3RSQA

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima soaked with nadh
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
490
structure length
490
Chain Sequence
HMKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative uncharacterized protein
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
total genus 175
structure length 490
sequence length 490
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rsqA01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3rsqA02
3UQEA 1TZ3A 3MBHA 1LHPA 1V1AA 3KD6A 3KTNA 3B3LA 4E84A 3B1QA 3DZVA 4UBEA 1LIKA 4K93A 2VARA 5TRWA 2YXUA 4XF7A 3RTGA 4C5MA 2C4EA 4EOHA 5C40A 1BX4A 1TZ6A 4LCAA 1RK2A 3JULA 4E8WA 3NCAA 3RREA 2DDWA 1V19A 3CQDA 1RKSA 3GO6A 3IE7A 3RQXA 5C3YA 2NWHA 4K9CA 2C49A 3RU3A 2I6AA 2DG2A 3IBQA 4DU5A 1TYYA 3H74A 3RO7A 5CM5A 1KYHA 2A9ZA 3B1PA 2PKFA 1JXIA 2XTBA 3BF5A 3BGKA 3RSQA 3KZHA 4E8YA 3UQ6A 4K8KA 2DCNA 4DC3A 1LIIA 2HLZA 1UA4A 4C5NA 2PKKA 4K8PA 2R3BA 4WJMA 3LKIA 3IH0A 3NL3A 2PKNA 3NL6A 1ESJA 2AWDA 4C5JA 1YGKA 5BYDA 2AJRA 1RKAA 3ROZA 3RNOA 3ROEA 3RTCA 3D3JA 1EKKA 2HW1A 4O1LA 4YWRA 3RRFA 3ROXA 1JZTA 3RRBA 1GC5A 2FV7A 1VI9A 4KALA 4E69A 3NC9A 3RT9A 4C5KA 3MBJA 4KANA 5EY7A 3RSSA 3RSGA 2AX3A 3RS9A 2DDMA 3NL2A 2Q5RA 3RQ6A 4E8ZA 1LHRA 3NC2A 1YHJA 4EN4A 1UB0A 3UBOA 5C41A 5C3ZA 3RPZA 3RQQA 1C3QA 3NM3A 2ABQA 4E3AA 3RRJA 2F02A 4GM6A 3UMPA 4KAHA 2QCVA 1VM7A 3Q1YA 3RY7A 4LBXA 3RTBA 3NBVA 2I6BA 4JJPA 3GBUA 4K8CA 5COJA 3N1CA 3RQHA 4LBGA 3NM1A 3RQ8A 5BYCA 3RS8A 1ESQA 3RTDA 3Q92A 1RFTA 3RTAA 2JG5A 3I3YA 4O1GA 1RKDA 1LIOA 4B8RA 2JG1A 2QHPA 2V78A 4B8SA 2AJPA 3KEUA 3RTEA 3DRWA 3UQ9A 2I5BA 3VAQA 1V1SA 1VK4A 4EBUA 3UQDA 4X8FA 3QA2A 3RPHA 3HYOA 2DDOA 3IQ0A 4XF6A 5EYNA 3K9EA 1LIJA 1JXHA 2PKMA 3IKHA 3FHXA 3PZSA 1YGJA 2JGVA 3OTXA 5F0ZA 3LOOA 4N08A 4N09A 4S1IB 1EKQA 2F7KA 3B1RA 4S1HA 3LHXA 5TQIA 2HQQA 4JKUA 3RQ5A 3PL2A 3K5WA 1WYEA 4XCKA 5BYFA 1RFVA 3ZS7A 3NBWA 4PVVA 3RM5A 4S1MA 3RQ2A 3RO4A 3VASA 5BYEA 4YL5A 5CGAA 2AB8A 3B1NA 3W4SA 2A9YA 4XDAA 5CGEA 3D3KA 3RSFA 1GQTA 1U2XA 3HICA 3LJSA 4KBEA 4U7XA 2O8NA 3RU2A 3IN1A 2ABSA 3ROGA 2RBCA 3QAIA 4K8TA 3HPDA 1L2LA 1DGMA 1RFUA 3FHYA 3NL5A 4K9IA 4LC4A 4C5LA 3B1OA 4S1IA 3EWMA 3H49A 3GO7A 2R3EA 2YXTA 4EUMA 3RT7A 1V1BA 4KADA 2AA0A 3UMOA 1TD2A 5B6AA 4JKSA 5F11A 2AFBA
chains in the Genus database with same CATH superfamily
4HNVA 2R8OA 1DPGA 4IRXA 1J0EA 2J0EA 5A05A 3UCXA 2YJTD 3CLTD 3VQTA 4ACAA 1M6EX 1AQUA 5HIKA 1NUAA 2CVQA 1SHLA 4GPD1 1AQNA 4K93A 4ETIA 5EP4A 1DRWA 1KRXA 1YZQA 1UC5B 3JZMA 4NDNE 3E3NA 1V7PC 1EJ6A 2XHEA 3OTIA 3LXRA 5EWMB 3AESA 4HLUC 2IUEA 3IV9A 3ZDYB 1YZHA 2FMUA 3SJCA 5C5DA 4Y6RA 4CCYA 1YRWA 1K3TA 3K09A 4BXOA 1T5IA 4I1OA 1CYEA 4GLOA 3AEZA 5JISA 4JSTA 4HYYA 2NN3C 1V1RB 1IB6A 2ZIXB 4Q7MB 5CA1F 3MWKA 4OA5A 4O0MA 3GLGA 1Z8DA 1SVWA 3HA2A 1CJVC 1CJCA 4C01A 1SCJA 3AGPA 2A0UA 4CQMA 2J3QA 3STTA 2HDNB 5ALSA 4UHFA 5DULA 1K3UB 1ZN9A 3EK2A 4TVOA 3N07A 3UMCA 1CVIA 3SZ3A 5CFRA 2Q9AA 2IJGX 1RAEA 1ZBDA 3HVHA 4K86A 3UXEA 1EXWA 2PUJA 3FKQA 4IX1A 1UOOA 1D7OA 2R44A 4N7RA 3RT9A 4CNQA 1AKUA 5FUVA 1AO0A 1X2BA 1CJUC 2HWKA 5TGTA 1XXHB 3STHA 2WNHA 2PKCA 3ZDZB 4QQNA 5B57C 3C1UA 4K7JA 3EBOA 4TSFD 1DV2A 2GJAA 3JQBA 2YZGA 4HEHA 5AKXA 2O8FB 3Q11A 1RJFA 2GF2A 1OZ0A 3TVYA 2D3TA 4J0CA 4AROA 1RXVA 1MJGM 1OZGA 1RZUA 2AEMA 2LGJA 2QWXA 3O9ZA 3OUUA 4JC4A 3EN0A 4ERNA 3KVRA 1C3VA 1ZUWA 2PA3A 2V3WA 2JGAA 3VVMA 2GC6A 3IE0A 4OUKX 3DCIA 3H1BA 4A03A 4BUZA 1CRPA 2ZIEA 1UF9A 1ECJA 1XALA 3K16A 3N8HA 4LBWA 4OTZA 4MS3A 1GG5A 1MTOA 4P7JA 3RB8A 1ODIA 1R6VA 3VU0A 1QKIA 3JQAB 1MPTA 4UU1A 2IDKA 1EB8A 1U9IC 2GB4A 2Z83A 5ES4B 1N4AA 1JLHA 1XTZA 1VPDA 1PQUA 2OFXA 2VP4A 2HXGA 3BMOA 3C3PA 1GZ7A 3DTVB 3IAUA 4II7A 4W7IA 4EBUA 3B6JA 4RU1A 1NASA 3VJRA 2I0FA 1JJIA 1SCAA 1YQQA 3ZNQA 2IEBA 5JADA 3IQ0A 4NS4A 1VLVA 2YBDA 1D1PA 1YI8A 1EFHA 4I19A 4OAPA 2PKYX 2XB2A 4HLCA 5K3EA 2WG1A 3HSKA 3E1KA 4FN5A 4DM4A 5CG1A 4LNUB 4Y9DA 5EJMA 5IHPA 1XTSA 1N7HA 1WDMA 2O2DA 2Z1MA 4IMRA 2L69A 3A4VA 4HAUA 5KTPA 1C14A 2FOLA 2HJWA 1HEUA 3ZIDA 4QFMA 4CV2A 4DA8A 5EJ6A 5HXAA 1W8IA 3RVQA 4C2UA 1QV7A 4M49A 4EEXA 1Z0JA 4KH0A 4ALNA 2RH5A 3TI9A 3PEFA 1FK8A 1UMKA 1V43A 2QJWA 2SKCA 1T4GA 3KB1A 3R09A 5CA0F 5FWXB 4CMIB 5TLSA 4YY3B 2DOKA 1U2SA 5AXAA 2VWPA 5AK3A 1WMFA 5JWRA 1NYRA 1GPUA 2AA0A 1SXJA 1UKBA 2EW8A 4BE7B 4DV0B 1MAUA 2O0MA 4HK4A 3KQLA 5LP6F 4JI8B 2E3JA 4HWGA 2NSJA 4OF4A 1K06A 1PR6A 1NQTA 4LHEA 1HX7A 2R66A 1N3LA 4WK6A 1RZRA 1V3VA 3KR9A 1XVVA 3TCKA 2PSHA 4BVEA 3L8DA 4DNPA 5LQUA 1J7KA 4BNFA 1FNNA 1VL6A 1VTKA 1I3KA 1R2QA 4J7CA 3TO5A 3DZHA 4N1AA 4YHHB 2JZNA 3LL7A 2OC4A 4GLFA 2C49A 3FY4A 3PEUA 1EHCA 1X1RA 2WTEA 2NVWA 5H9VA 2JLUA 1B4DA 4YMHA 5ELLA 1XZBA 4WLNA 3H5OA 3VPDA 1E6CA 4QAQA 2VF8A 4REQA 4DG8A 1MABB 4I6GA 5EFZA 2DWQA 1SBTA 1XZ8A 3D1VA 2DQYA 4WVFA 4E2ZA 4EYKA 4M8LA 1SOMA 3N86A 1EIWA 3EGOA 3KJQA 1TM7E 4MR7A 4ZTBA 4C5NA 1OYWA 4PLFA 1EKXA 3F47A 3ESYA 1MOSA 2BEVA 3SZMA 4FDUA 5ALPA 4P58A 1OU4A 4UE6A 1INLA 3A36A 1IRIA 1K7CA 3CWZA 2OENG 3AR4A 3K8YA 3OICA 3C45A 2GHTA 1UQRA 4N5MA 1Z73A 3FAKA 1R10A 1E1QA 3PEEA 3WO0A 4MP8A 1V8BA 3P0EA 2I7DA 4FBMA 4U7HA 1CC1S 1NW6A 5HVNA 4LJKA 3SZLA 4MB6A 4AG3A 2H1OA 4E88A 1ENPA 2M2IA 3ZE7A 5C41A 3LP6A 4W9NA 2HRZA 3HJGA 4YS6A 3PDCA 3V97A 2VJYA 5CXQA 3KOMA 4ZKDA 3TQCA 3K9NA 4NZOA 2FPPA 2QLFA 3M9XA 4O4IB 4QXQA 2IUFA 1PO7A 3HL0A 3ZUGA 1VIMA 4B7UA 4ZI7F 1E8NA 1FYEA 1USKA 1XWIA 5CK5A 4O6VA 1DS6A 2ZUDA 4I6JA 2IYSA 3VU3A 2HSWA 1GP2A 4H6PA 3RVBA 4WESB 1QLWA 2XADA 1ONSA 1T2NA 3AVWA 1I7SB 2BGRA 4G2TA 4YT2A 4FXOA 4G1CA 3C1TA 2ZZNA 3OFNA 4A73A 1NNLA 4LSGA 2VLIA 1ZIOA 4Y2PA 1G7CA 2FEOA 3NGMA 4M46A 3QVUA 4ENVA 3M9LA 5GAJA 4ALJA 1IHYA 5ESWA 2YOHA 4NULA 3MQ2A 4WK2B 1TM4E 5FEUA 5KHOC 4Q9JA 1MT3A 1FP7A 2PL9A 1ZSVA 1L4UA 4EJMA 1PSDA 4PGFA 3D6FA 3MN1A 3GGCA 4NMMA 4PC7A 4X8HA 2YN4A 3VZDA 4II2A 1EQAA 2OFPA 4TOIA 3I28A 5DLEA 4FE3A 3KV1A 1U4SA 4G85A 4G5HA 4HDCA 5E6UB 2CHQA 3DVAB 5LM3A 2OZPA 5EKTA 3LLMA 4R2HA 4IIJA 5EZYF 3PCRB 4AJOA 1O9HA 4IGFA 4FB5A 3QEOA 1GYQA 5AKHA 2BRUA 2YXEA 1JIQA 3NUZA 4HNHA 4JL6A 4N5LA 1BXZA 5K3AA 1IVNA 3WQBA 1NBEA 4XSVA 4MEBA 3WY9A 1LRJA 4I5FA 2YMLA 3SM3A 1O54A 4AQDA 821PA 2XCLA 3AONB 1Q0LA 2NNWB 4G0QA 3HDYA 1BZYA 2X9QA 3DE6X 3UT0A 3L1IA 4MQMA 3TQSA 4OQZA 2MJLA 3KQTA 4UEJA 5J23A 1AGNA 2ET6A 2AFBA 3MJRA 3VDQA 1QIKA 3QNWA 4XRRA 1F38A 4YV0A 3KV3O 4TT8A 2VNHA 3EYAA 3KQMA 1YZ3A 2C7PA 3R0ZA 2QVXX 2HU8A 5IKPA 1BX4A 4UVHA 2RHCA 1OR8A 2RGNA 1U0GA 4MS4A 3KPYA 2E6UX 5EMNA 4F4HA 1GRQA 4L2IA 1W0KA 3MGBA 3PUHA 5L40A 3QU4A 3VPCA 1IZ9A 2ORWA 5D2CA 3ULKA 4IGEA 4M4SA 4Z53A 4PHGA 2PYDA 2VT7A 4S1NA 1TIBA 3MJEA 4AMBA 1FJXA 5AI6A 4DUPA 2OQRA 4X1YA 5F4ZA 1SUWA 1ANKA 1W5BA 5KNBD 3AIOA 3BIFA 1J56A 3ILHA 1O5ZA 3F6PA 4Y2SA 4JVLA 1YJAA 4UDYX 1D2MA 1T5TA 3CZ5A 5JNSA 4FYPA 1YFKA 3QUTA 5KX5F 3HY4A 3IIEA 5CFQA 1T9KA 5A4KA 3FUWA 3QMWA 5F3DA 4JA0A 2DAPA 2H54A 3IESA 1YGKA 4XJSA 4B32A 1QR2A 2P4UA 1E1NA 3R7SA 2V6JA 1LSUA 2A59A 4RPGA 3FPCA 1ZH6A 2IU6A 1L1FA 1RKBA 2VDPB 3WBFA 3AEYA 4WT7A 5IZ4A 4Z4HA 1O6BA 3HO6A 4DCPA 4JVMA 4TLLB 3LX6A 1P9WA 2Q4TA 2VTKA 1QH1A 1X1QA 1X7YB 3HI6A 3RSGA 3F5MA 3OE5A 5KVAA 1B1AA 1ORTA 4OXYA 1I36A 1PZEA 5I9TA 5FO1A 4FDVA 5FBQB 2PFGA 3CLRD 1CDZA 3CF4A 3HYNA 4RIFA 4U5QA 1FDOA 1I24A 2DQKA 3VOSA 5B12A 5GV7A 1O58A 3UJNA 2ABWA 5K3SA 3Q1YA 2OQIA 4GR5A 2G9QA 3LLUA 4LWOA 1ZSNA 1KFEB 5CK4A 4R2JA 4C6SA 5K0CA 3G0BA 3OH8A 1HA3A 2QAJA 4HVAA 3K6KA 3ENKA 1CIPA 2K2WA 4LE2A 4AJPA 5INTA 1X7XB 5JS1A 4CEIB 2XY4A 1MVLA 2J5RA 1JYSA 3WAGA 4D99A 3EXFA 1MC4A 4YUYA 5DOZA 4D8VA 3OZXA 1JGTA 4PYQA 3VOBA 3FHCB 3F2IA 3S1SA 2JGIA 1PFKA 1UOEA 2VAMA 3MIZA 4WADA 1NE2A 2TECE 4B8YA 1TM2A 4EPVA 5E9JA 2VYNA 1E1KA 1IVYA 1WCYA 4YRZA 2W7TA 1PR9A 1COWA 5THKA 3LXMA 4FWTA 1D1QA 2XTMA 4M7WA 5A3SA 2QTRA 5E2IA 1BD4A 3PHIA 2AOXA 4B3GA 4ALMA 1MA0A 3ZWNA 4P4SA 2HQQA 2WI8A 3E5HA 3M6XA 1ZD1A 3RWBA 1KY5A 2J9RA 1NHWA 2QM3A 2WOJA 1IQRA 2IY8A 1T0IA 2ZJ3A 1SCQA 3L0PA 4B46A 3KELA 4LBYA 1YQWA 4TWBA 5HBGA 3ZU6A 5C8DA 2D74A 2PQMA 1LWNA 1E6UA 1GZ6A 4LRYA 2H7VA 4BFWA 4UU8A 4LQCA 2JGDA 4D41A 4CKCA 4JMPA 1K4MA 2WT9A 1UJ4A 3K32A 4PYJA 3HL4A 4GC9A 3NKLA 1ZQ1A 2Q7DA 2GJSA 4Y1RA 3NV9A 1Y3DE 4ZRNA 4TL9A 3QSYA 4JH0A 1J4AA 3C6MA 3ONNA 4XQGA 3FHXA 2A4KA 3FZQA 1CUXA 4ASUA 2HCJB 4N3GA 2H07A 2O1EA 4DIDA 3OZTA 2ZM5A 1PZMA 4RHCA 1P7VA 2J8ZA 3PKZA 2XJ4A 1ULTA 5F2NA 2C7OA 1KSHA 1N5IA 4OMCA 4YWJA 3A1DA 4AIRA 1DBWA 3F90A 3HMKA 4ESHA 1EP9A 1IK4A 4GP9A 1J5PA 4QBHA 3RUHA 4Q7KA 3FDZA 4DA9A 1V5FA 1GPNA 3UFXA 2PUDA 2ZI6A 4ZVNA 2AMJA 4DEYA 4MEJA 1S2MA 4B80A 2FF5A 3ZJUA 1D2CA 3OBBA 5CNIA 1PQ4A 1ICIA 1M8KA 1XKTA 1J07A 4M1KA 4MJ3A 3UWDA 1X39A 2PH7A 4P86A 1XTPA 2H08A 1VGQA 1ZD4A 2QRMA 3LUJA 4QWMA 4BYGA 5GTDA 3MMPA 2AN3A 2VHWA 1ZEMA 3KTAB 5E6RB 5L9AA 1KHTA 4EKEA 3LHKA 2YCLA 4MNTA 2NU8B 3UJ7A 1EFKA 3FLEA 3L0OA 4HH1A 5DN6A 3UO8B 4CLEA 5IT0A 1H2RS 1QCDA 4FHDA 1QRRA 1T1RA 1XZCA 1I3CA 2H17A 4TTPA 1N0IA 1KAMA 3JQ9A 3K9GA 1GLVA 1MAAA 1GUFA 4CEHA 4FKBA 2JHAA 4UMDA 1ECFA 3FDJA 3QVWA 1E62A 2C4TA 5FV7A 4MVJH 3KPJA 2X4DA 5LKAA 4TLAA 3LY8A 4HR7A 5FUBA 4JI6B 2VUTA 2WAOA 4FW9A 221PA 4HDNB 3E2MA 3X2SA 2AG5A 4RTMA 4Z99A 4GBJA 4IMPA 2OPBA 4N5NA 4G01B 2ZIAA 5CCDA 1KSJA 3OIUA 2BH2A 1KIAA 1UBGA 3CZPA 2Y1FA 4HZUA 2A9PA 4J0HA 3GK3A 3HY3A 4UBNA 2CLSA 3DHYA 1W36C 1USGA 2QAGB 5I9LA 2GCAA 4YCCA 2O8EB 3RS8A 5HWSA 1Y5IA 2OBXA 2X8LA 3IQIX 4CM8A 3SDBA 5AKKA 2WVAA 3DTYA 4G1EB 3Q1KA 2XVMA 2ZR9A 3M4JA 3OLYA 3NG1A 4Y1GA 3OSUA 3VR3A 1ZVQA 1MEJA 2EJVA 3G8AA 1UBFA 4G0OA 1KAHA 2P3OA 2XQJA 4IVRA 4L76A 2OFFA 4D79A 3R4CA 1UIRA 3A9TA 1GZHB 5CM2Z 5LNK1 4X8FA 1VSTA 4FOPA 3QXCA 3JWJA 1JLKA 1B6GA 2GN8A 1WULS 3QFFA 4M0FA 1N8TA 5IC5A 1N77A 1RWVA 1W78A 3CF6R 1FP2A 4YR9A 3BEDA 4ND3A 3WIDA 4BMOB 3GLQA 1X1AA 1FFEA 2W2NA 5BPHA 5FT9A 4L8GA 3GFTA 4JVNA 4QGFA 4WERA 3ZDRA 5CCXA 1NF3A 1U11A 3AG6A 3PSHA 5CXSA 3OQHA 5IF9A 1FXUA 5IKEA 1BE8A 2H0RA 2I5PO 2XUDA 3EJ6A 1GAQA 3MUOA 2ODAA 4I55F 2ZSKA 1TQHA 2FVYA 4UOEA 3HM9A 2X7HA 1W47A 3O31A 1CUUA 1ZISA 4D9NA 4CEJB 3JAKA 5C2JB 2OCPA 3C8MA 5C1DA 1IEQA 4AB1A 4EB0A 1UC9A 3NYQA 2IUSA 4D46A 4LJLA 4MRPA 4EA6A 1PJ2A 1EX6A 4ZIYA 2X86A 7ABPA 1UKZA 4HL6A 3L82B 2ZBEA 4N5IX 5KYYB 2A78A 2P6UA 4RD2A 4N9WA 4PZDA 4K9LA 2QRPA 1KP9A 3DV0B 5CXXA 4YXWA 1PZNA 5LZ7A 2QU7A 4YMGA 4AKGA 3QPDA 4GOOD 3ZVKA 1OKKA 4NATA 5HRUA 3TPCA 1QHHB 3DMGA 5DNVA 1A76A 2D5BA 4EYGA 1C7EA 3CUWA 5ALGA 5ADVA 4PFJA 4RF2A 1QZZA 2HHAA 3W4IA 1CB0A 3H11A 4G0NA 4D0LB 5LQMA 2XMCA 2Z43A 5ALEA 5H4HA 1QS0B 3H6GA 2GH1A 3GBSA 2XKBA 3F5SA 3WLNA 2ZIUB 3RUPA 3CS3A 2FN9A 2WWWA 4TV8A 5IKMA 2H1HA 3MB5A 4H0CA 3IAS1 4IEEA 1U3FA 1Z2DA 2XZTA 2K7ZA 1X42A 4JXKA 3MB8A 2VYFA 2XMSA 1TPYA 1WB4A 1NNUA 2NXEA 2W6OA 4NONA 1MQAA 4RZXA 4YMVA 1A3CA 1F60A 5FA5A 4CVKA 4FNOA 4BRZA 2XD4A 3EE6A 3OLXA 3A06A 4JNKA 1GU1A 1U3CA 4E21A 2X9LA 4UHBA 1GPBA 2DBZA 4OAOA 4YRKA 1GGNA 3VR2A 2XMBA 2LTAA 4TLBA 2O06A 4F86A 3COPA 4YJHB 5IEBA 1NN1A 2QUKA 5JR3A 2F62A 3HC7A 3L0SA 4QXPA 2D0OB 1J8QA 3L7YA 4NV1A 3R6WA 4DJTA 2PX8A 5FORA 1OA1A 4J7XA 3ABQB 3DT8A 1D6SA 4CKBA 5LZ9A 3C3AA 4N47A 1AS2A 4LPKA 2W5UA 3IBYA 4OATA 4WFQA 4DARA 4QYWA 1QUFA 2HPVA 2HWXA 4V0KA 4UCQA 1JIIA 4BU0A 2CL7X 1A27A 4X7RA 2V7QD 4LOJA 3NORA 2XRZA 1Q7GA 2IY7A 4UULA 2DBVO 3O2JA 5FBZA 2H1WA 3NWPA 1DJQA 3SEFA 3WAKA 4EZBA 3A1NA 4O3FA 4PGMA 4CL0A 2WTAA 4IRMA 4EKIA 1H2ZA 3ETGA 4YAJA 4Y98A 1JHRA 1M5RA 2AT1A 2QZJA 2W6MA 2EFGA 1T9HA 3F6EX 4BX0A 3DE2X 1D09A 4JLJA 3AR7A 3ELDA 4QOSA 4H0NA 2YVKA 4QHSA 4AJ2A 1IK6A 5KU1A 5TVGA 3V1UA 2QRVB 3OHMA 1TOAA 2ECQA 4MV0A 1OTHA 3KJIA 1IEXA 4Q39A 5TB5A 3EEOA 1KOFA 2OUKA 3P0IA 3NJ8A 4JQOA 4K6KA 2OA0A 4R0MA 3RLFA 2KWIA 3KOZA 2R8RA 2QD3A 3BRCA 4GO1A 1E32A 5CTJA 1XDSA 3F7OA 3PZRA 3LFHA 3JASB 4OGGA 2Y1LA 1DAHA 1NXVA 1UK9A 4QOIA 5EPUA 4FGUA 3SWWA 4YL5A 2V0GA 1X87A 2CJWA 4CVLA 1TEVA 3OBIA 3H5AA 2VRCD 4OXQA 3EX7C 2P9TA 4FMCF 4KRXA 3FSGD 4PPNA 1T36A 1WVIA 4K88A 4C4RA 4ETWA 2ABSA 1O5TA 1KDRA 2VJLA 3WGVA 2DZDA 3W2TA 1FRQA 4TTIA 1AKYA 1GIAA 1L4HA 5BSFA 1CRWG 2CD9A 2VHQA 3FOBA 2G1KA 2VBFA 3D8UA 4M7RA 5F3WB 3P2MA 2GCOB 3QVLA 2GESA 3VV3A 1XU7A 2X4GA 4BO0A 8ATCA 5IWCA 3WMRA 4KR6A 5FA8A 1EK0A 3ZE9A 1G60A 2JGKA 2YYSA 4L08A 1OAAA 1PS0A 4LW8A 4MRMB 1TO2E 3MQFA 2VARA 1NBMD 4LKOA 3L0CA 4B3JA 1DBIA 1JHMA 3KVVA 2VYVA 4QUKA 3CLSD 4GMFA 1QQAA 4TKZA 2VHCA 1U7XA 1Y3CE 3ZLTA 2O5RA 5EINA 4BO5A 4V3BA 2WSLA 2PBZA 1XRQA 2ZB8A 2H2WA 2JATA 2O2HA 1L4NA 4L28A 3HYTA 4HNSA 1GKIA 1ZIYA 3VC7A 4DU5A 3USZA 5CYGA 1I4EB 3C6XA 3TWOA 3L8MA 4X00A 3V2HA 2ERYA 4H18A 4PSVA 1KH2A 4C20A 4DM7A 3UK1A 5ITWA 4ZD6A 2ZTVA 4FZ5A 3H65A 3S70A 3NBQA 3FB4A 4AYTA 3HEAA 4K8PA 3EVDA 1ISMA 5DBOA 5BN4A 5LQDA 5T4EA 4DY4A 1MDFA 4WBSA 1P5JA 3FPEA 3KOWA 1LNZA 2J4CA 3DMYA 1NG1A 3N70A 3A11A 4C0XA 1NFRA 5C8ZA 3NR2A 1JPVA 5FNVF 2D1FA 4X92A 1UBOS 2XI4A 1TKBA 3OOYA 3ZK7A 2HW1A 1NVWQ 4GD3Q 1VGRA 2VJOA 3BXHA 3PGA1 4OSOA 3WHIA 5G40A 1DKUA 3PHJA 4IQFA 4DJ5X 3EARA 3E4CA 3QZUA 1A9XB 1C3JA 4E5SA 1QGAA 3N0WA 3PDHA 4F4UA 4DQDA 4WGFA 1W7AA 1AQYA 2ZAOA 3SYKA 2DERA 4Y2VA 1ADJA 4KP7A 5ECGC 1F2DA 1GUAA 3L6CA 4QQFA 3O4IA 5ALTA 4CMHA 1SQ5A 4BUBA 3W5BA 1TYZA 3DLCA 2BZ1A 3SEZA 3GLGE 1T43A 2AUTA 3BAFA 2CXPA 1KS9A 2FXVA 3T1OA 3KSAC 1TB4A 4FM9A 4H7DA 5EEHA 1T9BA 1JU3A 5MN5A 1G5PA 1Q22A 3L77A 1M2EA 1FYXA 1PE0A 1W4BA 3WADA 2V6BA 3BJRA 1RACA 3JWPA 3PI6A 2HQOA 1L8XA 3ASYA 2Q6TA 3Q5DA 4BQPA 3HXLA 3PCXA 4WOJA 3EWSA 3QOFA 5BNIA 3N2EA 3GAMA 4JP1A 3O94A 4OSEA 1L7DA 3D2AA 4TT3D 3R40A 1H1DA 1IDOA 3QV1A 4LOAA 5F35A 2G6BA 5D86A 2QYOA 3R7WB 3SXUB 1JR3A 4YJDA 2PM8A 3DUFA 2FZGA 4KPFC 2I9KA 3BZUA 4PNHA 3OP4A 3L4KA 4AN1A 1ECLA 1WD7A 4BC1A 1KO4A 1ZM3A 2Q21A 4JUFA 1TGVA 2F4VB 2O0LA 1OJ7A 5JYEA 3ZTTA 2E4UA 3T1VA 3TBKA 2JS7A 3SR4A 3TJRA 1P3DA 4MW9A 4OG2A 4JLMA 4RLQA 3FRHA 2YVAA 5LZ2A 3SQLA 1IQ0A 1O1YA 1WOMA 3AF0A 1WLSA 3ER9A 3AM3A 1L5MA 1GXSB 1EVQA 4IUDS 4D6PA 3AR2A 3NTXA 3OTWA 1VJ0A 1WKVA 4QLOA 5ER9A 1KEKA 3VH4A 1KFCB 1YIDA 4Y7CA 1G5HA 2XMGA 1YDFA 4QRHA 4EG7A 1TYAE 3GQBA 1SA0A 1CY0A 4KPUA 1XTUA 4QPCA 1AVTA 3DKRA 3RIEA 3R5JA 3TRJA 5BV0A 3JQPA 1K63A 1PNRA 3BH6A 4TUYF 2V8BA 4JJ8A 2QTBA 4GR9A 4AN0A 2O7QA 5HFJA 4UDOA 4EUSA 3PNSA 4GGPA 1AGRA 2P2GA 3ANTA 4CCAA 3TRIA 3IUPA 2ATVA 3FHLA 1U9CA 2INGX 5EWMA 3A25A 5KC9A 4AUMA 4DCJA 4HDMB 3VZCA 1P9RA 1E1MA 1TGYA 3UV3A 2FAXA 3C8DA 4PW0A 1RKSA 3P9NA 4XM1A 5JD5A 3HKDB 3PNVA 3ZD8A 4EFDA 3P52A 4H3HB 3VH3A 4TQ9A 3S99A 5BN3B 1EG7A 2HWWA 3RYIB 4IHJF 1ZO8A 2FUEA 2IHJA 1UDWA 4BMNA 2IVFA 2YWEA 4C14A 4OYYA 1SXJE 3DM9B 5HFNA 4AG6A 1FYDA 3BUSA 2PD6A 4TRNA 5J5CA 4MJXA 1H85A 1EE2A 2DPXA 1IBLB 8AT1A 2OGUA 1NU8A 3L8EA 3GUZA 3L92A 4U7WA 5DMHA 5DPMA 1MX9A 4TS3A 1T24A 1W36B 2FUCA 4YVFA 2FJ0A 1DQPA 4FMPA 2IYAA 1NVFA 2J6HA 3B6IA 2VCHA 1JAZA 1GTJ1 1YGYA 4BX8A 2PGXA 2X3YA 4D4MA 3CCBA 4MS1B 4URWR 2Q0XA 3W1EA 3DBIA 4E5YA 5JC1A 3GGSA 1NSYA 1YI1A 1ZUHA 1LGYA 5EZ6B 4KXLA 3NHLA 1YR9A 4D97A 3H3XA 4WV3A 4DDTA 4LXYA 4H6XA 3FCXA 5TC4A 1KDPA 3NM3A 4KPYA 1MB4A 4D4GA 2C2HA 2NZJA 5FOXA 1U5BB 1MT0A 1G3QA 1VPEA 2G70A 4J1TC 2GKOA 1XMIA 2NADA 2Q2VA 4ND6A 4WAUA 2JANA 2PX0A 3HJTA 5EQFA 3ZX4A 4HDRB 5I7FA 4K9MA 3LDHA 1D1SA 2DECA 2I6SA 2DYKA 2PFSA 5DE3A 3T8YA 3Q3VA 4LOKA 1FNDA 1LBIA 3VVLA 4UCFA 3E9CA 1VPWA 1OFUX 2DM6A 1K5PA 1C9DB 1XLTC 2Q5QA 3OMXA 1CY1A 4I99A 4TXJA 4YDRA 4YP0A 3R7LA 1KK1A 1JN0A 1FX0B 5BVHB 4FR0A 4ECEA 3HKBB 1VHQA 4XGRA 1E2MA 4PZCA 3PFIA 4NJOA 1SB9A 1PT8A 1G38A 1XMVA 3GEEA 4HEQA 1UC4B 1XRJA 2YWHA 1NMEA 1OXKB 4KE9A 3RWOA 3TE6A 5NLLA 4L8WB 4MO9A 5C8XA 3A4TA 4RELA 2EFHB 2EJBA 2NPOA 2EGGA 1UM8A 1RI5A 2A5LA 2ZI9A 2QE6A 2VHEA 3DB2A 3BA6A 3MEQA 4C76A 4R9SA 4NMXB 1OX6A 1LDNA 2NU6B 2OEPA 2PMBA 2ZRDA 5U4XA 2LCIA 2XIJA 5B64A 1H3NA 1FFSA 5AHXA 3E81A 4YEDA 1PWHA 2P9FA 4EB6B 1SUEA 4JHLA 2WSSD 3EF1A 3L4BA 5KWJA 1MKYA 3Q98A 4LZPA 3FG9A 1X38A 2EARA 4ZEXA 1JDZA 1BIFA 1H2EA 2P7HA 2XGGA 5EIEA 3AHDA 1K5HA 2ZQYA 1L6RA 4CYMA 3KEGA 3DPSA 2GJ9A 5BRAA 4LOLA 2H5IA 2LRHA 2O1XA 4C0QC 4HGZA 1B8UA 1LBQA 3IBSA 4HWSA 1JFSA 2WNIA 2AI3A 2QYSA 3BSWA 3D43A 3KQVA 1TTTA 2XB4A 2VLBA 3MGCA 3SZRA 4XIFA 1ULBA 1EXNA 1W36D 4EKDA 3IUBA 1XTTA 1G8HA 1ZNQO 1RCTE 2P5SA 3I73A 3KJFA 3QLJA 3QUSA 3GEMA 4U9UA 3TXXA 4N39A 2P2LA 3T5AA 1MABA 4GLBA 4EUFA 1ZN8A 1XRPA 1UFRA 4PZLA 1YR8A 4XLLA 5CX1B 1Z08A 3VR5A 1WETA 4OPMA 4NPCA 2Q5HA 1D1TA 2ZW9A 3FTQA 2Z5GA 3GPLA 1JXIA 4IEIA 5IAKA 3PT9A 2WUGA 4WEOA 4G89A 1XRMA 5KWSA 4PLZA 2F1RA 4Y6PA 3TSWA 3AW9A 4R2IA 2GEFA 2Z98A 4DRXA 3I2JA 1NM5A 2X15A 3R9WA 1EQUA 1W4CA 3F5DA 4S05A 1ESJA 2RJNA 3I5XA 2D62A 3AB7A 2Q1SA 2X77A 3L0ZA 1LNQA 5DTMA 3VAZA 1K6MA 2F3PA 1JQ5A 1U2GA 4JI2B 1E3EA 2XSZD 3A2LA 1VLMA 1Y4SA 5CIQA 1WUIS 2OCKA 2R751 3CUUA 5EY7A 2WYIA 2PKXA 1G8SA 3COSA 2F8TA 3M4ZA 2QCVA 5DBHX 5EJAA 2MSLA 2HF2A 4XCVA 2YJZA 2OGTA 3KYCB 1M2GA 2N1MA 1L5GB 1KVQA 1ST2A 3BL8A 4RK0A 4Z7JA 2XGJA 2PS0A 1GDDA 4HHEA 3REQA 1DCKA 3DC2A 1BU5A 1DLIA 3CWCA 4KX3A 2QN9A 3V8QA 3KQSA 2VDWB 3QMPA 4TYWA 1Z83A 4K8CA 1NOJA 2QVCA 2WJGA 3GXOA 3P94A 3MRSA 1M66A 1YNSA 5COJA 4ITVA 3UHOA 1X6VA 3KJNA 4MK4A 4OXNA 4IDHA 4WFJA 3VBEA 1W88B 3PE6A 5KJ6A 3WAJA 4XWWA 4R1QA 4KI0A 4URVR 2OYSA 2XV1A 4Q02A 2I8LA 2W2LD 1SY7A 1M3SA 3LUFA 3FSRA 2F4NA 2AV6A 5LP6A 2POQX 4TMWA 3M6UA 3BTSA 3QKRA 3RYHA 3UF0A 1SUAA 1XJWA 3IOBA 1U1IA 4YJ2F 4YV1A 2VJBA 1SC1A 2B5WA 2W8BA 1GGFA 2B3DA 3BXFA 4IVQA 5I4KA 3PUVA 2D4HA 2AWOA 4E6EA 5K20A 2VJNA 4BCBA 3L0YA 5IT4A 4P7KA 2BEWA 1BJKA 3F3MA 4BMCA 4FWBA 1XKXA 2R8EA 1ORWA 3IT2A 3L1UA 3TZKA 4BEWA 2QE7D 4NQRA 3UOWA 5E7QA 1E5VA 1FRFS 4TKUB 4GPTA 4LHVA 4IUBS 1AK9A 4MV9A 1XYGA 2NTNA 2H5LA 2GJ8A 1HM5A 3CZ9A 1PDWA 4R1TA 3L7BA 2ZYWX 2ZAGA 4EL0A 2AL7A 3LNTA 1XQXA 3S2GA 1DGMA 3R6GA 2EXXA 5CT9A 3RC8A 5CDFA 3MRVA 2CUTA 2V7VA 5E95A 1R0YA 5DBGA 1TW2A 3DOOA 1QPGA 3Q7EA 1TVEA 1P3JA 1RHRA 1G18A 3P45A 4J9UE 4CBVA 2X9GA 2J0VA 5COQA 4DM3A 4Y2JA 1UFKA 3GDOA 1RJ9B 5EGNA 1IXSB 3IP6A 3KKPA 4I1UA 5I7EA 2R6R1 2BCJQ 2JCGA 1TC2A 4MV4A 2YZKA 2FUG6 3RU9A 3WC4A 4ZAXA 3MT7A 5ICFA 3NV7A 3CGGA 2B1JA 2V0CA 1O5IA 3O90A 3SHOA 2GHIA 2ZXUA 3JARB 5C32A 5EJ5A 3NALA 2H1CA 4JJZA 3ACCA 1A0OA 3BX1A 3K0AB 1WMDA 3HRHA 3RSLA 2FWBA 4MRNA 3QM1A 3QV2A 1I3NA 1TAHA 1WDLA 2H8GA 2GF0A 4ZI7A 5C7LO 4NU5A 4QO8A 1KK0A 1NUUA 3JQ7A 3QE2A 1POXA 3B5IA 4EDFA 2QUHA 4F6LA 1RRFA 2C5LA 5K03A 4DUGA 3R9XB 4EHLA 1LS1A 5AJYA 1IY0A 1ZY2A 4I4CA 3W8RA 3AVXA 1E1LA 3H5TA 1Z75A 2FA9A 4CV1A 4BB9A 5CLJA 5MDHA 5MGBA 4EYOA 1Z82A 3GMSA 4CRWB 4R40A 5A5EA 2TMGA 4BNHA 1LFDB 2O8DB 2QPOA 3E9DA 1WQ1R 5HK8A 3TGLA 4I9HA 3CPHA 1X7YA 1YJQA 2WW8A 2XQKA 4MGEA 4XLZA 1YUBA 3RUAA 4BQIA 4E32A 3JRWA 4DLTA 1FYVA 1TVKB 2DY1A 3R6TA 4KALA 3AFHA 3ELBA 3RSSA 1P2GA 2QW8A 1U2DC 3TH5A 3WJ2A 2YJNA 3G2LA 5BNZA 1RPZA 3U80A 2Q5RA 1VG8A 5DI3A 4EPRA 4KO1S 5IM4F 2HYIC 3RPZA 5HJEA 2VJKA 2WU3A 1I5EA 3PF9A 4OHZA 1CY8A 4P3YA 4J94A 1CJTC 1TZMA 3OO0A 5AOAA 2MINA 5EZYA 4C07A 1N5KA 3LA8A 4L7VA 4BV8A 1RM3A 1G8YA 1P2VA 4HNRA 4BMYA 1X7GA 2V7PA 3NGXA 3V55A 1XMJA 5LYJF 3TNJA 4FWIB 2BHLA 4ZOAA 1FQWA 2GCPA 1VHDA 2ECOA 2QTFA 3AFOA 4BWVA 2FMTA 1S6YA 2HF7A 4UZFA 4F2GA 1KMNA 3OOJA 3DZ8A 2O2ZA 2DFLA 5ESRA 1E7QA 1JMVA 2O0HA 1PTKA 3DMHA 4FILA 3T3PB 3DXFA 5E2AA 4KFUA 2XMPA 1JBEA 1F9EA 1R00A 1XG5A 1T5DX 2EP5A 3DMTC 1FLVA 4M9QA 4UVGA 2PO7A 5U4QA 2Q9CA 1F8GA 1W76A 2FFJA 4K9OA 1XDDA 3QUCA 5B3LA 3ZV4A 1OPRA 4DABA 1F2TB 3HCEA 2WU0A 4JX9A 3FH0A 4RXTA 3CM0A 3S7TA 2FWJA 5IBRA 4AUNA 3LY5A 3OWHA 4BWGA 1OT3A 3WLRA 3IXLA 4QLBA 1SU8A 4IDFA 2V6IA 1FMLA 4ZCLA 2XUGA 3GUCA 3CQ9A 3UYLA 2W2KA 1L5YA 2I4IA 1YIAA 4EHKA 3G17A 3IO5A 2DKFA 1XA0A 3HWX1 1Q74A 1LVUA 2P2SA 3LKBA 4HUJA 1JL3A 1AKTA 4EQ6B 3HJFA 5G0TA 3OX1A 1TLTA 2A9JA 4YDHB 3DFUA 3R8CA 5KVCA 5CT6A 2HAEA 3JVIA 2D8AA 5WRFA 1CF9A 2BW0A 2I2BA 5KX5A 3NP7A 4WDRA 1N36B 4U2DA 1P1CA 4V3CA 1C3XA 3BTVA 4AZTA 1BCSB 1K7SN 4JUAA 4BRUA 3DVLA 2FPIB 2QMYA 1UKVY 1KJWA 1Y6QA 1U3TA 1GV1A 4JKIA 4QVGA 4S0XA 3V48A 4D1YA 5CFNA 2OCDA 5F5LA 4ALKA 4JOCA 3E5RA 4CM9D 4FNMA 4PPYA 4B2PA 4TYNA 3ZKWB 2E89A 1JNXX 1UXGA 4G0YA 1NXQA 2IQ5A 4RDHA 1B14A 5FQOA 1MGOA 3GJ4A 3HJAA 3LCVB 2EW1A 4O5OA 1S2IA 4MV7A 3K0FB 3PSAA 1LTHR 3R3UA 2HHCA 2FW0A 4BLOA 1V7QA 3AUKA 3LLCA 4K9CA 3B9RA 1M7GA 5C4IA 1DJMA 2PDAA 3W5VA 4Q16A 2G83A 3T5MA 3VZSA 5JYDA 2HA5A 1KEPA 1FNMA 4L1KA 3KTAA 2BR4A 2R7MA 5JFOA 4CKWB 1WW3A 1S8FA 4PXSA 4DXAA 1HT1E 1JSLA 3EISA 1ZHFA 5FD8A 2E0IA 4RHFA 2IL1A 4U7TB 1V1MA 3GEBA 3KVOA 3O8LA 4I8DA 1A98A 1I13A 1ESEA 3AHJA 4K9DA 2ZE5A 3MTBA 2BGIA 2LCFA 2Q1XA 1B7GO 3BMQB 1FXWF 1HT3A 2QENA 2VCYA 3C24A 3OF2A 4JR1A 4YNBA 2PPVA 4Q34A 1XZNA 4MROA 2WJ6A 2J32A 4RNDB 1VCNA 2XUQA 1THGA 3OZAA 1A50B 2P9GA 4C5KA 1V39A 3NVDA 3EW7A 1XLUA 3VGPA 3F7TA 4MRVA 1JLMA 2JC3A 2V9CA 4R2LA 1Y89A 4QUJA 1LI7A 1CFJA 5JRJA 1TVMA 5I7WA 4FYJA 4MPDA 2QAGA 4NG4A 3TUJC 3S2EA 3WK5A 3VTZA 4GG1A 2RH4A 4Q4JA 2PWBA 3QX7A 3ZBPA 3KWJA 3MWLA 2I6BA 4B6SA 7REQB 2JBAA 1ZAKA 4PX3A 3FXAA 1KKMA 5JROA 1TT5B 1U9JA 4JQCA 3JVDA 1YHNA 3L18A 3LPCA 1CE8B 4YCSA 3GNTA 3P5BA 4KODA 4RH0A 4ZANA 2OUIA 4IR7A 2K87A 3HZHA 4QASA 3LUHA 1MP0A 5AIBA 1SK8A 2F64A 3RAPR 5ISMA 5EJ8A 2VJQA 5A6SB 1TA0A 4LVCA 1AQIA 1W4RA 1EFVB 3GHYA 3Q2KA 3C7DB 4QTZA 3W9BA 4EF6A 4Z2AA 3FYUC 4X66B 5T6MA 1P4HA 1KXJA 1PK7A 3I01A 3EUAA 4OKNA 1BEZA 3WK9A 2Q1WA 3EVGA 3ZW9A 2VS1A 3H5WA 5JMTA 3DMNA 3LZ6A 3SIRA 1TKRA 3ZGZA 1NIPA 4BNIA 5CB0A 1DG3A 2QQGA 4P35A 2YBEA 4HXYA 4ZVMA 2PGJA 3L7CA 3KOYA 3TNYA 1RYFA 2G1AA 2OZLB 4UNIA 1G59A 3B1NA 4XYEA 1W87A 4IPTA 3K0CC 3GFVA 4GGOA 4U7XA 3T5BA 2O8NA 3ILVA 5F3RA 3K70C 3U4MA 5DXFA 3QE3A 3G1UA 3VAYA 1KJIA 1J25A 1TQ6A 1PEAA 2ZYUX 1I6LA 2Q41A 4WUTA 4ZOEA 4HDQB 3FVRA 5DVZA 4D3FA 1JSRA 1TZCA 1TD2A 1XKLA 1HI9A 1NFFA 3MINB 3KYDB 1Z2CA 2VJCA 2BJWA 5D6NA 3D7KA 1PJRA 5E1OA 3ZHUA 5JJCA 2FSHA 2NQ8A 4I46A 1BKDR 2NTYC 3RJMA 4ZO9A 3ZK8A 2Z6VA 1CS0A 2COEA 3OZRA 3B1YA 3GOHA 4I66A 3X1DA 3WGUA 1JFFA 1AN9A 4GI3A 1YWGO 1QF7A 3H97A 5BSVA 3IP8A 5C18A 1MJFA 4BZQA 2RSLA 3MG9A 4R8LA 4ND2A 4DA7A 2P91A 5F77A 1BA2A 5DLYA 1XF9A 3BFPA 4E5NA 4MUYA 3WYAA 1NSTA 5FBRB 3U44A 1JDSA 3I5YA 3HA5A 1GA6A 4BVFA 2WYVA 2W37A 3GVIA 5KTMA 4GL2A 3QX3A 5I7RA 3OHSX 3KHTA 1T5BA 3GAFA 1ZOOA 2P69A 2QG4A 1VGVA 4KR9A 4P82A 2KBFA 2NPIA 4RIIA 2YZMA 3LXUX 3L6RA 2AYZA 3QEMA 2OQVA 4B4UA 1IZ7A 4IXDA 1X9IA 2CZGA 3RC1A 5JXWA 4FYYA 3R7BA 2L19A 3UK7A 3CBQA 4EGQA 1M1NB 2OSBA 2SCUA 4JIMA 5AW6A 2CDNA 1F4PA 1X0XA 2PWPA 5C4GB 5G41A 4DQ0A 3IDZA 1DHTA 4EPYA 4BWYA 2ZDHA 3PICA 4E69A 4A6EA 2PBFA 1HZZC 1HH4A 1UDXA 3GBVA 4IRUB 1HDCA 1W6RA 3D31A 3AERA 1FUEA 2AN4A 2V7BA 3MXTA 2I2FA 4HVTA 4HG2A 4MV6A 2BVNA 3FJOA 2GPSA 4CM3A 2VPPA 3CVOA 5CBPA 2IS4A 5FB3A 2ABQA 1O6CA 3ZNNA 3FJYA 1FLDA 3GYGA 4I55A 1OI4A 3ZR4B 5JDCA 4E13A 4CZ2A 2QRUA 5DTJA 3RGWS 4JBGA 5CIYA 4MHSA 3PQFA 3N0TA 3HLKA 3I1YA 4UKDA 4BZXA 2NTJA 1PL7A 4R1OA 3JQFA 2O4CA 4LJ8A 2XD9A 3WZLA 4TS4A 4I50F 2AVNA 5IASA 1RPNA 2IP2A 3GLHB 3ZY2A 4OXKA 5HRCA 1QK5A 4JBLA 4QPDA 2QRVA 2DUJA 1XT6A 3I58A 1HE2A 3O03A 4B79A 4EHFA 1JEQA 1RQNA 2E49A 2EAUA 2OT3B 4TKMA 1L5VA 2O7NA 4OYLA 3SQNA 2HF9A 4HPJB 4AF7A 4AP5A 2ZR8A 3LNCA 3EZNA 1KWGA 1ETUA 2C94A 3URKA 3O75A 5F7XA 1YBMA 3L1JA 5JASA 4CMEC 2FP4A 1XKQA 3AW8A 1PV2A 1VFPA 1DQYA 2QDXA 1QE0A 1IY8A 4PRYA 3PVSA 3QKSA 1MVNA 5ADWA 5EIFA 4BZPA 2IPAB 4MCJA 5K4HA 3B6EA 2YDYA 1JG4A 4JC8A 2HGSA 2WP0A 1DLJA 2HCTA 1KIMA 3FWYA 2ZQ5A 1JR3E 5A4MS 2RBCA 3TW6A 2CLCX 2ZB4A 5AW7A 3WJAA 3IBGA 3U60B 3SSNA 5JC8A 3LW7A 4X7PA 3D6VA 1IPHA 4FXPA 1UM9B 3TZ6A 2C95A 1RWKA 4QTYA 4C1BA 4Q9IA 1LBEA 4OOFA 2IU3A 5IJWA 2YASA 1N32B 1Y82A 2HO4A 5TGDA 4AZWA 4AMVA 3AL0C 1KBQA 1MH9A 1T2DA 2C2WA 4HN9A 3QX9A 3HZRA 1ZH0A 5BSEA 5C52B 3MWEB 1CVLA 2Q6IA 1M6HA 1QH9A 1SWVA 4OL0A 2VORA 4PYKA 1FS4A 1C1YA 2Z30A 3R5SA 5FP0A 4Z0PA 3UT5B 3EGDB 2BMFA 2FPGA 1A9ZA 2FCAA 3A1FA 3P5SA 4BLVA 4LTMA 3ZLVA 5KYUA 2EFEB 4ZEMA 3CX8A 4BAZA 3R6LA 3GAAA 2A14A 5TX7A 2HB6A 2J3JA 4JBWA 4LFAB 4OLAA 1W9HA 1Q0RA 1WV0A 1E2IA 1K9VF 4B5KA 4BVKA 1R37A 4MUXA 4S0ZA 5B1IA 2B94A 2WZBA 5ALDA 3AIKA 1GRNA 1MAWA 1X3SA 2JCBA 3A26A 3IUYA 1HFKA 1VLLA 2WUWE 3G2JA 4RJLA 3W8NA 4YASA 3ES9A 4P3NA 1FUKA 1C7JA 3B1VA 3MWDB 1ZA1A 2W2XA 5HA5A 4C13A 4UHHA 2BHSA 4I4TB 3IUJA 3SR0A 1U6JA 1I9CA 4PLPA 4XX0B 5HKAA 2D6FA 3EGCA 2R6DA 1IAVA 4PSAA 4C3OB 3UGJA 4C3VA 3FCYA 2PZFA 3GOQA 3NNNA 3WYGA 1SQ6A 3ZWMA 1Z0IA 1LNSA 3EUWA 1ODJA 4MUAA 1GR1A 2IOYA 2HI0A 2UYHA 1V6SA 4RF4A 2VP3A 3TGWA 1EAMA 4IDQA 1J06A 1N9GA 5LBTA 3IJEB 2EX1A 3BGVA 4FS3A 1U28A 5I4CA 2XUZA 1RCFA 4RTLA 1GEEA 1JH8A 2B9EA 1JALA 3AVOA 4KOEC 1CS4C 1Z5WA 1E3DA 5F1OA 4E03A 1I94B 1JHAA 4ZFNA 2NZWA 1ZXBA 1TPZA 1JE1A 3SYNA 4YQZA 1L7EA 1HUQA 1MPXA 4C08A 2O0KA 5CXUA 1OH6A 2B8TA 3I9OA 2AHOA 1BVYF 3P26A 4YGYA 1SBHA 1PYDA 4TLEA 1A2KC 3A9CA 3S6JA 3R7WA 3DPUA 1RLOA 1NVBA 3PL5A 1ZGCA 3H1EA 4CMJA 3A32A 5L3RA 4F3YA 2AW3A 3GLFB 1DX9A 1IWOA 2A1TS 2FETA 3T95A 2QT1A 2ZEJA 5L3SB 3LP8A 4YRMA 2DCMA 3W0LB 1CDOA 4R9VA 3BFJA 1AE1A 2FP3A 2NV2B 3AU8A 2PX6A 2OV2A 4BNTA 1GTG1 2ZJYA 4G1FA 2A9FA 2A0KA 2IYOA 4QD3A 3D7LA 1XZIA 2I33A 4GOXA 4MYUA 5I9IA 3IQHX 2PHZA 3NM6B 1T6ZA 3V7NA 5MFPA 1AA9A 1ULUA 2RDMA 3VOAA 3IKVA 4CMAA 3U3KA 2BJHA 4NZYA 3HCDA 2XHZA 5B2EA 3PX3A 4KIGA 3IO3A 4UM9B 1YS7A 5FAXA 4AQ7A 4UBIA 4IHKA 1LPNA 1SU6A 3W9SA 2H6EA 5L51A 4B3IA 1DFHA 4F3CA 3FWNA 2NTEA 3NW9A 1HT2E 3D2BA 1YZKA 1MW9X 2HSJA 2J3IA 3O3CA 1ESMA 1HLFA 2BELA 3LWZA 3N9IA 3PQ8A 5IJAA 3T4EA 1TF5A 1ZD9A 4QODA 5CT4A 3NOOA 4C88A 4A91A 1NW3A 3B70A 2PWAA 1K8RA 3GXBA 3FBWA 1PD0A 2DH5A 3JXEA 1SMKA 1E6KA 2LNDA 4KN9S 5FNVA 1U3DA 1KTIA 4MRAA 1OXUA 2QVZX 4XVCA 1Z12A 3IT0A 4UM7A 4H7HA 2OXCA 1PK9A 5TQ0A 2GSDA 4C4SA 3IEPA 3OLZA 2C8LA 4DXHA 4O33A 6PFKA 2BF7A 2VWGA 4OI0A 2C61A 2WF7A 4C0LA 5IMSA 3JQQA 4ER0A 2W0MA 1RK2A 1XTBA 3LKVA 4QGGA 2CMKA 1Z4KA 2QX8A 1D4OA 4UAGA 1IBKB 4RPLA 2CBZA 3EIXA 2DTXA 2ZRKA 2XWBF 1OC4A 3MMNA 4K05A 1X8LA 2WIDA 4IDNA 1PBNA 1P1KA 2DGDA 3QU2A 4OUDA 1C0IA 3JR7A 3OIDA 2X22A 1DAFA 3P0HA 5CX4A 3RC3A 1LSSA 3AP2A 3DDNA 4IV0A 3FWPA 2A9QA 4NOLA 2OFWA 3KB6A 4OJMX 5DBFA 3TL3A 3LMKA 5BR4A 1DTWA 1C1XA 1ORHA 4I08A 1DKMA 1PX2A 3OECA 3TEMA 1USVA 1XEAA 3C8UA 621PA 4PV7A 1TXGA 4XH9B 2Y6VA 3DR3A 2DUUA 3M83A 4IOLA 3NL3A 3RRZA 2H31A 4DSOA 4MS1A 6YASA 4RY0A 4QDZA 4WN9A 1NI4B 3QKUA 1OFVA 5F1KA 2XH8A 3UM9A 4XVQA 3KPWA 1E1CB 3ND7A 1BWPA 1KSGA 4RD6A 4M2LA 4K1XA 1P1HA 5AJVB 3HNPA 1ACMA 3NHRA 4M89A 2CMDA 2QMEA 4DLUA 1J5XA 1AUVA 2DMRA 3GAZA 4NCNA 3BJEA 3HN2A 1U5BA 3SCZA 1UBEA 2PUVA 3ZXXA 1FDVA 2O48X 3FYUB 4A0SA 5AQ1A 1OXTA 2F90A 4TQUS 2FE4A 2GTIA 3HP1A 2GLUA 3DQQA 4IXTA 3N58A 1K27A 3RFTA 2FEAA 2O2JA 2BSAA 2OZVA 4R8VA 2XOXA 4K0RA 1EZ1A 4MR9B 4B75A 3AFGA 4LY3A 2Z5LA 3G0CA 1RXWA 4QQRA 4J91A 3CZCA 4LF8B 4AX8A 1A72A 4O4HF 4Y9RA 3Q85A 4EY5A 3TGPA 3SC3A 2QN1A 3Q3CA 1UPTA 4NSNA 5D01A 4B4OA 2QPLA 2W4IA 3NTQA 4F5EA 2YMQA 1V9LA 2I1LA 1EDBA 1Z45A 3AEUB 2JGRA 1R9NA 3K70B 4ISBA 3T52A 1ZD5A 3SI7A 4DTCA 5BWNA 4H4CA 2YY5A 1UFQA 5HX7A 2JHPA 4FJ0A 1QTQA 1GZUA 1Z2OX 3RUFA 4HQ0A 2A35A 1T0PA 5CH3A 5AVJA 4IKOA 2EX4A 5CLLA 1TJPB 5HGXA 5DLPA 2FOXA 1ZIXA 2KSQA 2WLSA 4OHVA 1HSZA 2G04A 4MI1A 4XIYA 3H1FA 1PJTA 2OLEA 3QA3E 1AA6A 2IP1A 1WJGA 5JSZA 2VIIA 2CXNA 3MA0A 3IP3A 5B1HA 4S04A 1CIJA 2OCAA 4IHJA 5H9WA 1Q0QA 3IL2A 4EBBA 1NJ8A 2XTAA 1P9OA 2IIPA 4G9GA 3ZHYA 4IDOA 2Q0HA 1B3BA 3IMGA 2E4WA 1OWPA 2OGWA 4ZVTA 2QMOA 1GOTA 2OHHA 3INYA 1ZVVA 1JDPA 2J6BA 3E05A 1T9DA 5CLGA 4AI6A 3RADC 4X91A 3DW3X 3V5NA 4UDNA 3K5PA 5TPZD 1M0TA 2AZMA 2ECKA 4GICA 4JB8A 3OEEA 3KS9A 5DGCA 3V32A 3LBYA 1W44A 2BE7A 1VMEA 1J20A 3BK1A 3OQVA 4WFIA 2JJ2D 4GEKA 2O2SA 4CR6A 4MV1A 4ZYZA 5AVVA 6LDHA 4ZOCA 1QM5A 2QY9A 3BCRA 5LIPA 1N33B 3ZD7A 2NP6A 4RDXA 4YCNA 1NXTA 3ZDCA 2BGGA 3G7NA 4HBZA 3BGSA 4C2BA 3M1AA 2FFRA 5ICGA 3FHTA 1C3LA 3HSYA 3H5RA 2WWIA 2OHIA 1ZHHA 5GOTA 1BKYA 4HDSB 1BC5A 2GEBA 3U31A 2IU4A 1EXVA 1PVOA 5C37A 3F7MA 4YP5A 1SBQA 5B3JA 4A15A 3WXMA 2WP8J 2ZVJA 4FI3C 5CDFE 1YE8A 3LSYA 1QORA 4RORA 4WNAB 2EKBA 1EHYA 4WZBB 1C0PA 4KO4S 4XQ0A 4CNBA 1OTYA 1ZN2A 2ASEA 3IDOA 3QITA 1P81A 4EJ0A 1ACLA 2DUMA 1N8KA 4EI7A 3EFBA 4MQ4A 3WFIA 3WXBA 2PKRA 1DU4A 3F7NA 1I5RA 1UBSB 4K03A 4LHZA 4BTLA 3GLIB 2KHZA 2BMEA 3SSAA 4PN3A 1U0NA 2ORVA 2PBRA 3L7IA 3M6FA 2WMYA 3CLUC 4MKFA 1JHXA 1OF1A 3NANA 3OZDA 4Q1CA 4R4JA 4J75A 5KQMA 1BWQA 1JLLB 2FW6A 1RWQA 1JMYA 1TT7A 4TMTA 3L79A 5DGHA 4DJEC 1KRHA 3HKCA 1NVAA 3K9QO 3OJLA 2C54A 2QR5A 2EKZA 3IQGX 2VWQA 4NRDA 5DSTA 5K0TA 4R5HA 1NR7A 1EX7A 2YV4A 3CVXA 1OT5A 2WA1A 1NUQA 1QH0A 2W6QA 1N7JA 2XDQB 3GUUA 1SQGA 4RENA 5G0SA 1C3QA 2VDWA 3SY8A 4BC0A 2Z5VA 4G8BA 2O5VA 2VDQB 3FPBA 5B2ZA 4G1BA 3IBFA 2C4NA 4ITRC 1SUFA 1Y8AA 4JT8A 2HTEA 4OHBA 1W5TA 4NH0A 1BQ3A 5CHYA 4GE0A 4TLCA 2IKSA 3E23A 3VHXB 4C9BA 5CFMA 5JD6A 5MF6A 1Z56C 2RHRA 3QWBA 1FJHA 2HU5A 4G5FA 4JKYA 4B8RA 1ITZA 1PR2A 1PAUA 2O3RA 3OP1A 2J3LA 1ZM9A 3FR8A 4PG4A 4XIGS 3ASUA 1B0AA 2ES4A 3OQJA 1NBHA 3UH0A 1XZKA 4PQFA 2GBGA 3MJDA 4NI5A 2ID9A 1ZJ4A 3L04A 3GDHA 1HFJA 1LPMA 1U0LA 3V8NA 4POOA 5L7WA 5LQAA 2OILA 2AHRA 4PO3X 4QQ8A 3S29A 2XXJA 1E3WA 2V58A 5BYFA 2JEYA 3NOVA 4OQLA 5DGXA 4WW0A 4I36A 2BIFA 2PRSA 4HCJA 4AJHA 2IH5A 1P1RA 2AE2A 3I5AA 5MHTA 2ZRAA 3HJRA 4IXNA 3K2EA 2PYIA 4BFLA 3A1WA 4OREX 1HLDA 3LJSA 3BGDA 3KETA 3C0KA 3STWA 2OAGA 2HA3A 4O63O 4BP3A 3NJ4A 4A16A 1POWA 3AM1A 4JT9A 1VSBA 2POCA 1LZKA 3BJMA 1RBMA 2J9FA 3AHGA 2EF1A 1WDTA 1RJ9A 3OVMA 2R7LA 4LF5B 1ZEJA 4FCTA 4RQBA 1O95D 5JZ9A 1IEWA 3NHMA 3VPXA 5GONB 1T8WA 1I7QB 4MUGA 1LJ8A 1PR5A 3DWFA 5TMDA 3RHTA 3WYEA 3ZQJA 5JCZA 5DNEA 3T1TA 4LJ4A 4E5DA 1M7BA 2QRKA 3UCEA 5D1NA 3KQUA 3FOZA 3NRSA 4LV8B 1NR1A 1U7OA 4DR3B 2J0SA 3VBCA 8LDHA 1PR3A 3I32A 5L3QB 1TZ6A 4D3DA 1XD8A 1PKXA 2VP9A 3KQPA 1MQSA 2R65A 2QK4A 1H8EA 3UUGA 3NOXA 3PP8A 2VPTA 4OQYA 2ANCA 5DBIA 2PCLA 1ODFA 4MQLA 4B4KA 1CUEA 1RWWA 2PSFA 3PPXA 1LDBA 1EINA 2BFCB 1P4JA 3VJMA 3H9QA 5DYTA 2BBSA 3WNCA 2FWNA 3ZE1B 3RSQA 1Z6PA 4P6VF 4R68A 4CTOA 4F04A 4R1LA 5LXTF 1GGHA 3RQSA 1ABBA 4TVSA 2VZEA 1O8CA 4GPBA 3VI3B 1W59A 5EJ4A 3LECA 2I3BA 5HFAA 3UGTA 1WXDA 5ERXA 2XGSA 2WK1A 3BERA 1LDGA 4E2WA 1KR5A 4FMDB 4NY1A 3ROZA 5IN5A 3RTCA 5A3JA 2A0WA 4U7FA 5AK6A 1SOUA 3TJZA 4YJ2A 1GYRA 2X3FA 3MBOA 2B1RA 1EZ4A 4UBJA 3AM4A 1GL3A 3CT6A 4BS9A 1B73A 3GMIA 1AKRA 4FCWA 4LGVA 4D9IA 1U0RA 3KAQA 4RMNA 4QHYA 4D0RA 4FJ2A 3THYA 2CNBA 3NL2A 3GARA 3A4MA 4FU0A 2RH8A 5H80A 3DCYA 3FCAA 4YJFA 3CRZA 3SMVA 3TE7A 2VTBA 4OL9A 3UH1A 1W1IA 3ZLJA 2J09A 1JVNA 1X80B 4KLCA 4GBMA 3NHFA 3ZG6A 3BG5A 3PF8A 1H9CA 2I99A 4UATA 4V0ME 3PHCA 5IK2A 1BXRA 3RTBA 2OMEA 4YMLA 4YV7A 3DQZA 2MSCB 1DG1G 1OV4A 2BSQA 4O08A 3DP7A 1XRRA 1VI2A 4YLEA 2YHIB 2GCEA 3SEAA 3TG2A 5LYYA 4EJ2A 2FZCA 5TEWA 1R0RE 5LOVB 3I09A 5LA6B 4DN6A 1RSZA 3F1LA 4D8YA 5AXCA 3RDPA 3KEUA 3ICVA 1IE3A 1FL9A 1PZXA 3M6MD 1E1YA 3V8PA 5JDIC 1MGPA 1XZHA 1VCHA 4M87A 1EVLA 4RANA 2HU2A 4U02A 4WXRA 2DJ5A 3TAHA 3VPGA 3VVBA 1FMCA 2ZSUA 1C8VB 4AMZA 2J5BA 3H2BA 2PKMA 3S1AB 3B2EA 5KREA 5M5BA 1YKFA 1O94A 1AK1A 4L07A 4PZAA 2P3SA 3B1RA 3LU1A 3NHSA 3KJXA 1AGXA 1UKCA 1Y4DE 2GFQA 1V48A 2WAAA 2R6CA 3EH1A 4HC4A 1NVVR 4XPIA 3VTAA 2JAWA 1N2HA 2H9IA 4AS3A 2FWAA 1EFPB 1C8KA 7AT1A 1EE9A 4RTSA 3MWYW 1EUQA 1Y9ZA 3Q7QA 2GK3A 4QSHA 5K0GA 3NTUA 3CV3A 1CQIA 3U3MA 3I9JA 2BEJA 4D8WA 5GJVC 2C4WA 1T35A 2EC5A 2VF4X 2GZRA 3MYYA 4FLFA 3QE9Y 1OXMA 3LKZA 2J6CA 3R41A 4JBHA 5ALFA 1JFRA 1RFUA 4X44A 4DC1A 3U3DA 3OUTA 2LE0A 2LW7A 3RT1A 4EGJA 2G0NA 1AGYA 3N8DA 5JVDB 4D26A 1P6XA 3FR7A 3GRVA 1BMFD 1YOVB 2P62A 4LQDA 4WJKB 4C7XA 3UMOA 2IIBA 1P2SA 1YZGA 4UJ5A 5FX2A 2Z6AA 1IXZA 1EI9A 1SNYA 2RCYA 1Z28A 3W3AD 3R0QA 2E5LB 6REQA 2GBLC 2JJ1A 1E7RA 1JR6A 1F12A 3O3OB 2LWIA 4XF7A 2YWFA 2EOAA 1N2ZA 1ZLYA 2LVBA 4RTRA 2JCVA 1KEEB 2NUPB 4QYXA 4W5TA 1XIVA 4DA4A 3TX2A 2AQKA 4Q21A 5IM4A 4UUAA 2WTBA 2XUFA 1E2JA 2HQ1A 4HQLA 4REMA 1B74A 1JW9B 4CKWA 1ZXXA 2B4RO 4G81A 3B7PA 3ZDQA 2C20A 2DFPA 4B7AA 2ZYSA 3G5MA 1UDRA 1G6HA 1XCGB 1DQZA 4BCCA 3EB9A 4KXNA 2OVBA 5SY9A 1A5AB 1VSVA 5TMEA 4Y2GA 4GR4A 1WQ3A 2PX5A 2EL7A 1XTKA 5LYJA 3VU9B 5BV8A 5FDFA 2HLPA 3ECSA 4E11A 2BKUA 3G0HA 3BGWA 3SFVA 2QJTA 3V4PB 2B1IA 3KSZO 4EUEA 1N2OA 2PMKA 4GUAA 1WSAA 2XECA 3IJRA 1TO1E 5BYDA 1PNOA 2VRNA 1VM6A 3PDIB 4KTVE 1YULA 4U2KA 4KN5A 2D7DA 2M1ZA 3Q9NA 3R9IA 1K5DA 4HAOA 3RVOA 3HHPA 2ZIVB 3T6KA 2RGDA 1S3GA 1Z3IX 1C29B 2DHRA 1XTIA 1L4KA 2B9VA 2G07A 3MWFA 4ZHQB 2OMKA 1B41A 2QTVB 3PA8A 4JJ7A 2JIOA 4CIXA 2QXYA 2DR0A 3O8QB 5JE8A 1L5HA 4CL8A 2XE7A 4Q9KA 3DA8A 1KTVA 1N6IA 4QZVA 1QLJA 1RBZA 1N2EA 3UW1A 4ML3A 1ND6A 1UMDA 2BKAA 2UVDA 3B78A 2NVUB 1Z17A 2FF7A 4AJ1A 5FPPA 1T5OA 4HV4A 2FSVA 1U8XX 1I7LA 2K4MA 1CE8A 1IMJA 3MOIA 3C7CB 4C29A 3NP9A 2GLXA 3OWOA 4HDKA 5C35A 1W581 4OI2A 4M1YA 5K0BA 3F98A 4RA9A 3AQIA 2NZVG 5J1TB 3PQDA 1WXWA 3DLIA 1EFVA 1IB0A 2F43A 2QPTA 5LUBA 4AP9A 3O4HA 1Y8RA 1P0PA 4QDJA 3K72B 4BNZA 2W6IA 1P8AA 4D4HA 3IEKA 1Q2UA 4FCCA 2PEYA 4BO7A 1JXOA 1DAIA 1YK0A 4MR8B 4P7FA 1P77A 2PK3A 1YZLA 3L0BA 3DLPX 2DFVA 4LYAA 4QUAA 4ZVQA 4N5DA 3A3NA 1IHUA 5A5FA 1PLJA 3QLUC 4O4LF 1P33A 2IY9A 2H52A 1DHRA 3FNFA 1MRZA 1EK5A 1P0MA 3AF1A 2QT9A 2ZYHA 1NKSA 2B8WA 2FPOA 2HMWA 1IG3A 2X8BA 1CEQA 4OHUA 6AT1A 5K0FA 2ZSEA 4M21A 1TUBB 3JD3A 1NXWA 1OFTA 5KAPA 5LMZA 1CYDA 2D5AA 2ZE7A 3V1KA 1Q57A 2A8YA 4W8GA 3UPTA 3OT4A 3HICA 2CVPA 4O1MA 1VL2A 1VZ3A 5KIAA 2ZXFA 3ROGA 4UD2A 2I2XB 3LHSA 3SZGA 3AF3A 4Q37A 5T3YA 2WDZA 3B85A 3FOWA 3H6KA 1QVWA 2CXSA 1CP2A 4INJA 3O8OA 1J2YA 1CJBA 1ECBA 3DH0A 3HDQA 3I61A 1TUGA 1QHSA 2OBYA 1N5LA 5KYWB 1SHZA 2ERXA 4PFKA 4IWNA 2HN9A 4G2NA 1NUPA 1ZL2A 1E89A 3EXG1 5FWDA 1PZGA 2N47A 3K1YA 5DGTA 3HK2A 1WZUA 1KQGA 4OK5A 2ZSHA 4L78A 2Z9DA 3MJTA 3WRYA 4OQMA 4DWOA 4F3KA 1JXMA 4LCAA 4EMTA 1WIWA 3OLWA 2HUPA 2VPXA 1A1VA 1GZVA 1G8JA 4B3MB 2R1UA 2C5EA 2HBRA 2H16A 2RKBA 4Z8YA 1HV8A 4H15A 3LL4A 1OU0A 3EEYA 4HGPA 3KAPA 4K6FA 4OJYA 5AVWA 1U8AA 5L45A 1XZLA 2A5DA 4KQXA 4JOQA 2EF0A 2JHFA 2OORC 3DAPA 1X94A 3F9IA 4MIYA 4TL8A 4TPKA 1EFLA 4WCDA 5I47A 3L8HA 1LIIA 3I64A 4K9PA 1YB4A 4DJAA 1UT8A 4GOKA 1P4GA 1QOQB 2ZBQA 3PC7A 4GF5A 2JF0A 1KMIY 3DPIA 4U3JA 3ZHXA 4E3WA 3ZDDA 4PWZA 3GUHA 3OQ1A 1OROA 1W93A 2R00C 1FP1D 1YTLA 1Z7YA 1VBMA 1R4MA 2IRWA 3OZWA 1F6WA 3MYRA 3IAM1 3ZEIA 1DIGA 1IZYA 4BEVA 5JPIA 5K0ZA 2F3TA 2MDTA 1EUDA 1M2KA 4TL7A 1FGSA 4QJBA 1RRKA 2CBGA 2X1HA 4TKLA 4BY9E 4L4RA 1X7ZB 3NATA 4MQ6A 2V4MA 3T54A 4F5DA 4RABA 2Q4DA 1K08A 2HD4A 2QP3A 3FGNA 2RHJA 4FTWA 5CW2A 4BYMA 5IZCA 1D0SA 4QIHA 3GCWA 1ZCBA 3MCWA 3O8NA 1E3MA 3KYJB 3VNBA 3GGGA 1U5AA 2FZEA 4A0RA 1UZNA 1E69A 1L1RA 3UK0A 2JAHA 2IEYA 2M6RA 1L7OA 4UHCA 3ODGA 1VB5A 1LX7A 1M10A 4F4FA 1H4SA 1RFTA 3I6BA 3LQRA 2WQZA 3LOUA 3ZY6A 2EHJA 2FEMA 3EEFA 2FEXA 3FLBA 4E94A 2V78A 3VDNB 5EUQB 3G02A 4LWZA 2AJBA 2QW0X 4GMGA 4Y9TA 5I9NA 5DU2A 1L5NA 4QDIA 3WWZA 3OMLA 1V9CA 3Q3GE 2NT4A 5I8PA 4RA6B 5HQTA 2WQ6A 2JLZA 1Z0ZA 1YQXA 1DBVO 1Z4PX 3B3QA 4TWIA 4EJSA 3BJIC 1P6UA 4AZ0A 1NJ6A 1SXHA 3JQEA 2HJRA 1HMPA 1KH3A 4I1VA 1JBWA 2VSNA 2WVJA 5ECYA 5EVCA 2G4CA 5JCXA 1RXSA 1SVUA 1BYUA 3DZKA 1PG0A 1N57A 3D64A 3NBMA 4X95A 4OLHA 2F2TA 3AUXA 3ICOA 3VYVA 5LFAA 2J7KA 3CLVA 3NC4A 3I30X 3QLVC 2X0KA 4U2FA 1XAIA 2YCBA 3AEKA 3B1KA 4CU5A 4DV1B 1WHTB 2Z95A 3DVRX 3OPXA 1SKAA 4BO9A 1F1JA 2GMWA 3U62A 5J3JA 5JZSA 1XJ0A 4O2AF 3I9V6 1QP7A 3ND5A 1GU7A 2D0DA 3A6EA 2Q6KA 2VZLA 1GSHA 1LHPA 1LUAA 1UAGA 2BOVA 5AW0A 4FYIA 3ZDAA 2HWUA 5J9FA 1UAYA 1LI5A 5IUJC 3ZOZA 4G5XA 4E1AA 3TJMA 2WAYA 4QJ4A 4AICA 4XWAA 2WHYA 1ZOPA 3BGOS 1P75A 4YB8A 3QVTA 2PZLA 1IU9A 2GOYA 2QIPA 3CH4B 3T38A 4DLSA 3AXTA 5EHXA 1T4BA 2CY0A 3AX6A 1FJ2A 2Y67A 3PNYA 5CFLA 4ZYVA 3CJRA 5KJFA 3ON5A 2F1JA 3RVKA 3B82A 2OD9A 1YXMA 1TA4A 3CSUA 5JRDS 2GEUA 1BYIA 1DIHA 2UAGA 1D2AA 2GERA 5BWMA 1I1OA 1NW5A 5I45A 2I7XA 1NXSA 3STUA 1K0UA 2G7ZA 3BS4A 2R3BA 4JT2A 4XX0A 1P8JA 4QO7A 2CWWA 1Y9DA 2J41A 2J3MA 2X8AA 2Y1EA 3NAZA 4N7JA 8ADHA 2ZG6A 5J4KA 1T5HX 1Y7PA 5FAKA 2G3YA 1FTQA 3GJ6A 4NBTA 2QROA 1RABA 3SBXA 3CRQA 4ND4A 2JHGA 2GS9A 2ZRFA 4RX1A 1RM4A 2R8YA 2Z56A 1YKSA 2E4XA 1ESCA 4Y9SA 4HUQB 1T8YA 1SKBA 4H7KA 4BKPA 5KJ1A 3REOA 1QE3A 3TZLA 5HOEA 1HDOA 1TJYA 3UBTA 3VTFA 1Z47A 3M3PA 2WB2A 3VTKA 1MIHA 3FZYA 1A4UA 2MYUA 4B74A 5H0IA 3W8FA 1FBNA 2Q2WA 4EAQA 2O2EA 1VSQA 2JAQA 2NYVA 4DHWA 5AUOB 4C7OA 2X9NA 4RPKA 4UMVA 2KLHA 2NO5A 1JSCA 3H87A 3GYBA 4M60A 4MWCA 4O59O 5J4VA 2JRLA 3R8FA 3L7LA 4PINA 2G0AA 4DJFC 5I01A 1H0RA 3HCPA 2XNKA 1MU0A 4HEJA 2HT1A 1SUPA 5DNWA 2XNDD 3R74A 1QP8A 4ZMSA 3CKYA 4WK0B 4BBAA 5LP1A 4NAUA 3RRMA 4H3SA 3NIFB 4PC1A 1OX4A 1MA3A 1YL5A 4ND5A 2XNJA 2BI4A 3L7DA 1W4ZA 2OD2A 1FDRA 1M73E 1QK4A 3A6HA 3KDAA 3QNUA 3QNMA 4J43A 3HEMA 4NFLA 5AJXA 4F0JA 4J6EA 2N0SA 3AUFA 4IP0A 1XMQB 3ERCA 5SZKB 2H1FA 4CKEB 2AZXA 1FLNA 5ALUA 4MLDA 1OFHA 1MB0A 3KXIA 5DK6A 4CI0B 4EG4A 4CIAA 3T0IA 5CYPA 4IVNA 4UBKA 1C2YA 1C0EA 1GFZA 5FEMA 5GIPE 2PXCA 3CMMA 1XHEA 1RJDA 1PSWA 1NRJB 4NBKA 2P4HX 1J2EA 4L9RA 3WHLA 1AM4D 2J9GA 3O93A 3PFCA 4RV5A 3DMPA 3RO4A 3IN1A 2HU7A 4RKYA 4HTFB 3I5MA 4PRKA 5SY6A 3GT4A 2WQ7A 2J3DA 5CGEA 3NVAA 4DC0A 1PWYE 1KOLA 1Q84A 4YRIA 7ADHA 3NHKA 2O14A 3WMXA 2JKYA 1NDQA 1Z8FA 2QZ4A 4BQRA 5IXSA 4LSMA 1H94A 1N6HA 2L17A 4U8GA 3WRWA 3TAXA 1L5KA 3KU1A 4PHCA 3G2OA 4PCUA 4L4ZA 1KDVA 1A88A 3DC7A 4GZ5A 3I9FA 1BEEA 3SHQA 2GGSA 4X0EA 5IW8A 5MGNA 4UZEA 1GRVA 3FTCA 3PQEA 1Y5LA 1VKNA 2XBLA 1EH5A 5K51A 3C4QA 2Z8XA 3K6JA 1XEXB 3KKEA 4BX2A 2EBFX 5EWJA 1E9RA 3B38A 5JSKA 3V8VA 3OJWA 3VNSA 3WLTA 3SQXA 4YPFA 3ZHBA 4I9UA 1C1HA 5CUQA 2A5FA 3EUEA 4O25A 5EYPB 2EKLA 1JDTA 2FQXA 2QRZA 3ME5A 3RFCA 2YMMA 3NLLA 2BGNA 1RKUA 2BR3A 5FOWA 1X13A 1LX6A 1DTEA 4GAEA 1AC5A 3THWB 4ARIA 3OLQA 4C4YA 1JJFA 5KMGB 3F73A 1FFXA 1G64A 1J6UA 1THZA 3K09C 3DE7X 2GHRA 4L6CA 4NFHA 1GPLA 3UN1A 2GVDC 2RD2A 1UOQA 2BTOA 4QXAA 4F21A 4TTTS 3V1LA 4XDGA 4EG5A 3T0GA 3V3TA 3RHZA 1M0WA 4BB5A 5H70A 5C8YF 2ZTMA 4G4SO 3DOIA 3DDUA 3WLHA 2CVFA 4CLHA 4BFTA 1DXHA 1VCOA 1D6MA 1M2OA 2HUNA 1BGXT 5AOVA 4GOJA 1EIZA 1I4WA 3QF4B 2E82A 2PV0A 2WJAA 4QYTA 5AM4A 1TFRA 4MXDA 3CXUA 5HQ3A 2DBRA 2HRBA 5DCWA 1NQOA 3ABOB 3O9MA 4MUBA 3EQZA 2HL6A 1OXSC 4WE3A 5EGSA 3AK4A 2WD9A 3L7MA 3RPEA 1XCBA 4QLAA 3V6MA 5HE9A 3UMPA 3B2QA 3ZPXA 4DQVA 1ZCFA 1G20B 1WHSA 4M22A 1TJ5A 4PSCA 4UNSA 5EKUA 3RS0A 1XTRA 2JK0A 3JQBC 1IAQA 4MYTA 3W2GA 5ALRA 1QTIA 2B36A 2V3VA 4I5IA 3SN6A 3H8JA 4ZYUA 2QM0A 1XDZA 5JHHB 1B6TA 1U94A 3MCTA 3PWKA 1B8NA 2KW5A 4MA5A 4G5RA 1DT5A 2B2NA 5H02A 2QD1A 4MUNA 1HDRA 4RZHA 2QMZA 3SM9A 3ZHRA 4C89A 1CY2A 4XVRA 4LYEA 5LVAA 3UQ9A 1KI2A 2H92A 1TZKA 1RYDA 4UU7A 2EG9A 2PGOA 3O84A 5JCJD 1X15A 4K8RB 4QU8A 3D4BA 1E9VA 3COWA 2Q99A 3DL7A 3F0TA 4N9QA 5TE9A 5L4LA 2O4UX 3ITNA 1YVRA 2Q1YA 1ZITA 4CDRA 1SIWA 2QUZA 3PD1A 1DV1A 4BLSA 1K92A 1ML4A 4C0WA 4MKRA 5AP9A 3SF8B 5BN1A 4PCAA 5BURA 3BE6A 1FFYA 1L4BA 3ZWVA 2EWVA 4FGKA 4K3VA 4JJPA 2WT8A 3RAJA 2EERA 1QIEA 3INGA 1YUMA 3DHVA 5JT1A 3RM5A 4K28A 4NS1A 4C43A 3DGFC 1HNWB 2FGJA 1YOBA 1V8OA 2F9MA 2DTDA 2VPZA 2EW2A 2W4MA 4NWIA 3ZS8A 1E61A 4KAAA 4CM4B 1KVSA 3C39A 4B76A 5DI9A 3RUDA 1C4XA 5LSAA 5EWLA 3AB3A 1MF7A 1XO1A 4MW4A 5BNFA 1U1EA 4TS9A 3SF0A 5CVEA 4FZRA 5K8LA 1TIKA 3H16A 4ZCPA 3C5WP 3GO4A 3WYCA 3LXXA 1F8UA 2XEXA 1QDEA 2G72A 1NW7A 1PUIA 2VAVA 3FCUB 3KDPA 4YBZA 3VKFA 3QKWA 4V02A 5B6AA 1RRVA 3TTWA 2XX3A 2MSWA 3QVXA 1OBOA 1FUUA 2C2BA 3GP5A 5J5AA 2N46A 1XVIA 1OHHD 3MCUA 2GYYA 4K46A 1KC3A 3FKSA 2GZHA 3HDVA 1SXJC 4NTZA 3WDKA 5ICCA 2PS1A 4ARZA 2B3TA 5JY6A 4C5MA 1R8YA 2FFHA 4FOTA 4NJMA 3WL8A 2DETA 3K53A 3LWNA 4G65A 3U1TA 3HO8A 3LBHA 1PT7A 3OU2A 2PXAA 4MVYA 4DIUA 2C9OA 1SXQA 4RFSA 1R5OA 4RZ3A 2UU9B 3CJTA 1GPAA 5C1OA 1RS0A 1XCJA 5SYAA 2M6LA 4ZAWA 2R8PA 3DM5A 3B1PA 4BVLA 3A6KA 1XZEA 3NRCA 2VJMB 3JZAA 5EHGA 3MJHA 5AKYA 2C96A 3GMDA 4O4HA 2OB2A 2HLZA 5YASA 2HRDA 3UAYA 2JLQA 5JQGB 2PLWA 4A2PA 2MR5A 4LC1A 3O74A 4EOGA 2W6ZA 2WYHA 2YMPA 4QNRA 3T61A 1Q0UA 1KEWA 4LAFA 5CPFA 2Q1TA 3BICA 2OY0A 3JYOA 1Q1GA 1MJHA 5TQ2B 3TKYA 1FRNA 1UXJA 4V03A 3HB9A 3ETDA 3PTLA 2HHHB 3AI3A 4P7BA 1ZGGA 2AFRA 2NWQA 5AJHA 4W6ZA 2Q5LA 3BDIA 3CZAA 4JEMA 1TTQB 4EI2A 3M49A 1E2EA 2XGMA 3PXEA 1E7YA 5ES3A 1KA9H 4ZOLB 2QLNA 1K7YA 1YJ8A 2Q2OA 1OY1A 4WXPA 5LZ4A 1IG0A 1ENZA 3NBKA 4HAIA 1V16A 3OPQA 4O5AA 3I2YX 1RTTA 2X76A 3RS3A 4CLDA 3EGWA 1A7UA 3QJYA 1P4RA 1ZDMA 1J1ZA 1I2DA 1OV6A 1SVKA 1V11B 2OHVA 1S2GA 2VRBA 4NEGA 4Z3OA 1O0BA 4A10A 4MJ7A 2BLLA 4FFVA 4JGBA 4LYJA 3RQ8A 2PLRA 4CUJA 3RRYA 1LIOA 4Z7OB 1E4OA 1UPBA 3EVAA 2VJAA 5AKLA 3O82A 3T4UA 3M6LA 5K7SA 1E64A 2XBUA 3I12A 5TPWA 3V4FA 3ZHCA 4Z1MD 1TQ4A 3Q9UA 4OMUA 2OBBA 4FB4A 3KALA 2CXOA 1DKOA 3DXYA 4GXTA 5B7NA 4DV3B 1LC3A 2VKTA 4ZWNA 2C29D 3S2YA 1JXHA 2JGVA 3EIUA 4YRDA 9GPBA 1VP3A 4FIZA 3M2TA 2Q4EA 4D57A 3O4GA 1NU6A 2GX6A 3EAFA 1R66A 1D0IA 1CY4A 2PMWB 3FD8A 3B6MA 3KKZA 3O4JA 1ZK4A 4JCCA 3E9NA 2Y76A 4JYBA 4O2BF 2XLCA 3T7EA 4AQYB 2A5JA 1T8UA 5L3ZA 3IA2A 1HE1C 5BYEA 3W2FA 1G8AA 1Q2XA 3CUYA 4PWYA 4CW7A 2X2FA 3HVJA 4WY2A 4RTQA 1AZSC 4PLYA 1YS4A 2IHVA 1KK2A 1DDOA 4PQYA 1E5QA 4WX2B 2PRZA 3UATA 3KQHA 2Q3DA 4WL0A 4MMXB 1SFRA 2BWJA 3G2PA 5CDSA 3SGLA 1UK7A 3DTNA 2ZB2A 4YJGB 2BRUC 2TMDA 5TY0A 1YFJA 2QQFA 4AZ3B 1KS2A 3I23A 5G3ZA 3CKKA 1Y6GA 3UWKA 4GRDA 3DFFA 2CFRA 3JTEA 3DNMA 2PUWA 3IVRA 3KOXA 4JP3A 4NP6A 2R4TA 4ENPA 3L41A 4BAUA 2ENUA 5HP4A 2IDZA 1RAGA 1WCIB 1YMUA 2A84A 1Z2NX 2SNIE 3DAYA 3BL5A 1CQWA 3HM2A 1NRXA 4U2EA 4UUMA 4CMGA 1UPFA 1GNTA 1KETA 1RBQA 3JQGB 1DUIA 3TDNA 4FFDA 3SICE 3UWMA 5AUNB 1YC2A 3L40A 1CJMA 4G5SA 2P9BA