWWA 3UJCA 3ZWXA 4DJFC 3W04A 4EHLA 3ZUPA 2J9FA 1H3EA 3AI1A 2VP4A 4J07A 1NIJA 4FQ7A 2AK3A 3LF2A 5SV2A 1HTTA 1H6DA 4NH4A 3HEMA 5HZHA 2EYUA 1N6OA 1GGJA 2CZQA 4OY3A 4BP3A 4C3VA 4MX8A 4FMDF 3I4LA 1NZDA 2P8JA 2RGYA 3GJ4A 3IBFA 3B53X 3B1XA 5EQTA 1K27A 3KE8A 4IGKA 2ZJ6A 3C3KA 3WDMA 4RVGA 3OQ6A 4OB6A 1DX6A 2OGZA 3OMXA 1CU1A 2Q0XA 3JD0A 1FUIA 3HM2A 2G76A 4M98A 5DM70 4QLOA 1TMYA 1KBZA 1ADBA 1XEAA 2FP4A 4GOXA 3HUUA 4JBHA 4JP5A 1YBAA 3I05A 3VGJA 1JX6A 4EK9A 1IIBA 5JJCA 5HRUA 2YZGA 5DEIA 2J6BA 1UFRA 1WW3A 1XZFA 2OBMA 1FS6A 5IKPA 1BDBA 4A5SA 1A0OA 1SXPA 2C00A 5TB5A 3GT7A 3DDCA 3HN6A 3GJ5A 2HK9A 3RSQA 5A06A 4FKMA 1A76A 2PFGA 2A92A 4M54A 5JSHA 1W0KD 3L7NA 2X2EA 1NUUA 3FKQA 1OLUB 3K09A 2VQEB 2GAJA 3V1TC 2QSUA 4D9MA 2WJ4A 1ZHOA 1CLUA 2GJSA 3T4PA 4C2TA 3IUSA 1A2BA 2CY0A 5LC1A 3PC2A 1IN1A 4Q4CA 1XTVA 3GG9A 1EJ0A 2QLLA 5ALHA 2EARA 3KQLA 4E2ZA 4CGYA 2NZJA 1NDHA 2OD9A 2P30A 5EIFA 1T4DA 4GUDA 2PMCA 1JPUA 3BD6A 3DBRA 1M2JA 4H7IA 4QUJA 5AVKA 1PYOA 1TCCA 3F49S 4GMDA 4UREA 2H57A 4JI6B 2C7OA 3G2PA 1TL7C 2R8XA 3GR6A 3SYKA 1O6BA 1MR3F 5JTTA 4JWKA 4IXDA 3ZLTA 1LFDB 3D7MA 1JQEA 2UXDB 4WLOA 1AQLA 3KNZA 2XNDA 4FK8A 5ALRA 2A14A 2JB9A 1ORWA 3WLIA 3N70A 4QYWA 3USES 1WKVA 1WOMA 2FQQA 4HNGA 2FK7A 1RHMA 4ZXFA 2QV7A 3V3KA 4BNVA 1EDBA 2Q6TA 1EXNA 3JYPA 1Z4MA 1LSOA 3TR5A 5ITVA 2P67A 5IXJA 4N5LA 3L4JA 3VA7A 4L0DA 3QA2A 2C9BA 2KM1A 3IAXA 4HB2A 4L5AA 1DX9A 4TLCA 2JFZA 3A9RA 1AMOA 4DRXA 4M0KA 1A8QA 4BFTA 1Z34A 3HGMA 2EKDA 4QVGA 5AJUA 1ZMOA 3GA5A 3KYDB 2P41A 3B6EA 4TWAA 1RIIA 5REQA 1B1AA 3LDUA 1ZNZA 5AW7A 1E1QA 3R40A 1F6DA 2PRYA 5HIKA 4TPKA 1PR2A 2GK3A 2VJMA 1ZDMA 2YOGA 1W88A 3H5NA 4XW2A 3T38A 4NU6A 1ZCJA 3DLPX 3ZQ6A 1XNRB 5H0IA 1VCMA 4F71A 5AJVB 1KDTA 2WHRA 3NW9A 3W3AH 1WEKA 1G5PA 2Q5QA 2R7AA 2RC5A 2D7CA 4MQFA 4OAOA 1C7JA 1U28C 4LRWA 3PFWO 4FOPA 4R1NA 4ZV7A 1PSZA 1C9KA 1XZPA 3NM4A 1A8IA 1V4VA 3NMUF 5DJ5A 5I47A 3I53A 3TL6A 2JGDA 2FGJA 3KU4A 2IYFA 1P19A 3IEVA 2R6CA 2Q1XA 3FYHA 1FZTA 3UEOA 3V2IA 4Q3BA 1FPQA 4HRXA 4C0HA 1T1RA 1S96A 5HIAA 3VJLA 2AI1A 3Q88A 4YCSA 2OOKA 2GESA 2JCXA 1BXGB 3AUAA 4X54A 3PTZA 5LQNA 3EIEA 5B36A 4BX8A 3ICEA 1MHPA 3F5DA 1PL0A 3KZNA 2QJRA 1HORA 2JRLA 3CX8A 2X3UA 3E27A 3HWWA 2ZPAA 5AKXA 1W19A 1PQWA 4XQ0A 1KJJA 3DEIA 1VRWA 2BMAA 2GEUA 1SUFA 2ZJ2A 4LVOA 1MQ9A 3TW0A 5HFAA 4LS3A 1E66A 4B87A 1PJAA 4TMYA 2I6AA 1WPRA 5JXGA 2HCJB 1H2EA 1A5BB 3DWEX 3GP8A 3KJNA 4KRXA 4Z54A 4D9GA 5D1NA 4MYUA 3NS7A 1VRVA 2GI4A 2VRWA 5HP4A 3I64A 3D5EA 5JDIA 1J8VA 5KJFA 2XZDA 5MN5A 1TXGA 1RTKA 2QTBA 3ENQA 3O21A 4E07A 5JCZA 1WU8A 5K0NA 2JF0A 3FMIA 3IUBA 3QJGA 1NN3A 3EZGA 3FPGA 3KS9A 4FZVA 5CCXA 4EBUA 2YDYA 1OH7A 1VMKA 3SM3A 4KIJA 4XX0B 3VR4A 4JBXA 1NI4A 1VSQA 3BTVA 2ZRIA 1T3SA 1AKRA 4MKXA 2OWDA 4F06A 5G0VA 3BHMA 3GDFA 2ZB4A 3NX4A 4F3TA 1TIKA 3D8HA 4NCBA 3I9FA 4G1UC 3CURA 5I7SA 4C3OB 1WULS 3COYA 2XYVA 4Z8YA 5ITZB 2BCJQ 3DVLA 4Y2GA 2I03A 3J80A 1D2GA 3W06A 2LV8A 3FOCA 2O0HA 4DCPA 4CKZA 4MUFA 1N6PA 4K5QA 4LBXA 2FOXA 4ZT3A 1P5RA 1RI5A 2H3EA 1B26A 3FMVA 3RVLA 3WXBA 3EIFA 1HDGO 5LXTA 4ZO9A 1QVVA 5TGZA 3ZJ5A 3AHGA 2ZI3A 1TO2E 5LUBA 5K3EA 4B85A 1GUBA 2YQ5A 3X2EA 1AS0A 3OM0A 3GBPA 5AHXA 2ZUCA 2OYCA 1G0OA 1TYCA 3FNIA 1X8KA 5F9FA 3NTRA 2ZBQA 1CJVC 2CEAA 3H1PA 4WLUA 1U0GA 3RHZA 2IYRA 4MCHA 4NXMB 1SHLA 5C3UA 1G21B 5FO0A 1BJTA 3JQGA 2IYXA 2ZB8A 1YFJA 1W4AA 3P0JA 1RLOA 2FZVA 1M2NA 4L28A 3R7AA 3EGWA 4JOQA 3GLGA 4RFLA 1QORA 2CVPA 4W4TA 1V3VA 2EKQA 4C1BA 4OLBA 3KWJA 4B79A 3CEHA 1OBCA 3RG8A 1YR1A 4U2DA 4PC3A 5BW4A 2BM8A 3BG5A 5TRTA 1NVVR 1XTZA 3ZNNA 1JNYA 3LVQE 1IMJA 3OKAA 3ZCUA 3EK2A 3T9CA 2EJUA 4ALMA 2PX2A 2E9SA 3BD7A 3X1YA 4TWRA 1U3VA 4ZT6A 1S2GA 1H0SA 2H1RA 2ZJ4A 2B8JA 2B8TA 2FZWA 2RGXA 4GX5A 3ZXIA 4CG1A 4ON9A 2C03A 4V2IA 3VZDA 4EBFA 4BQIA 1TT5A 4EPRA 3SSMA 3C15C 3LWZA 4LGMA 1Q1NA 1W5BA 1X9GA 2V0CA 4J4BA 4YBRA 3PXXA 2WNHA 1ZEMA 1FUUA 1UJMA 4JLWA 5KOYA 4LDJA 4BNYA 3GA7A 4AM8A 5BN3A 4JQCA 1PS9A 4NNOA 1U3TA 4MA0A 3VYSB 3KEQA 3A28A 1MB9A 3FVVA 4ZYUA 1A72A 2Y4NA 4YIHA 4GMFA 3VO1A 5ERGB 1W36B 1SIUA 4KH1A 2GZ2A 2HRDA 4RGVA 2QZZA 2RGGA 2W9XA 2CW5A 4TV8B 1XB2A 4TWJA 5U4QA 1BVRA 1ZWLA 4JLPA 3NHKA 3ZDYB 4LJ4A 2NT3A 3F4KA 4I5DA 1BYUA 4U7TB 3PZBA 3CLSD 3EEFA 3LXXA 5T41A 2O20A 3VNRA 1UM9B 1KXJA 2XCTB 4NBLA 2H1HA 3IVGA 5FQNA 3CINA 1XNQB 2GZRA 4MVJE 3ZU6A 1Y48E 1J8FA 1RHJA 1W48A 3HP4A 4I50B 2J5KA 4GW3A 4GOMD 4CEHA 4II3A 1J00A 3OG9A 5JYDA 5JAMA 2DE0X 2X6QA 1GWNA 1GSAA 2DSNA 3C39A 4YI3A 4MGEA 5FOUA 5B12A 3AR4A 4K9IA 1RKSA 3P2IA 2J3EA 2FKAA 2P7IA 5DWDA 4E32A 3GDOA 1JYFA 1KZ7B 3TLBA 3V4OA 2X2PA 4BB0A 4Q7LA 3UXEA 4G85A 4OH7A 3SMQA 4C7KA 4TX1A 4CMHA 1WVGA 1M0EA 2AWDA 1A96A 1SXHA 1B42A 1UKEA 1GSHA 4OKNA 4BQEA 2IWRA 3OQ1A 1ECGA 1N6IA 1N9GA 1YE8A 2QN3A 2RHDA 1YE5A 3VUEA 1WHSA 2XW6A 3AY7A 3MMPA 5FT9A 1NOKA 4M0PA 1WDWB 4A2WA 2WT8A 4KFRA 4EARA 4YN3A 2IS4A 3GU3A 3FE2A 1KSFX 4UU8A 1QCYA 4GOLD 4QJ5A 4BZXA 4K93A 2WHQA 1PJSA 3SVZA 3H9GA 1G8PA 2QUHA 4AQ7A 3MVEA 5LR6A 3NHAA 1E62A 3MILA 1QNFA 4WY5A 3NAZA 1MU0A 2CL0X 3PEVA 3FJOA 1W581 3R3HA 5K3CA 3AIKA 2J67A 4Y2JA 4AS3A 2CUZA 3BSYA 1LNSA 4BVGA 5HX7A 1FDRA 1BDMA 3W6OA 5JPCA 4YCNA 2NZWA 2MINB 3KXIA 4J2TA 4MPPA 4Y0VA 5TS2A 3ZY4A 4E2YA 3TCKA 3BGSA 3R7FA 3TH5A 1G3UA 1U8AA 5IUNC 1N5RA 4XB6B 3VVMA 1OVMA 3D6MA 5DNYB 1CZRA 2C4HA 2G3YA 2Q9CA 2WU8A 4KX3A 5F3WB 3TVDA 5FLEX 5G0UA 3DOFA 2I65A 1F12A 3LKVA 3GFPA 1XIVA 4ZXPA 4B5LA 5L9AA 3PIRA 5DF1A 4R0VA 3GLIA 1T25A 3ZW9A 1UPXA 4E5KA 4QVIA 3NYRA 5L3SB 4PVCA 5BT8A 4Q6WA 4ZCSA 3NOOA 5DNAA 4OFZA 2BFDA 4RTMA 3SVTA 5EMLA 2JFXA 4BIMA 1LDEA 2B1JA 5HOQA 2XUIA 5CD9A 1V8FA 2FOIA 4PGAA 1B93A 4IQ8A 1WETA 5FOXA 1XTIA 1O5OA 3E15A 1B1CA 1W2HA 4CM5A 2CDCA 2FQYA 2BW0A 4A2CA 5DWVA 3MUNA 4JI4B 4RY0A 3SSNA 2AUTA 1GPWB 1ES9A 3UG6A 5A3JA 4WZZA 3AVVA 5J4LA 4JP8A 4BAZA 3ANXA 2EGUA 4BVKA 1XQWA 4DZTA 3VH3A 1KI8A 1E9BA 3S81A 1KZ6A 3X1ZA 3SS7X 1P31A 2NMVA 1VPWA 1EFKA 4G25A 4Q3CA 3WGUA 4RFSB 1WW2A 3QLEA 2O8DB 2WTZA 3SBEA 2HQQA 1HEYA 1EXMA 1V2HE 4BN4A 4I3FA 2ZB2A 5CP8A 1QHSA 1XYVA 4JLKA 4QXPA 2YC2C 3ID6C 1WD5A 2O14A 3AEYA 2I7DA 3GRKA 1CTQA 1Z47A 1XRRA 4UXJA 3OECA 1XZCA 1ODJA 3CS3A 3R6WA 1L7DA 1W87A 3D8BA 2X2OA 5T8KC 5EHIA 5C51B 5F35A 3HADA 3K2BA 1BMFA 1QTQA 4ZVLA 3C3CA 3N39C 5EUQB 4GPD1 2IHTA 1JAYA 1J06A 2OBNA 2ZE8A 3RVKA 4KYVA 4V0NA 1Y7HA 1V5FA 2PD4A 1VRCA 4HN2A 4GKKB 1TYZA 4MUYA 1B7GO 3R0VA 5CURA 2RG7A 2O8FB 1FTYA 4S2EA 1FDTA 2FUCA 3U9LA 4HF7A 4AP6A 2XXAA 1SUCA 1JKMA 1TZCA 4Q05A 4W6ZA 4ZAGA 2UDPA 3ZH2A 3VPDA 1GPYA 1AKTA 4MHSA 4RS4A 5ICFA 5AVXA 1AU9A 1B43A 5KQSA 5IH3A 2QXUA 5FTWA 3HSYA 4BOYA 4GSLA 2QYSA 4GT1A 2NU9B 2XT0A 5E9AA 2AZMA 2PANA 2Z2YA 3HY3A 1NLUA 1VHQA 4QD3A 1P17A 3F6YA 4WWHA 5H68A 5JH7B 4MUBA 1BMQA 1W1IA 4DCNA 4IGFA 2QROA 2GOYA 1O0SA 1ZRHA 4B2YA 3MTGA 4CUKA 4X1YA 2WHEA 1EVZA 1QWOA 4WZAB 3DEZA 1WCXA 2G4VA 1OWLA 5BUZA 1TQ4A 1YHJA 1I80A 3T5TA 1O89A 2WFZA 4UARA 1RAEA 4A4DA 5KYXA 1UBSB 1EWTA 5DBEX 2ODPA 3O8QB 4D9BA 1W36C 3BFPA 3NYIA 1TMOA 5I7AA 3UGKA 5M7EA 4BKPA 3R7WB 5ALWA 4PPFA 1PSWA 3QSGA 1TM1E 3UAWA 3L6OO 4MK4A 1U02A 1RZ3A 2POCA 3GP5A 4BE9A 4K8OA 1HBJA 2AJBA 3RAJA 1RWMA 3GRPA 5B53A 5JROA 2CYBA 1H5UA 3WG9A 2NN3C 5D7BA 4GVPA 3KJQA 2P9QA 3KM0A 2IXFA 4R2HA 1M6VB 1R0BA 3AZPA 2AX3A 3TQOA 5J1SB 2R8PA 3ORYA 2QPTA 3PGMA 2Q3JA 3P9NA 5P21A 4GKJB 3S7ZA 2I62A 2J9FB 5A04A 3RS7A 1T5IA 5HF6A 2WZQA 3DE7X 1VBKA 5HBRA 4ZI5A 5DVZA 1F9EA 2J3IA 3LY5A 2XE7A 4BRWA 2ZBUA 5B5SA 2XQVA 4S35A 2V6IA 4EP1A 1TKAA 3JD3A 4GSYA 2Z8YA 2EU8A 4X63A 1Q2UA 1G5HA 3PEYA 4RMGA 1MOSA 3IBTA 3QYAA 2QQ0A 2JIQA 5KQGA 3KT0A 3D6HA 4W7SA 4ZN6A 1VPTA 2LZ0A 1CVIA 2E4YA 2PZFA 3IH5A 4HQNA 3D8RA 1Q0UA 1UZMA 2IE8A 4H3VA 4RD0A 1UXHA 1WMFA 4NH0A 4Q12A 5JY6A 1MKYA 1PQUA 1RKBA 3A3OA 1B0ZA 1E1LA 2Z3VA 4B76A 2W6OA 1M72A 3M5WA 2MYNA 3FTDA 3O03A 2PUHA 2O5EA 5H4GA 1TVKA 1MJFA 2XUZA 2Z2IA 4J1SA 1UH5A 3NAGA 3UCXA 4URVR 3U16A 2QLMA 3OAAD 3W6PA 1KRWA 3R3SA 1A9QA 5FP0A 4HX2A 1NBEA 2IYSA 5FFNA 2MTBA 1DQNA 1Y8QA 4GDMA 4IUDS 3ADOA 4QC2A 4RF4A 3RPHA 1KGSA 3IBYA 3UK0A 4B4WA 3FHOA 3VC7A 1NP3A 3OLQA 5C2JB 5FBHA 3QK7A 1PR5A 2QM8A 3DVAA 4LQ4A 3GQBA 3FFXA 4TRMA 1A5ZA 1YDWA 3OCVA 5E1DA 1QCZA 4OK5A 5GVRA 1E61A 1YVPA 3FHTA 4H35A 5DGCA 4AF7A 2NVUB 1GTMA 3PHJA 4KXQA 2O8BB 1Z7BA 3HJCA 5HFNA 3RK1A 1RYFA 4NCIA 1XR3A 2E4ZA 3RJMA 2BMEA 2R25B 2M6LA 3T4UA 1GQOA 4Y30A 4L4ZA 1E1RA 2IGBA 4KVGA 1MX5A 3LYAA 1G9XA 3OZ7A 4DQLA 1HSZA 2Z6AA 3DLHA 3CF4G 1TLLA 5BYAA 3RSOA 3GD7A 3OO0A 2G8LA 2W2NA 2ZKIA 2G70A 1IFXA 2PT6A 4WH0A 4IOKA 2EJCA 1IATA 4AJKA 3DTVA 1NM5C 3RBZA 2ZWAA 1Y3IA 4U3JA 1B6RA 1JGTA 5HDBB 2DUWA 2G08A 3U7FB 2A58A 3GYBA 5ICMA 1O87A 1YOBA 4B45A 5JMOA 4QPDA 2J3QA 3CNOA 4KQWA 2XCIA 1K75A 1TIPA 5ER6A 5J5CA 3WL5A 4WJMA 4OX9B 2HJSA 2CCJA 4MQ5A 4DRYA 1I0ZA 2JFVA 3OTWA 1TZMA 3RQ5A 2EP5A 5JYBA 2VJMB 4MGYR 3RYTC 5BR1A 2CVQA 2BBWA 4O4HF 4LE0A 3T7TA 2TS1A 5IMBA 3R7NA 1BQEA 4MQFB 1KWKA 2KBEA 2OLKA 4ZKDA 4FCWA 3NR2A 3R0ZA 2V7XA 1YGPA 1P74A 4QUBA 1RWKA 2YY5A 1J49A 1TYYA 2QRNA 1AHIA 2HEIA 3KJFA 3N2GA 4JLDA 4PG6A 4Z0HO 1L4UA 3KG2A 4XD7D 3B1JA 4GBMA 1KL7A 2QTTA 1SEVA 2FSVC 4N0MA 3TIFA 4E94A 3ND6A 3MQ4A 3B3QA 1UC5B 2O9JA 3AVXA 2CHVA 4EX7A 5C1BA 2XKAA 2GEFA 2C7PA 1VJGA 3VHXB 4PG8A 1DQYA 2OMKA 1ZY2A 1NFFA 3F90A 4N6OA 1GAQA 2HPAA 2QX9A 4KAJA 2PKNA 1OH8A 3C4JA 2XX3A 2F7SA 3H5IA 4BV9A 1MAHA 4JROA 2VNIA 1X7DA 1RZRD 3C74A 2F8TA 3TM5A 1RI4A 4UPEA 1FNSA 2I4IA 1BH2A 1YZKA 4NZNA 4B7AA 4H59A 4Q7QA 3Q5GA 4YWJA 2XCSB 2C5FA 2B35A 2FUG6 1M2KA 1Z39A 1MRNA 4ZAXA 1ZS9A 4ND8B 1VA5A 2BMFA 3E84A 4YO7A 1V1AA 1QDUA 3NHWA 3OJWA 3DLTA 1T9AA 5TNXA 1U81A 5KTRA 1E0AA 3V32A 4P3NA 1JAXA 1YRBA 2IUTA 3I58A 4MPDA 4U6SA 2IF2A 1TM4E 1Y3FE 2AR7A 4H9GA 5KQMA 1QP7A 4NATA 3K35A 3UMSA 2PLRA 1SBNE 2Z83A 1PR6A 2WYIA 1TUGA 3WSVA 5EZSA 4OI1A 4RA6A 4LDPA 4D8TA 8ATCA 1RYDA 4TKZA 3CT4A 3OWHA 1HLGA 5G40A 2G1JA 3P7MA 1N1EA 3JR3A 2PMDA 4C2BA 2OQIA 1QVZA 1ZOLA 2WOOA 4FZRA 4LG1A 1R4AA 3B70A 4JT2A 5CM2Z 4GE0A 5EE9A 2R4QA 3SQNA 4Y6GB 4HDNA 4NF2A 5FPSA 5CXSA 5LWQA 4TMZA 2W83A 5K6RA 4MUMA 3U9SA 4M1TA 1EKXA 4A92A 1CB7A 1Z56C 2A6PA 4BNDA 5C4IA 1FUKA 1NNUA 2COKA 2V6MA 3CBQA 2NUAB 3RW9A 3LGAA 3FR8A 1WO8A 4D80A 4MJLA 1HSOA 3FZGA 2PGOA 1VJDA 1V8BA 2WDPA 3QAIA 1XMSA 1G3IA 3O4JA 1K6XA 4R05A 1ULBA 1YHYA 4G86A 4U63A 3M34A 5E8RA 5L3RA 5LD2C 1FW6A 4KLRA 2G40A 3TUZC 1LHRA 4CLDA 3P9KA 4ENWA 1HG1A 3RC3A 1T5BA 1XDZA 5FL7D 4ZDIA 4JVOA 3K05A 5LXTB 4GR4A 3LKDA 1F06A 3TLCA 1EFRA 4GFDA 3NBYC 1X7HA 4PZZA 2F1IA 1I4OA 4ML3A 1JUDA 2WSBA 8MHTA 1QUEA 1CHNA 4CW7A 1PD0A 1VL6A 1I4WA 1NU6A 1G4UR 2IODA 6GPBA 2B37A 5L3QB 3GI1A 1MFPA 2EKPA 1IH8A 1K68A 3SQXA 1DWUA 3KBOA 3QXCA 1WAMA 2HQ1A 4UPVA 1XAJA 4DC9A 2P9GA 1ZAYA 1B6GA 1Y4UA 1KWGA 4J0IA 4GVLA 4J1TA 4UE2A 2NG1A 2OY0A 1DQSA 3WYBA 2OHIA 4U4AA 5IKMA 1AQNA 1HT1E 4V1CA 4BZQA 1WZIA 2LCIA 5AVUA 3AUUA 3K09C 1PV2A 2YWBA 2X8BA 3PPIA 1QP4A 1W75A 2X15A 3D4OA 2BJWA 1ZJ5A 1OWNA 3ST7A 2RH4A 2AMLA 3VO2A 3WKEA 4AB1A 2NTVA 2X9VA 3MCWA 2NV0A 4M22A 3H4IA 1Z5WA 3RANA 2QLJA 3GB9A 4M9CA 3BIWA 3OI7A 4ZZ3A 2NQ2C 3D0RA 3PHCA 1DKNA 5DNDA 4D9EA 1KMNA 3LZ6A 1OIXA 2ZTHA 3EF3A 3H5RA 3ZU4A 1TT5B 1BOFA 4I9UA 3L43A 1Q3TA 1I3CA 1L7BA 5M2QA 4D0GA 4KNWA 5FUQA 1U2XA 1VI6A 2HK7A 1LTHR 4KVFA 4BEJA 3UGTA 5BUQA 3ABOB 1DDGA 4FMCF 3TRJA 4UFPA 1WDLA 4G1BA 2HAEA 3L93A 4Y6SA 2GZAA 2AG8A 2GB4A 2IPAB 1ULUA 1MC8A 3LE8A 3LA8A 4MB6A 5D3MA 4E4YA 4N12A 4EY7A 4GRAA 3RAFC 3TAHA 4QAQA 1EZ4A 5EESA 4I1IA 2J09A 1JEDA 2VDOB 5EMNA 2VWHA 3GXOA 3U6BA 1SZJG 4TYYA 5ARDA 3L7IA 5F64A 4E7PA 3RARA 2H7CA 3OA0A 4GLBA 1MO5A 2QL9A 1AA9A 1LZKA 5J63A 1CUUA 1SAYA 3P9XA 3GN1A 4J49A 3FH0A 5AVJA 1G41A 2XMGA 3QV2A 4FSHA 1ZJWA 4WK0B 2VSFA 4GC9A 1WY7A 4G67A 2Y77A 2JZCA 3L1IA 3HJUA 3OF2A 4JUBA 3VUFA 3RFFA 1FYFA 2SKDA 2VJLA 2RHCA 2HHLA 3HWSA 5I7EA 2XTBA 3MN1A 3OWXA 4ENTA 3WBBA 1CEEA 2I2FA 3TSWA 5JZSA 1DJLA 1POWA 1HETA 2B1RA 1CX9B 1VXRA 2BMVA 3H8SA 2OQRA 3R75A 3RS4A 4CFSA 1DCFA 3QZUA 1TPYA 3ZW8A 3DC7A 4CIXA 4F5EA 4Y67A 1C1YA 1TAQA 1V26A 4N5NA 3LK6A 4OB7A 4W9NC 5BNFA 5CJPA 3W5VA 4MS1A 1G9SA 1WHSB 5FWXB 1CS0A 1REQB 4Z7NB 1YTLA 4HRYA 1NJ8A 1VMIA 3DLCA 1Q74A 9ATCA 1W7AA 5B58C 3OT1A 5JZVA 3QVJA 1UAYA 1F60A 1GNRA 4OYLA 4RVSA 4JELA 4JJPA 2JAUA 4N3CA 2FQXA 4PEVA 1SU4A 4RPCA 4XQCA 5CLQA 4QTYA 4G5YA 1WBJB 2VDRB 3VR5H 4M9UA 5BW6B 3AJAA 1E2QA 1UBRS 1U1FA 3NBQA 1G59A 3VU3A 5LN1A 3PHGA 1AHHA 4D1YA 4CLOA 1UKBA 2Z09A 3UJ7A 1ZOPA 5A3RA 1K06A 2CDBA 3WBKA 2YV4A 1E3WB 5EJEA 3MJHA 3COZA 1PT8A 2R2AA 4OQYA 2RD2A 4M9SA 2P6MA 4C6TA 3UWMA 3SQLA 1KYXA 4C0WA 4ZVOA 4MS4A 1RWPA 2ZDHA 3PNLA 3KSAC 2X6TA 4NBUA 4NZ9A 3BXEA 2A0UA 2L69A 3KOWA 4YC7A 2FZCA 3OQPA 5C31A 2LRHA 4FT2A 2HDHA 5LJLA 4MW4A 1D4OA 2BGRA 5I3CA 3I1JA 1BTOA 4P3XA 3HKEB 2BFDB 1J2UA 2C29D 3V55A 1HYEA 4KYTA 1K7EB 2R6JA 2FSHA 1H3NA 2QPOA 4UZEA 1T4CA 2CVOA 1Y81A 4C04A 2OYSA 4JYZA 2H5EA 1Z63A 2BEJA 1FB5A 1ZCAA 4NQZA 4XLLA 2W2KB 3IBSA 5IZCA 4X8OA 1Z33A 3KDSE 4MWZA 4UVGA 2RHBA 4AP5A 1UADA 3AB3A 1G21E 1LWOA 4DIFA 4HYEA 1LPNA 1QTRA 1SBTA 2Q49A 1I30A 1QS0B 5KX5B 1JA1A 3ANMA 3LT2A 4NAUA 4ND1A 3STVA 4NARA 4AZSA 1T6NA 4GUAA 4LNHA 4L0CA 1JDBB 2X8WA 2J48A 2F59A 2YOFA 1OX4B 2QMQA 2VO1A 3C5CA 3LCUA 3WHLA 4M46A 1NYQA 3M3DA 5IM5A 5BV7A 5DN6A 4M87A 1WB9A 4ME6A 2NZ2A 3WDKA 3HABA 4EG4A 4JOSA 1DBRA 4MP8A 2EJBA 1HT3A 2BELA 3KYCA 4PZUA 5A9SA 2CT8A 1V1JA 4BN0A 5A7HA 1G2PA 2G82A 1JZSA 3DBIA 5CH5A 5IJ0A 1R4ZA 5KKNB 5U4XA 3G5MA 5K0TA 1R66A 1RZVA 3NYQA 3ZNOA 1C7IA 5HRCA 2OV6A 4R98A 3CZCA 5EUCA 4CV2A 3EFHA 3DDNA 4DLAA 1Y6QA 1DWPA 1XZIA 4G1MB 4DSZA 2D7JA 4JI0B 4HYQA 4CHTA 1EDDA 4ATNA 3EG5A 2D1QA 3CTMA 4UHKA 1VP9A 4EF6A 2XCRB 4G0UA 3IKHA 1M7BA 3TLKA 4PYNA 1A9OA 2N9UA 1IEXA 3QKIA 2LUOA 4YASA 1ZJZA 1H2HA 2FLVA 4OMFG 3V2UA 3G2QA 1TD9A 3DL7A 5KYWB 4P3YA 3QCZA 3H84A 5FORA 4V0SA 1UKCA 4R2LA 2APJA 2HV8A 1KI9A 2LBPA 4XWAA 5IT9A 1J5EB 3N5KA 1R9JA 2ZTVA 4AKTA 1FMJA 1GQRA 2WP8J 5DLYA 4L7QA 1U8CB 1JG7A 3ESQA 4HO1X 4YJ3F 3WVNA 5GINE 3D81A 4ZAZA 1QANA 2VCEA 1RQRA 3U4HA 3JQ9A 1E5DA 4QPZA 1F38A 4WADA 2BEVA 3QIVA 4DV0B 2EBUA 4NFSA 5JJBA 4RGQA 3ZJVA 3IDOA 4H7PA 1NP6A 1XVLA 4M1SA 4OYRA 1P6QA 1FNMA 1MQSA 2X0RA 4X1YB 5IWCA 3CLRD 1J8DA 3I6YA 1XKQA 1JKIA 1UBFA 2ZJ0A 5CM5A 1ZVMA 5LB4A 2JJMA 3FMPB 3P9PA 4YX9A 4YS6A 3OPVA 4ND2A 3BHJA 3UUEA 4AN1A 4B3IA 1IBMB 5F7JA 3RIMA 1USKA 1FYEA 3P94A 1T35A 1D7OA 1RQXA 1HEUA 2WYWA 3RB8A 1Q6ZA 3V7UA 1Q20A 5FEMA 3ZQKA 3LHSA 3AM4A 1UWCA 2AXQA 2EATA 2MYTA 1H4TA 1WMBA 3ZWKA 1EEXB 4TT3A 1XEFA 1LWNA 3OZRA 4LBZA 2ZT7A 4P0PB 3M4YA 2AYZA 3FLAA 1P77A 3V8VA 1SZCA 1Y5NA 4RH3A 1P7WA 3FROA 2E85A 3MWEA 1FDIA 3ND7A 2AQIA 4K88A 5DU2A 3U3KA 5BN1A 1N32B 4MVWA 1CDZA 4N03A 5HF9A 3DHWC 5CNKA 4EA9A 3IRVA 4NAVA 1F0PA 4ED9A 5AHKA 2XHZA 1FNDA 4C05A 3LQFA 3O2JA 1VFNA 1B14A 4FFSA 4MVJI 4TWBA 4A27A 4INOA 4IO1A 4IYJA 3R3JA 2VJKA 4AIRA 2D5IA 1E3DA 4I1YA 4MLCA 4E1BA 1FTQA 1QIMA 3SLGA 3LQ2A 3WMWA 4Q37A 2VAPA 3MWYW 3UT0A 1SRRA 3FTNA 3MS7A 4LF6B 2W0MA 2YQ4A 5JMPA 1G2QA 2J07A 1GQQA 3I3OA 4LRTB 4BPBA 2YMPA 2FCRA 4R9NA 2CLDX 1ZGBA 2ACKA 2J9ZB 4K9PA 4RE5A 4XUCA 5IP5A 1XRPA 1R27A 1NQXA 4BC1A 4JT4A 2HJVA 1I24A 3H1FA 2GYWA 3O93A 3WZMA 4MJ7A 4AD8A 3VMFA 1ECJA 4WKOA 4R3WA 4EYOA 2JAPA 3H9UA 3I6IA 4KUEA 2CLOB 2WF7A 4NSNA 3FPKA 4QDXA 2PRKA 1RAIA 1R10A 3MSXA 5JSZB 5JUWA 1GUYA 4LXXA 4Q3OA 3NWBA 1G2IA 4B4DA 4S1IB 3L7MA 2FKNA 3CTPA 3Q3JB 1Y8QB 3L49A 4I8DA 5H16A 3ZQUA 3R9WA 1I0IA 2OXTA 5GONF 2RHTA 1E2NA 1MPXA 4DIOA 3L9WA 2Q9AA 1VJTA 2C3YA 3M8KA 1IVSA 2YHIB 4MHTA 3FMFA 4G9EA 5DCLA 2HW1A 3GQBB 2Z95A 1ETHA 1OTHA 3FX2A 1N8KA 1NTRA 4QOHA 5G0TA 2PUBA 4ZHSA 5AM4A 3IHKA 4CCSA 4FBMA 4Q03A 4UEQA 5DXJA 5LZ4A 2X13A 2FZKA 4PLGA 1IDOA 3DONA 4CM3A 2RIRA 3W5HA 1XXHA 3TECE 5E3HA 2FZLA 2GK7A 5HUHA 2YQZA 4GX0A 4M6WB 2V96A 1P18A 3DNFA 3MWKA 3V4ZA 1PG2A 1R64A 2VYFA 3HA7A 3HJNA 3PXAA 5TRWA 2XIQA 3O3MB 3O5AA 3FF4A 3Q7PA 1C0PA 4MGKR 1SHUX 2ASVA 1Z0ZA 2VL7A 4EY3A 1Y7PA 3AK4A 4AY3A 5IPFA 2Y0EA 1T34A 3MINA 5EP4A 3MPOA 1IY9A 1CQIA 1OFUX 2PGXA 3FI9A 3K5PA 4N3AA 5TARA 2JLZA 4TS3A 2WJIA 2Z8YM 4U3JB 3H2HA 2BR4A 3C8ZA 1LK7A 3KTOA 2WPNA 2QUBA 3LUDA 1U8FO 2GFIA 1NFQA 3DC2A 4HDKA 1KNQA 4IWYA 1L8XA 3SEAA 4O2RA 1USVA 1UXKA 2O8BA 1WPGA 2VP2A 1ZSNA 3A9UA 3ZY6A 3T4XA 2SNIE 4L2IA 4EZIA 2D06A 3NONA 1BOOA 2AYYA 4FI3F 3IMKA 4NV3A 1K3TA 5B6IA 5K2OA 3I39X 1VI5A 3C6XA 2CK3A 5DI9A 1ADGA 1DOAA 1OE0A 4OHPA 1Q0QA 1GITA 2FLWA 2PGIA 3DPSA 2Z8XA 2XB2A 3FA2A 1US8B 3NNNA 3OKFA 2IRWA 3AUSA 3O8OA 1FSSA 1DRJA 1VJ5A 2PMEA 1IN7A 3JQEA 4HDSB 3UENA 3N8HA 4GEKA 3K9NA 3PC7A 5F0ZA 1XDUA 2WIAA 4NEGA 2JHPA 3D4BA 1EFPB 2NPOA 5D5PA 2AI2A 3DM5A 1FL9A 2B2XA 5I9IA 4WZAE 3N2GB 3STUA 1FSZA 3QPDA 2Y1WA 4PIVA 4TMWA 4WNYA 1Y1KE 1HEIA 1O4VA 2C54A 3WGGA 3LNTA 3QIAA 4K0KB 2VHVA 4FR5A 3C6KA 1CR1A 2J7KA 2P2SA 2WABA 3O2NA 5F7ZA 1CD5A 3ZCTA 4IEFB 5K8IA 3K9HA 3ENZA 2BKXA 1TYDE 4OMDA 3RU2A 1HX7A 3DHYA 1NRIA 1EWVA 1QRRA 3I32A 1ULZA 3PHBE 4D0NA 1YJ8A 2HA6A 3MBIA 3PVSA 3QM1A 4HEA1 4IOLA 4L6AA 5H9WA 1RJGA 1VE9A 4DQKA 3HNPA 4UTPA 4QAJA 3WKCA 4MI9A 4ACAA 2A5LA 3TDKA 4L5JA 1EGAA 4F4JA 5PGMA 4D9CA 4PTZA 1TCBA 1KEPA 3AIMA 3T1TA 2XOXA 2M1ZA 4JCOA 3VDRA 4F7WA 4HL6A 1BO6A 1QH8B 4IZOA 1ENOA 3KWFA 1N5MA 5M5BA 2IVFA 1CY2A 2HX1A 3GZ4A 4HSGA 3B60A 5LNK1 3R0QA 3LPAA 3PR1A 1UIMA 5K99A 1VHDA 2VN8A 4MDYA 1CIVA 4RCVA 2M32A 4ZVMA 4O1GA 3C41J 3DBLA 1YZHA 4PU0A 1TVCA 5AI8A 4HAIA 3GCZA 2FGKA 2HCTA 1O9HA 2C2YA 1JYEA 3C3PA 1LNZA 4DVGA 4LQDA 4XIJA 3D8SA 2OEPA 3E81A 4RA6B 2QWXA 3ACDA 4OOFA 3IOCA 2PKYX 4WJZA 4EB0A 5BQ3A 5FEUA 4OLFA 2ZWVA 1Z36A 5AVZA 2QX6A 1EWRA 4RKRA 1WTAA 4QGFA 1LV8A 1H1DA 3L04A 4CQMB 1IG0A 3GN2A 1EK2A 3OLZA 3TL2A 3L01A 4JENA 3UB4A 2AKEA 1ML4A 1L5LA 1TO1E 2O2ZA 3RRMA 1Y3HA 1YH3A 1TKCA 4WLVA 3ZC3A 3IT3A 5FHRA 4D45A 4EAAA 1V5WA 2Y1XA 3P2MA 4IFBA 3UANA 1K0FA 3I2HA 4GL4A 2W71A 5LP6F 3LQYA 3OCXA 3DZ8A 1Z88A 3AHFA 1YDEA 2Z1MA 3B1QA 2RI0A 3I9MA 2Y93A 3EAGA 4L76A 3JSXA 5AOCA 4NE2A 3HGQA 3NVDA 2YXBA 4KCGA 3KX2A 4DYDA 3BD9A 1ABFA 1V4NA 3L6BA 5F1KA 3ROFA 4FYJA 1GY8A 3AXTA 1HE1C 2BM9A 2XUJA 5IW8A 1VKOA 2ZJ1A 3Q0TA 1GPLA 2BRUA 2I6SA 3HBAA 1KKUA 3OU6A 2G9RA 4PLHA 5MN6A 3DGEC 2HBZA 2NO1A 1XZHA 3AETB 4R01A 3PSHA 4DMKA 1TD2A 1BW9A 4JB3A 4V0KA 3V1YA 1A7UA 2C7QA 4X6YA 1T2EA 2IUSA 4Z3KA 5AW0A 3LWNA 3OIUA 4BO1A 1ZSYA 2HCFA 2Y76A 3VR5D 4CCYB 4J6FA 2OBFA 4XVHA 4KQGA 5JPIA 1T2CA 2QTCA 3PK0A 1QTNA 4C5CA 3H97A 1JQBA 3EXG2 2CL7X 1W49A 2YFYA 3JQBC 5BO5A 1PBNA 1XGKA 1JBKA 2IY9A 1J1IA 4PWYA 4L27A 4DEYA 2IC5A 2ZVJA 2VQ6A 3OTIA 3IAEA 4P22A 1OWMA 3O26A 4QDUA 4GZLA 4DHEA 4FMDB 4DR2B 1P2VA 1EG7A 2HA0A 2TYSB 3A6DA 4JI1B 4BC0A 1YR7A 4I4IA 1M8FA 1RHQA 2CNWD 4KSBA 4ZYLA 3NL2A 1ZGGA 4NS4A 1SHZA 2BV3A 4ZQCB 5EMJA 5FUYA 3WLNA 3ZD6A 4TWZA 1MMFB 3QVGB 2O8EB 1UB0A 4KC0A 2P5SA 2QUKA 5AOBA 4ABTA 2EL9A 2V7BA 3MCTA 3OJ0A 3SKXA 3IMEA 3UHJA 1VL8A 1KO4A 1Z15A 2B25A 2YL2A 1L9KA 3OD1A 1XRQA 5CVUA 3EPHA 1LVHA 4HDMA 1Z35A 2DPMA 2AQ8A 2OXEA 4UNIA 3INGA 1ONNA 2CVZA 4UM9B 4HJRA 5JTUA 1Y5RA 3E9NA 2GD1O 4Y1RB 2QRMA 3IHTA 4CLHA 3RBVA 1TF7A 3OTGA 5H9VA 1TEHA 3ZGZA 3DP9A 3FHXA 2AOUA 3QEMB 4IKPA 5ERXA 1DKOA 3B6JA 3UK6A 4B83A 1NAHA 3NOVA 1FMTA 5D3MB 5AD1A 1BX1A 1W1WA 4F5ZA 3VSBA 2ORWA 2IEIA 3ZGOA 2F48A 3I0MA 4HDCA 3G02A 5K4HA 1RXEA 1PJBA 2CF6A 3ZJTA 1T8RA 2EFHB 4EITA 1E6EA 2DTDA 3EFOB 4MI6A 4PSVA 4ZPXA 2DR2A 4FDMA 3VI3B 4B3FX 2QVXX 3W7BA 1KTVA 4MIKA 5DYGA 1P9WA 2IT1A 5KQPA 2RHHA 4D8XA 1IJFA 5EZ5A 4G36A 5DP2A 5LDGA 3CEJA 2FSSA 4DCMA 2PL9A 4KXXA 3B82A 2JFWA 2NVOA 3PUYA 3WGJA 4DIBA 1DG1G 5IVPA 2JFOA 3FFWA 1J0CA 2FXVA 1UJCA 3SICE 4I6EA 3TNDA 1NJ5A 4S1NA 5AW9A 3O73A 4XWYA 3ZN2A 4RD2A 1W0KA 2B94A 2PL5A 1SHJA 3EQ6A 1HDOA 2P11A 2G67A 3ND8A 4EELA 5TPWA 3REQA 3IMFA 4M1EA 1UKZA 4FCTA 3PWTA 1CR2A 5KYNA 4MS1B 1FLDA 4WXYB 3HU5A 4ZKEA 3BXGA 4N1AA 2FETA 2P1RA 4LISA 5EP1A 2PKWA 3NHBA 4V02A 3UGJA 5CA0F 1NMYA 1D5WA 3VNVA 2WT9A 4P4TA 1YQQA 2OYRA 3KDAA 2Z6UA 5F2EA 2ZFUA 3MBHA 5C46F 1U8XX 1ZUD1 1A9XA 4PQYA 1HQDA 2R87A 3N2NA 3K20A 3FIUA 3FCSB 5DK6A 5ALYA 3V97A 3H2SA 4K81B 4CR7A 2V98A 4D9IA 4O4HA 2RHOA 3UT6A 4ZK6A 2XWQA 5COJA 1JA9A 4P08A 1G8KA 4FQ8A 2CJWA 4J0DA 4RXTA 3DNPA 1PWXA 5JWOA 2DUNA 3A1FA 3I0NA 4P4UA 4TTTS 4OPMA 1ONSA 3ELUA 1TTTA 1PTKA 2YBDA 2CFTA 5IN4A 4HLDA 5FJIA 3G0BA 1GQTA 1F6WA 1AX9A 1B4DA 1EUDB 1KI6A 2RBEA 2ZAOA 5B55A 4PC7A 3A6ZA 4Y2TA 2BFCB 4Z4FA 9LDBA 2G06A 3JRXA 4DDHA 4EYSA 1DEAA 1NONA 3T61A 1AGRA 3L7KA 1DAHA 4JSRA 4Y9DA 4CIYA 1R4NB 2HRQA 1AQ6A 4W7IA 1XPJA 4BFVA 4EA7A 1S4MA 1OFIA 3O8CA 2IEGA 3OE7D 2GCOA 5FPPA 1KDVA 3JAMA 5CLJA 1MJ5A 1HXHA 4B6OA 4QYSA 4JI8B 4EUMA 1U3CA 1U0RA 2HGSA 3O7MA 3OQBA 1WF6A 2FEAA 2PT7A 3A6LA 3PGVA 4MVJD 1RHRA 3NTXA 4C08A 4JI5B 1J0BA 1YK0A 1ECCA 1ZLXA 4OYYA 3LOUA 4K46A 1DIGA 3NBUA 4P83A 5IMSA 4BO4A 4XVUA 4HFNA 2VJAA 1IHUA 1PVVA 2QK4A 3GHHA 4XTRA 3VH2A 4BJ6A 4RY8A 2QJOA 1ZD2P 5FTJA 4ZYTA 3VAZA 1WZUA 5TS3A 1TVEA 1Z38A 2BHLA 5E6UA 1JTFA 3O84A 4NWIA 3UFBA 1ATZA 2GXAA 4K9KA 1X7GA 3B6IA 5AKKA 1DJOA 4KIUA 2PKFA 1ZONA 1OROA 1KOLA 4RPIA 3FKJA 5DHSA 4PFJA 5AESA 2PUCA 1QGAA 4C7JA 2ZB3A 5IJ0B 2CNLA 1AD2A 4OKSA 5K4GA 1SOAA 1O6ZA 2PKQO 3BBLA 3G8AA 1CRZA 1KYVA 3TB6A 3AVWA 3VZCA 1T1SA 2QL7A 2ESRA 2EX1A 4Q3DA 4WY2A 2FZ4A 1U8ZA 1NSYA 3HVJA 3OEED 3PWKA 3V7FA 4D99A 4DQVA 3SYNA 2W0SA 4AWXA 1M8PA 2HY7A 4FE7A 2GK6A 4BKMA 3AKEA 3I73A 3QHAA 3PYMA 2JGNA 3M5CA 5AI6A 3RWOA 1UC9A 4F5WA 3CPJB 4E08A 5TR9A 4RHXA 4XVRA 2G7ZA 1MJGA 2BGNA 2PX4A 4YAIA 5BVHB 2ON6A 3EWSA 4EGSA 3RUAA 4J1TC 4ARBA 3O3CA 1L4MA 1P6UA 1R6XA 2RGUA 4LOKA 4AQDA 1VE7A 4AJOA 3ZWOA 1ZH4A 4E0BA 5EINA 1T36A 1QGUA 1CS4C 1CR0A 1GPAA 1SD2A 5AW5A 2QRVA 4CKBA 1NX9A 5BOSA 2EDAA 3LC7O 5EJ8A 2H1IA 4BGUA 3ZZMA 4QG7A 1DMSA 1PV1A 1EGHA 3ASYA 3LCRA 1F5SA 2BTQB 1I4EB 3QW2A 1N0IA 3AW9A 3KJZA 4US0R 1ECBA 4K6FA 4BTEA 3HUEA 3LLSA 1NP7A 4AS2A 4BCCA 5BUSA 4RK4A 1OI2A 5HE8A 1LW7A 3EH2A 4P81A 5K8CA 4HGPA 4QBTA 1IB6A 3A3KA 1GNVA 4IEEA 3IURA 4M0MA 1Z2PX 4QHTA 4RJJA 2TRSB 4E09A 1H0HA 3SS8A 3L8MA 2E21A 4OREX 1U1CA 1QG2A 3H1GA 3TKAA 4C7VA 4DW8A 4EFMA 3SWWA 2V3CC 3W8NA 4DR4B 5LYJF 1E4VA 2RGBA 2A0WA 4LVUA 1FMLA 2AMFA 2WHPA 3S8YA 1IHPA 4IXNA 3RGWS 1OAKA 3G2OA 5F52A 4EMSA 5BYDA 2AFHA 2Q5FA 2J5XA 3L18A 1Q7CA 2NXJA 1BQ3A 1ORVA 5IC4A 1AVTA 2BC9A 3IE0A 3MG9A 3Q6IA 4OK3A 4XLZA 5FV7A 5CCBA 1JSLA 5LCXA 2J5BA 4IYRA 3L0CA 4KKXB 2C97A 2VQSA 3UQYS 4NZPA 4IJQA 5JD4A 2SBTA 1GPKA 1HQCA 4O2LA 3KCQA 3UBOA 2GWRA 4XR4A 4BNXA 1D2NA 3LDAA 4RC9A 3K71B 2A9QA 3O8RA 2EP8A 4IVQA 1XDGA 5CDHA 1IEWA 3AR8A 4M60A 4TL6A 5E6SA 3K6SB 1SBQA 5LLTA 4PW0A 3PPWA 2XAUA 4PS0A 3AGPA 4DUYB 4ZAFA 4CDMA 2WNSA 2QW1A 1S2OA 2RI1A 1IZYA 1GUFA 1XHEA 1R6UA 4C0SA 5BWBA 2FPIA 2FPXA 4H2DA 5C52B 4I2NA 5DSZA 4YUYA 2RIPA 1E7RA 1MG0A 3AESA 4LWOA 4AJ1A 3TIVA 4YMTA 3DE5X 3BORA 5BXYA 1OGYA 2JARA 2RI6A 5AW6A 4K9OA 1SZPA 3F0TA 3ULKA 3VH1A 5K3OA 1PFYA 4J0GA 2DXIA 3IKLA 2CKMA 3RF7A 1NI5A 4KDEA 4P84A 2I6UA 3FDZA 3FM9A 2GT1A 4B3MB 3LV8A 2CBZA 2P1ZA 2BD0A 2E82A 4HS4A 1XTTA 2WUEA 2CLMB 2YWHA 4LGVA 3S2UA 3GJTA 3ZWBA 1L5HB 4F46A 3ZVMA 5C40A 5J2TF 1PR1A 2ZRDA 3G13A 2Z8ZA 2N3ZA 5AK5A 3GELA 4XGNA 3UJ6A 1BDIA 4L0QA 2OK7A 2WYOA 2ZJAA 4QJ3A 4HNQA 1YRWA 5JNRA 4ZIYA 2CXOA 4EFKA 3GDGA 1R5OA 3PDIA 4L8WB 1RE1A 1R0KA 2GNAA 2JLYA 4KREA 4GICA 3VH4A 2Q2OA 3W8RA 1O08A 1JFFB 3UHAA 2H0RA 1J09A 1AS2A 3EXIA 5K0EA 1ZLYA 1NUTA 3A9TA 4EYGA 3BFJA 3WFZA 2AFBA 2DDWA 4YLGA 3CF4A 4K40A 3DOUA 3GAFA 1LPOA 3PICA 2O2DA 4G89A 4BVFA 5IDQA 5A0FA 1GGFA 4KYIB 5F7XA 5LOVF 3TQCA 3AQIA 3F5SA 5A2QA 3LUHA 3H9JA 1XXHB 3OX1A 1ZNYA 4YPOA 3WK9A 4N0QA 1OWOA 2VK2A 2JPDA 2PS9A 4E84A 4MV1A 3IMCA 4Q7EA 3AYXB 2V78A 1UPFA 5EJGA 1JHZA 2EAUA 4G0NA 2AJDA 3VBEA 1LLQA 1SN7A 1AKUA 1EFVB 4OA5A 4Y9TA 3HCOA 1PUIA 2IEAA 3SI7A 4EZBA 5C3MA 4KQFA 2QENA 3OT4A 2DHRA 4UNNA 1OZHA 2R8ZA 4EVSA 4OA8A 2CHGA 4P86A 3VU9A 1LRKA 1NYLA 4MYTA 5IZCC 3THXA 1AUXA 5A0TA 3ZHQA 1XHFA 3ZZ0A 2QVZX 1N0UA 4NZZA 4HS9A 1RPTA 1QHXA 2X8AA 4RHEA 5EHQA 3A1DA 1M5TA 1EAYA 3PXCX 3QKWA 4P32A 4QEDA 5AJXA 4DJEC 4HDKB 4EVIA 3GLHE 1NVAA 2C20A 2H9IA 3GOQA 1EZ1A 4G5GA 4RTKA 4BLUA 2AWNA 2QG4A 3M1YA 1N5OX 4QTUB 5LU8A 4UD6A 4N6NA 1AKQA 2OC9A 3IPLA 1P4SA 4RVDA 2AUMA 1OA1A 4QHSA 4XWWA 5SZKB 1K7FB 4XGQA 4KO1S 4ZVTA 1X2EA 2GBGA 3GPIA 4G0VA 1GFWA 2I4TA 4H0CA 4I7EA 2XI4A 3FSJX 1E20A 5C8XA 1E9FA 1L7NA 3O8OB 1TK2A 4PCUA 4XUGB 2PYIA 2G1PA 1C30B 3GH1A 3NCHA 3FXAA 3EXG1 1X3LA 3D3WB 3ICVA 1CYDA 4KGVA 3CM0A 3D4PA 3PLRA 4TROA 3WMEA 4YP6A 4JA2A 1Y9EA 3NTQA 3VPGA 2H8KA 2PGAA 1BH6A 1R8XA 2ZSFA 3OJOA 3QITA 4N08A 3I9V6 3UMJA 3ZCPA 3IBCA 4F3YA 4KAHA 4XGKA 2I4RA 2WJAA 3PV0A 4MCAA 3UW1A 3I2YX 3W2HA 5CBPA 3KP1A 4DTCA 3E2IA 2NW6A 3GJYA 1PUJA 2FLKA 2WV7A 2ZTLA 2D4AA 2GN1A 3B9PA 3HLYA 5EZYB 4AJ4A 1JSCA 1E79D 4XWOA 2DFTA 3G9QA 1D09A 1J0EA 3FZNA 5FA5A 3QX9A 3JASB 4KBGA 2FHSA 5DYWA 1DT3A 1OBOA 4WNIA 4O1HA 1YULA 3GNLA 3JQ9C 1NV8A 2ETXA 3WRYA 2GM3A 3HVUA 5F4ZA 4R9RA 3G8BA 1RBQA 3JV7A 3MF4A 3LRTA 4YP1A 4LF9B 2D3WA 3H0KA 5CT6A 5KSPA 5BN4B 1YUBA 2ERYA 3HBMA 4YRTA 2IK8A 1FRNA 2PTGA 5J2UA 1XRLA 2WSMA 3B38A 3LQ1A 4KR9A 4BAUA 4E8ZA 2CMGA 4MVJP 3UXHA 1PR9A 2QD3A 2JK0A 4D82A 3BQNB 1QHHA 3ZWNA 1VLVA 2GZDA 2VC2B 4ZZ1A 2PXHA 1QAQA 4H4CA 2WIFA 4CVMA 2P0EA 1ACJA 3K2QA 3I30X 3IOYA 2ZT8A 5IANA 2XGJA 2YWRA 3HB7A 3HCBA 3MJFA 4EAQA 4CEJA 3HDTA 3B12A 1YONA 5KNCH 1MO6A 2BSQA 5AUQA 4YJ3A 1H0KA 1P4AA 5EIBD 4UBNA 1V1MA 2QRKA 3IJPA 1Q6YA 1V5GA 2XWJI 2HZ7A 4GYKA 4CFZA 1VMEA 3ITKA 1PDOA 1CUEA 2P2ZA 4BY9E 5K8TA 2A9PA 3Q3HA 3RUCA 3T9DA 2A0YA 1YZ3A 2FEKA 2ZR7A 3SU8A 5BPFA 2WFLA 3AVUA 2LE0A 1RABA 5COQA 2W58A 2YCBA 1JHXA 2QVCA 2ZRLA 1UKAA 3HKCB 2W70A 4DUZB 1HV8A 1D0IA 1VPEA 5TC4A 4DA0A 2ID8A 3Q2IA 1UZLA 5ADWA 2GXSA 1HFJA 4KBFA 4UNRA 1X80B 4MCIA 3REGA 1R4MA 4ZYYA 2IBTA 1VSBA 3PDCA 2XMCA 3HZZA 4A2PA 2JEZA 1H8ED 3S2GA 4ZICA 5FTNA 2XODA 4M99A 1CP2A 4G0OA 1Z25A 5GTDA 1ODLA 1W5FA 1SPBS 1M6HA 1QGED 1I4LD 1T9ZA 2YXLA 3JALA 3OTHA 4QBKA 4W7HA 4Z9FA 4F9FA 4ZCQA 3H75A 4FXPA 1CDEA 5IN5A 3VNQA 1VMAA 1LY1A 1SCUA 1SBHA 3UV6A 4TRNA 1O0BA 3D0OA 1XYYA 1BFDA 2H00A 2AV6A 5HIMA 2FPOA 1GZHB 3TMAA 4BO5A 1AK1A 5A4IS 2PUFA 2HIMA 1Z18A 3OF3A 2Z6QA 3RUPA 4BVEA 3BRQA 1FP1D 3GL9A 3ZPXA 4F2PA 1E0JA 1Y98A 1XZDA 1QH9A 1UPBA 3OOSA 4OBXA 4WCFA 3T7KA 5FBLB 1TAHA 4E5VA 4EA6A 4EJ6A 1U3FA 1YA8A 2OBBA 3QYJA 3SZMA 3IUYA 5A4AA 1G38A 1D5CA 1Q5PA 1W73A 2FPPA 2IDZA 2PX8A 3L1VA 3O8BA 4IX1A 4U9HS 4CFYA 4LRSB 2VHQA 2V65A 3AR7A 5BPHA 2KSQA 4DV3B 1IEQA 4NMHA 4E33A 2PVSA 1JBWA 5BSMA 3EUEA 1X1CA 2WM3A 2V7PA 1VL1A 1RT9A 3PL5A 4MPJA 3Q2OA 5CFMA 1CUYA 2GPTA 1QIJA 4W6QA 3LS2A 1M33A 3FYUB 1E6MA 1J1UA 5EKUA 4G26A 1XZGA 2BZ1A 3O38A 5HCUA 3KELA 1N0VC 4PHCA 4XDAA 1CUSA 1L6RA 4NX2A 2ZRHA 4J0FA 2Q4DA 1QHYA 2Q2VA 5CHYA 2PD3A 4ENUA 1EWYA 2JAWA 1Q1GA 4RVCA 1U3WA 4H7EA 2P65A 3Q92A 1N9KA 4X1KB 2ODQA 1YIAA 3HSKA 3AEUB 3EGDB 4RHFA 1VE3A 2YHUA 3ZV7A 1OLOA 4EGAA 4Q00A 1E60A 5DYIA 3I5MA 1NJGA 1ZINA 3ILXA 4X3CA 3MZ0A 3WBFA 1HL3A 2YJ3A 2J59A 3D8UA 1RXSA 1DEOA 3HJRA 2ZE5A 5JT1A 3VOTA 3KZ1E 4HDAA 4KDCA 3SSOA 3DPIA 3PQ8A 4TUYA 1OJ7A 1R5JA 2YYZA 4RL4A 2HXYA 3KUUA 3KE9A 2M98A 1SVSA 3C7KA 4L8VA 1YSCA 1KR2A 3KHUA 5I9LA 1VLZA 2G9VA 3G17A 3OUTA 4I8XA 4L8LA 3GLSA 2YKGA 3B6MA 5M3BA 2JG5A 3EYWA 5AVSA 4DKXA 4Q48A 3O9MA 2CB9A 5EMHA 3R0JA 1E2FA 1KHHA 3OY2A 3W2EA 5LFAA 2VDKB 2FDRA 3C4QA 3OAAA 1UOOA 3QPAA 3FY4A 2B61A 2QEQA 2QI9F 4S24A 3PFKA 8GPBA 4M8LA 3AKCA 2NSYA 2D00A 2ZI4A 2PKEA 1OUMA 1SVUA 3BL5A 3FCEA 3REQB 3RUIA 3P2OA 4E70A 1SHTX 4X41A 1SXJE 2OSBA 3ADKA 4PO8A 1ZVJA 1RFUA 3VR6D 3E8XA 2FU5C 1QB7A 4YRLA 3SKVA 4PHGA 3C6ZA 2BLLA 4PZAA 4BE7B 3DJYA 2J7PD 5DHFA 5JVDF 3JAKB 5K2MA 3SJBA 1HDCA 4FNOA 2ZRMA 4RSMA 3RKSA 4JITA 4RTJA 4QVKA 1ATIA 3T41A 5B2FA 4W5RA 2ZYTX 3IQFA 4OHZA 3F3SA 5MDHA 1ZGZA 5HJEA 1Q50A 5KIAA 4BP8A 1UXJA 4WUVA 3AFGA 1M54A 4FTWA 3WQQA 4V39A 4ZCIA 4G41A 3K1AA 5JMWA 1F6BA 4QPNA 5KSOA 5ALFA 3E0XA 3PRYA 3GZTB 4B8YA 1HE4A 5DP1A 5KJCA 1EE9A 1WYEA 1GEGA 2GRAA 2BFBB 4AQYB 4WFQA 3H11A 5HM8A 4QZVA 2RGEA 2QIOA 4XRGA 1N2IA 1QGOA 4LVCA 4Q1FA 4ZP1A 2GPAA 1D1TA 2P9JA 1WSBA 1C29B 1UDCA 3RK4A 1F5NA 4R8KA 3BJMA 3TX6A 1Z0FA 3AEKA 2PRSA 3JYOA 5CJ2A 1VTKA 1KI4A 4AZVA 3HY4A 2AFIA 4HMQA 3BH7A 5COBA 5A5GA 3KV1A 4DLTA 1O6FA 1M34A 2ADFA 4JGIA 2W6MA 4TKUB 3T15A 4ZIRA 5I7UA 5LQJA 1ZVVA 3D3NA 1DC8A 3MOIA 3W5SA 5KDLA 3JD4A 2PS1A 4YJDA 2QM0A 1VI2A 3E05A 3ONEA 3Q10A 1N2OA 3ZVLA 3N53A 1RVDA 3N86A 4Z8XA 4W99A 2DR0A 1C0LA 1XRMA 5K8JB 1BU5A 3MTAA 1FXSA 3SBDA 4YFYA 1FSPA 3AZQA 3IE1A 4AO8A 5B4VA 1QHFA 2FSGA 3W0LB 2YHBA 2YIDA 3KSMA 2WTEA 4OFXA 1VKJA 1ZKDA 3A26A 4CIVA 4MB0A 1JEAA 3FWHA 2WYUA 4XD7A 5TX7A 1W5SA 3TG2A 1QU2A 4JNKA 2AJPA 3BSSA 2QTLA 3PQ6A 1KYTA 3TRIA 4UMFA 2O8EA 1CUXA 5HGXA 3DS8A 1P1RA 1Z29A 3EVZA 4KE7A 3WNZA 2F6RA 3FUVA 1Q57A 3HYNA 2VHUA 3I1YA 3KJIA 3PUIA 1EQUA 4K1LA 4TZ6A 2GCEA 1BDHA 1EB9A 3LYUA 5DT9A 1EHIA 1RZRA 3HCNA 2R6AA 3H3FA 1JR4A 5E2BA 4UEOA 2BRUC 4JODA 3TE7A 3JQ8B 4KPGA 3N2KA 1WXFA 1XAIA 2VQDA 3BS4A 2X0JA 2EXXA 2VRCD 4MVJF 3AHEA 4ZOLA 4NV0A 3IE7A 1JEJA 5A3QA 3ZDQA 5K0JA 3DV0B 1JHDA 1PHPA 4ZHQB 2IIPA 1GUAA 3CNBA 3K0HA 4MYRA 4OJMX 3RM5A 2JI7A 1NRXA 3BJZA 5FULA 1V39A 2ONJA 5ALIA 1K8YB 1XALA 2IZOA 3C48A 4DA4A 4JY7A 3U7QB 1I2BA 1ILWA 3BTUA 4R1SA 3A6JA 2VNJA 1QFJA 2DDMA 1JKFA 1ZD1A 1M0TA 1QFMA 3H2YA 2AVDA 3G9XA 4MQEA 4I3GA 2BPOA 1EDZA 4XA8A 5EWMA 1T8UA 3W4IA 2P2CA 4RLFA 4CM4B 2XTNA 4Z4IA 1LH0A 2YVUA 1M66A 4DBZA 3IKTA 3KQTA 3DWGA 1XZLA 2IYUA 3E82A 2I6XA 4PGFA 2NU7A 4AWBA 4NYJR 2GFQA 1Z08A 1ZPDA 4IHAA 4XIIA 2XQFA 2ZUWA 4M7WA 4YDSA 3UUFA 1XTSA 3MTIA 2I7TA 1GPMA 1RR6A 1FFHA 1Q11A 2VTKA 4F11A 5IKOA 4FC6A 3G2LA 1UOPA 5D86A 3DDWA 1HWYA 2RGWA 4FFOA 1FQJA 4LFCB 4OKIA 1OYVA 2X8JB 1PNRA 1JBEA 1GXSB 5DMXA 4Q3AA 4K6GA 1N2GA 3E7DA 3DYVA 2AFHB 3PDUA 4YWHA 3F78A 2K2WA 4M49A 1DUVG 4XZ3A 1P80A 1KPGA 1Y4DE 3GDWA 3GW8A 1T2FA 1QKKA 5JS1A 1YBHA 2NPFA 2WJZB 2YFKA 3BXXA 2ZCUA 1OV6A 2ANBA 2I99A 2MJLA 2WKQA 3C8UA 2Q5RA 3RY7A 1DBSA 3MTEA 3QVVA 4OH1A 3WMRA 3WWZA 4GM6A 4O2AF 3FWYA 4Y2VA 1FFCA 4FCVA 4J75A 1T1EA 2XBUA 1NSFA 4EDFA 2C4TA 4KK4A 5CVJA 2LKDA 4IVPA 2JAQA 1TKRA 5KREA 1R9GA 1NQAO 4TVOA 1X9IA 1MJGM 4LHXA 1G8GA 3AR2A 1CULC 1TJNA 3A7EA 3R2JA 1EE2A 1ZH0A 1CUZA 1D6SA 3SR3A 1E8NA 2F64A 3VHRA 4EJSC 5L51A 1R0YA 4FMCB 3U13A 1NR1A 4DT1B 1V1RA 1HZZA 4NBWA 3ILYA 1U3UA 2QTWB 4MO9A 3EPJA 1WQ1R 3LI2A 2EWMA 1X0XA 1P4JA 7ABPA 3IQ0A 3CVJA 1AG9A 2GEVA 4ARVA 4HLNA 4BX2A 1PGPA 1T1GA 4UBIA 2HBYA 4I81A 4MUKA 3IR6A 2HJHA 3P52A 4FN5A 4ZREA 3GAZA 2PV0A 5EEGA 2AXEA 2I2BA 1LC3A 5FYDA 2AZDA 3IDSA 4NHOA 4JIMA 1GRVA 2BY4A 4IG9A 4RD1A 5EIAA 3I6QA 2XZTA 4Q21A 4RDCA 1DZIA 3I5AA 3VR4H 3TRFA 3PDIB 4CMEA 1GAEO 3FZQA 5C1DA 1A9PA 3FPFA 4CM1A 4ER6A 4YMGA 1KVRA 4KODA 3UAOA 3MXTA 2OZKA 3HA2A 4GU5A 3PVCA 1QIHA 2H07A 3AVPA 4ZC1A 2X5OA 2DY1A 1TEVA 2QRZA 3WKAA 4AT1A 1JHAA 1NUHA 1OXBB 1ZZEA 3D1VA 1Q77A 2NT4A 2P75A 3ILSA 2OGWA 3M6LA 1TE2A 4MAMA 5EJFA 1X42A 2ZRJA 3B1YA 4NULA 1DLIA 2IIQA 5FNVA 4QU5A 4FB5A 2DH6A 1KDYA 2KWIA 4GLOA 4OVKA 3SX4A 3KZOA 1EFLA 5CA0A 1IVNA 4HWTA 2BUBA 3PXEA 1IB0A 3KZKA 4ZZ0A 4YMIA 4AUEA 2NQ8A 3LSYA 4B73A 4B3XA 1EKQA 2YWCA 3T7RA 4URZR 3AOEA 3L8HA 4DA7A 1CNFA 4GI2A 1ZI9A 1CBUA 3RS5A 5SY9A 1B8UA 1K6MA 1STOA 4GMGA 3WLRA 4DMUB 3HM9A 4QJBA 4INAA 2NSDA 1JIIA 3GAAA 3KT3A 3OQIB 1N2XA 3O6VA 3MTBA 1II8B 4J1QA 4NBRA 1SKAA 3SZUA 4JX8A 3RC9A 4OLJA 1II9A 2HUNA 3KSRA 4RMNA 2CXNA 3RVRA 4ARZA 1VG1A 3LZDA 4BTLA 5B2EA 1KC1A 2QTVA 1IBKB 3U37A 4MAFA 1L7VC 3BTSA 5FPQA 3ZTYA 1D2MA 2V6JA 2QMYA 2XV1A 2XKJE 3D5QA 1E69A 4UU0A 4YCLA 3ISVA 1Z7YA 3OIYA 4NZMA 1JH9A 2QYTA 5FIUA 4BLRA 3RQXA 3GHYA 2PYDA 2SICE 2IUEA 1L4KA 1A8SA 3TAXA 4PCAA 2Q5IA 3VU0A 1IN5A 1KBQA 3WP0A 4W5HA 3KSZO 3B3JA 3IULA 3SYRA 3IIJA 4IIJA 2OUIA 4B32A 4WRRA 3VYUB 1JEYB 1PZGA 3EQZA 2H65A 5E9WA 3UAVA 2C5SA 3GBVA 1K98A 2OB1A 2PO5A 1WA5A 4IRXA 5IAOA 2N47A 2W8BB 4Q4AA 4DCGA 3GUZA 5HRAA 4AROA 3T5CA 2A5JA 5EJAA 1J2JA 4YBZA 2Z58A 1Y3DE 1QIIA 4RPGA 5G1NA 2ZJ3A 5JC1A 1L5WA 4RDIA 2H9AA 3DYBA 7YASA 2JJ1D 2WV9A 3DZBA 3HEBA 4WTOA 2XZPA 5G41A 5BMVA 2ZIZA 1BWRA 3ETEA 5I9MA 4A5OA 3NJRA 1UFOA 4PONA 3UKJA 3X1JA 3NHZA 3L4KA 3Q85A 3RRXA 3I83A 4DV6B 1VCIA 1L7RA 2M9MA 4PS1A 1QGZA 1NLZA 3LCJA 3LP6A 4BNZA 5L7TA 1XLVA 4JL6A 3SF8B 4FFWA 1LBEA 3WWEA 4Z9AA 1F8XA 3A4LA 2NTJA 4LECA 1MF7A 4RPHA 3WGQA 3WLMA 1JWAB 4YP9A 1P9OA 1QDLB 2Y05A 1M67A 1Y8RA 4NYJQ 1URPA 5IEJA 2JJ2D 1GNLA 1K6IA 2D54A 3G0OA 4F4IA 4MI3A 1QHHB 1ZW6A 2A4KA 3SC2B 1QAOA 2D13A 3BJEA 3D6TB 5FADA 2FEXA 5JU6A 4ARAA 3WMGA 2XYRA 2Q50A 2G9NA 1VG8A 1E7YA 1W4LA 2MDTA 4LBVA 4AMUA 3WLOA 5AKZA 4ENVA 5JHGB 1L3BA 1MB3A 3TX2A 3CLTC 1E7MA 2P9YA 1BEZA 3QXGA 1QH1A 4PYMA 1U2SA 3CSDA 2P6RA 3CLKA 4F2DA 3JQPA 3K30A 3B89A 4JBYA 3A2NA 5HDQA 2H0QA 1MG5A 1L3CA 4LOJA 3GXBA 4D3XA 1GKUB 2WFLB 1ZISA 1IRIA 2XY4A 3FHCB 2YWDA 1VI9A 1UP4A 3U4CA 5TMBA 1XF9A 2F1RA 1COZA 1J1ZA 1D0SA 1G6HA 1OAOC 3LVRE 2B92A 4ODIA 3C1AA 3AL2A 3JZDA 3L0BA 5AKGA 2Y9PB 4F3RA 4GX1A 3E9DA 4KU4A 2WG1A 5ENZA 4QTXA 3V7NA 1MNQA 4FBGA 3SN6A 3TLAA 3PPXA 1SH7A 3EF0A 2ZDGA 4CQLA 1NUQA 2H59A 1WB6A 3EEIA 1YUMA 5AUOB 7AT1A 2MSCB 3EOAI 4RVHA 3R9XB 2JI8A 1LBSA 2YXNA 3Q8KA 1Q83A 2GH1A 1ODSA 2GC5A 2ZRNA 3KQUA 3JALB 1X7XB 4S1VA 4XDYA 3KZMA 2VCHA 3CKLA 1PZHA 1NU8A 3G7NA 2ZM5A 4C5KA 1CK4A 3HVKA 3IUJA 3LC2O 4A0QA 3RIYA 1S0UA 1R00A 2HA7A 1EFCA 1XVVA 2OT3B 4IX9A 4A0GA 3A06A 1C3JA 3DXFA 4XASA 1O4WA 4DLRA 1C2TA 4LNAA 4LRUA 2Q3LA 3QU7A 5FWYB 1N7HA 1CUHA 2CFIA 4EW2A 2WI8A 2O2SA 5B7GA 2CDNA 1N2EA 4D0LB 3KQYA 1VHLA 2DHEA 4MKHA 3VDQA 3WRVA 3IDQA 4EYQA 4UHFA 4WCFB 3U5ZB 3DT6A 3KCNA 3QPBA 4FHFA 1F2VA 1RQPA 4A73A 1NVBA 1U0TA 4C7XA 2VKQA 2PKKA 1KVUA 1JFTA 3HP7A 1OJLA 4CKCA 1ZUNB 1B8VA 1G7SA 1I6MA 1Z17A 2FPPB 2CZGA 3QE4A 1PZEA 2GSDA 3J81k 5F23A 3HJFA 1KIMA 3CH4B 1N2BA 1F8FA 2R3SA 3BMOA 3V48A 4ICIA 1SKYB 3GRYA 4FHEA 3ZIDA 1PQPA 3BGIA 1O54A 4IXWA 2VVTA 4Q4HA 3PKZA 3E35A 1P4HA 5J1TB 3KJXA 1BA3A 3RFXA 1SCJA 2IUYA 1EH5A 3CLSC 4OBEA 5EZ6B 4BO0A 1AO3A 3DE2X 4CHGA 1NZFA 2Q1UA 4K3UA 5KPDA 4LYDA 1A9TA 3OEYA 3GGOA 3CUWA 3L82B 4NYIR 5J2TA 1QVWA 3CUKA 1NOJA 5B1EA 5GJCA 3T8YA 1PAUA 4FEYA 3I12A 4EOHA 5IAEA 3OU2A 1GZ7A 3KKZA 1ZITA 2BZGA 4NMLA 5IDVA 3WDSA 3HDQA 4V0MA 3ZK7A 1ZN8A 2J5RA 4G0PA 1WBBA 4I4NA 1MHTA 1AQYA 2GCAA 1EGQA 1ZRMA 2MT9A 5GONB 2G8NA 3IT2A 3K2EA 4HMPA 4U2CA 5AI9A 4C76A 4E12A 1MVNA 2CBXA 5DW3A 4DADA 1XMXA 4B84A 1ZP6A 4YP5A 2C2WA 5L7YA 4YXWD 2WAYA 3GDHA 3IAFA 5LOVA 1NI3A 1TGYA 1KZ1A 3NIBA 3TZKA 1W5EA 1M7HA 5GVSA 1E18A 2CNOA 3KJEA 4YT8A 1YD7A 2PA0A 4BS9A 3GJSA 1GCAA 2VWQA 3QMWA 2W4IA 1KVQA 1ONOA 3GMSA 3OZEA 3MWJA 4BDSA 1X7ZA 4O02B 4AECA 3AJDA 5CPBA 5LYYA 3T7AA 1KPIA 5K4AA 4MWEA 2LVBA 4NU5A 2YNMD 4TMXA 5FTKA 3KKNA 1WY5A 1YS7A 1NF3A 4S1TA 4XR9A 4ZO4A 3STXA 5CITA 5INTA 1D8AA 3OZVA 3RSCA 2HL6A 2R7LA 3ESZA 5SYNA 5IX8A 1VKHA 4YY3B 1K4KA 2A7XA 2JBWA 2WJJA 3IEUA 1G18A 1QIGA 4ZVKA 4O4LB 2OA0A 4LVNA 3KFVA 1UMDB 4M88A 4PQRA 3T3EA 1JXIA 1V19A 1ULHA 2P5TB 2YJNA 5DM4A 1EXVA 4H4EA 3VZPA 1L2LA 4Y2HA 2GEJA 2EWVA 1TI7A 4J0CA 1ZMRA 3ZI4A 3ZCSA 1KAQA 2OG2A 2W7TA 3RYCA 2I4OA 4DREA 4MRMA 3UHOA 1RWQA 4F2GA 1IL0A 2Y1EA 1GTVA 4AZ3A 5CLLA 2OKGA 4JB2A 4NCNA 4UOZA 1EFAA 3DWFA 4MYSA 4MLDA 2QOEA 5E4JA 1KKMA 3DLBA 4JB0A 3V4RA 3C98A 1LQUA 3OC6A 1Q17A 1G6OA 2YY7A 4HV4A 2EIHA 3H74A 1G5RA 2H6EA 1PR3A 2E5WA 1JB9A 3H11B 4A16A 4YRDA 3NL6A 2WU1A 5ECGC 3IJRA 1OC2A 2AJ8A 1DXOA 3A1CA 2ZJZA 4DLSA 4UHHA 4S0XA 1S6YA 4X7BA 3FPJA 4UDOA 3W8EA 3ZTTA 2PGJA 2FOLA 1QFXA 3AEKB 4HVAA 2V58A 3URMA 4Q0MA 1QLWA 4W9MC 4C2UA 1DHTA 3BMXA 4N7MA 1CY8A 4PZPA 5DLDA 1TIBA 2AFIB 2QR2A 5IM4F 4EY4A 3MMNA 3CJTA 3DQZA 2FMKA 1N6HA 3FW1A 2VP0A 4GM4A 4D56A 2EP7A 4EG3A 4TV9A 2XUAA 5DTJA 4AY2A 4I6GA 1C4WA 2IPMA 2X8LA 3MTJA 5FCDA 4YEDA 2DWPA 1ISIA 3UK7A 1XEXA 2CN1A 4OATA 4IH9A 3U7RA 4FGJA 5TQ0A 4AXBA 3WIBA 2JLBA 1E1DA 1H6CA 5EQDA 3X2SA 1PFGA 1RM0A 3GLVA 4DCVA 4DWWA 5CDUA 5JIBA 1CIJA 2EF0A 2JCBA 3KPWA 1E5XA 1N2SA 2ZRQA 2XQIA 3GFQA 3E0QA 5F4BA 3UN1A 4GI5A 1RPNA 4OGFA 5ICEA 5KU1A 1PRYA 2C84A 3EVTA 3NP9A 4GLLA 2ZU0C 3RQ2A 1QQ7A 1XJCA 3IAHA 3JYQA 3UPUA 4B40A 2GK4A 4V2UA 2OAP1 3ZHXA 4LZPA 2P9CA 4ZEWA 3V46A 4CDRA 3DO8A 2J9RA 2XDAA 4MQBA 1GTJ1 4BQPA 5HCIA 3CVOA 1CUVA 1NW3A 1GIAA 3T3GA 4D43A 4HGOA 4NMMA 4KWCA 2C4KA 1ZJJA 1KZGB 2V8BA 2YRFA 5E6RA 5CX1B 4D9FA 4QWWA 3EZ7A 2YV5A 5J3JA 5EYPB 4EPVA 3AR3A 1MDFA 1WXQA 4H77A 1UBMS 5F2OA 2ZROA 1T8PA 1ZN9A 4FUQA 4JOBA 3MRXA 1M6YA 1E0KA 3ENWA 3Q1KA 1XA3A 3EC1A