3RSQA

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima soaked with nadh
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
490
structure length
490
Chain Sequence
HMKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords Putative uncharacterized protein
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 175
structure length 490
sequence length 490
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rsqA01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3rsqA02
4C5NA 1YGJA 2F7KA 3W4SA 3RQXA 5BYEA 3RS9A 3RSQA 2DDOA 3DZVA 5TRWA 2XTBA 1RFTA 1KYHA 3NL2A 3UQEA 4EN4A 1L2LA 3RRBA 1UA4A 4U7XA 2FV7A 3NL6A 3NC2A 4XF7A 4EBUA 1EKKA 4K8KA 1LIOA 4JJPA 4O1LA 3FHXA 2R3BA 4XDAA 2ABSA 5C3YA 4K8CA 5C41A 3RTBA 1RFVA 3GO7A 3IE7A 3KTNA 4B8RA 2JG1A 3MBJA 4S1MA 3B1QA 2DDWA 3NC9A 1WYEA 3VAQA 1V19A 5B6AA 3ZS7A 3RQ6A 3RSSA 3B1RA 1VI9A 3B1NA 3IKHA 3IN1A 3LOOA 2A9ZA 4XF6A 3JULA 2AWDA 3HYOA 3IQ0A 4EUMA 4S1IA 4LBGA 4XCKA 3NBWA 3B1OA 5EY7A 3RO7A 3K5WA 1RKSA 1TD2A 2HQQA 2RBCA 3RTDA 3NL5A 3OTXA 5COJA 2ABQA 1RKDA 4WJMA 1ESJA 3QA2A 4C5MA 2JG5A 3BGKA 1LHPA 3HICA 2NWHA 5F0ZA 2I6BA 4GM6A 2AJPA 2C49A 3RY7A 2VARA 4N08A 5C3ZA 3FHYA 3QAIA 3ROEA 2PKMA 5CM5A 2I6AA 3NM1A 1GQTA 3LJSA 3UMPA 3D3KA 1RKAA 1ESQA 3GO6A 2DG2A 1V1AA 3UBOA 4C5LA 4E84A 5F11A 3RS8A 3RPZA 3RTGA 5C40A 3DRWA 4C5JA 4DC3A 3PL2A 1LIIA 5TQIA 5CGEA 3RQ8A 2DDMA 4UBEA 3RRJA 3BF5A 4K93A 4K8PA 4E69A 3NBVA 2YXUA 3I3YA 4K8TA 4E8YA 3RSFA 2O8NA 2AJRA 3RREA 2DCNA 2YXTA 2AA0A 3CQDA 4E3AA 3UQDA 2QHPA 4YWRA 1C3QA 1VK4A 3EWMA 4E8WA 4EOHA 2AFBA 1YHJA 3Q1YA 1JZTA 4K9IA 5EYNA 3ROGA 3RSGA 3RPHA 3ROZA 3RRFA 3KEUA 4JKUA 3RU2A 3RTAA 1LIKA 3PZSA 4KAHA 1LHRA 1UB0A 1JXHA 1YGKA 2PKKA 1RFUA 2PKNA 3LKIA 4O1GA 3D3JA 3RM5A 3IH0A 4C5KA 4DU5A 2QCVA 4LBXA 3H74A 3IBQA 3ROXA 3RNOA 2F02A 1U2XA 2PKFA 3NCAA 4N09A 1TZ6A 2AX3A 4E8ZA 1EKQA 3MBHA 3HPDA 2JGVA 1V1SA 5BYCA 3RT9A 1TYYA 1DGMA 2A9YA 4LC4A 4LCAA 2AB8A 2HW1A 3UQ9A 3B1PA 2V78A 4KADA 4YL5A 1V1BA 1JXIA 1TZ3A 3RT7A 2R3EA 3VASA 4JKSA 3RQQA 3RTCA 4KBEA 4S1HA 3RQHA 3K9EA 3N1CA 3Q92A 4B8SA 3RTEA 1LIJA 2C4EA 4S1IB 1BX4A 5CGAA 3RU3A 2HLZA 2Q5RA 4PVVA 3RQ2A 3GBUA 4K9CA 3RO4A 3KD6A 3UMOA 3RQ5A 5BYFA 4KALA 2I5BA 5BYDA 3KZHA 3NM3A 1GC5A 3UQ6A 3B3LA 1VM7A 3LHXA 4X8FA 4KANA 1RK2A 3NL3A 3H49A
chains in the Genus database with same CATH superfamily
2PUJA 4Q15A 1JAHA 1YGPA 4CF4A 1ZUIA 1MAHA 2HV9A 1ECFA 1W93A 3EFHA 3N2EA 2MT9A 2HK9A 3NU1A 3QYJA 4MW4A 4O5OA 1V2GA 3AUJB 3AEQB 1KFEB 4ND6A 1QIDA 4WBXC 4LNAA 4BHTA 1GPJA 1ZCBA 4MJ3A 2H63A 3GD7A 1LDMA 4Z7NB 5MN5A 1ID8A 2B4TO 4OQQA 5HFAA 5CD1A 3MUOA 5JBIA 3NJ8A 2RCNA 3S81A 1P2GA 1NXTA 3OPQA 1YL5A 1Z5VA 1PJTA 4E14A 3HKEB 1G20E 2IKQA 1WP4A 3WADA 3NM5A 3M5CA 2VPTA 5B2EA 5LP6F 3LLSA 5JZOA 1KI1A 4NIMA 3JASB 5AWFC 3NOXA 1U7XA 3PD7A 3W9YA 5I7FA 1SKYB 3P5SA 4OXRA 4XOIA 3HC7A 1FX0A 1XA3A 3HPQA 2ENWA 1I10A 3GNTA 3KQOA 4C13A 3RUHA 2QX4A 3DS8A 3GXOA 1W78A 2A1TR 1U6IA 3FXAA 5AW0A 4GS5A 2JG5A 1QE3A 4YJ2F 3LI2A 1ND5A 2R11A 3GJQA 3ZD9A 3GCXA 3A2KA 2DSTA 5C51B 4IHJA 3THXB 3T38A 2GZHA 4DSNA 3PGVA 4OLJA 4XUCA 4E84A 1MRZA 3UBOA 5TGTA 1I3MA 1WB4A 3O4HA 2ETVA 4BNNA 3O94A 2I87A 3VPGA 2QPTA 3L0CA 3GZNB 2V54A 3CC8A 2E5WA 1LFDB 3V7YA 2CD7A 3I05A 4RLFA 3SN6A 5A1TA 3QPCA 3WFJA 3NTVA 3PIIA 4LUCA 4YJDA 1ZS9A 3NDPA 4OEHA 3EWMA 5F21A 3T9DA 5IT9A 1Z5ZA 2XVZA 5JQGB 1X80B 1WD5A 1IQRA 2I34A 5IBQA 4CKZA 1KK1A 4Q47A 4XWOA 5JYCA 4N0EA 1Q7GA 3OVMA 1RXEA 4OTZA 5FLEX 2VJQA 1DTSA 4JX8A 1NF3A 2C54A 1HYEA 3EF3A 3BFPA 4NESA 4H7EA 1OAKA 3EIHA 3K1TA 4IRMA 4O3FA 5L6MB 2FE4A 2O5CA 3HXOA 1J70A 4AZTA 2P5YA 5G0UA 1TZ6A 4YVFA 2AKYA 1YR3A 4E70A 1KGDA 4XWYA 5JBQA 1E4VA 1S2GA 2C0CA 5E2BA 2QJTA 3AI7A 2ZJ2A 1RM0A 4QQ8A 3GDFA 1EYZA 3A06A 3HKCA 4JHXA 1X8JA 2PPVA 4RHTA 3IAEA 3N8GA 4L7VA 3O7WA 3RV3A 3T5BA 3UT0A 3AL0C 1C0LA 2OK8A 3EIUA 5FCDA 2OPHA 4C03A 5JDIC 2VDPB 2QTBA 5K0LA 3PD0A 4S05A 1NRWA 2VZLA 3ODPA 3GQBB 1ONNA 4GGOA 3ZDZB 2Y1OA 2YIMA 1H2RS 4HADA 4QSMA 3UF0A 3AQIA 5KTTA 3U5ZB 1XJWA 3QFSA 2AFHB 2AWOA 2Q9BA 3INYA 1T0PA 1ARZA 4GZMA 4AKSA 3VYUB 2HK8A 3IMKA 5AI5A 3SSAA 3R3WA 2IYRA 5AK0A 1O95A 1GILA 2NSJA 2AMYA 2XCOA 3ENKA 4QUJA 4TKZA 3X1MA 3QVTA 1GGVA 3ZGZA 2FHSA 1FNMA 1C14A 4C29A 1K8ZB 3HWRA 3MLAA 3RVPA 4BV8A 1QRAA 2D62A 1N57A 1NW6A 1YIDA 3RR2A 1F2UA 2WSYB 3GHHA 1NU8A 5EUMA 4PGFA 2P9FA 2RH4A 5JRZA 1O8CA 2NU7B 4B73A 1OHHA 4BRWA 1J23A 1UPBA 4Z4HA 1HQKA 3K3PA 3K5HA 5LDHA 1DJMA 1I6LA 3ECCA 5JO9A 2GM3A 2PO7A 4W9NC 2J8ZA 2REOA 2AZXA 4LRUA 2OV1A 1VJ0A 2Q21A 1B41A 2H5EA 3K94A 3UXEA 3FKQA 4R31A 5I5EA 2AJ8A 5FI1B 5GOTA 2PM8A 2W6NA 3H5AA 1JHMA 3H2SA 2JG3A 2XVMA 1GG2A 2BV3A 3RVNA 2GLTA 2BMAA 2LCIA 3B48A 1UKZA 1VJGA 3T3NA 1E8NA 2X7JA 2XGGA 1PUJA 4OFWA 1XN1A 1R0WA 1XZIA 2QT9A 4FMCB 1ZIYA 1LTQA 1PNRA 3NI2A 3OOYA 2GM5A 4QYSA 5G0TA 1T9DA 4DJ5X 1MIOA 1T8TA 3STHA 2AJTA 4UCWA 2WJJA 2AD5A 4HWGA 4UHKA 5F1YA 2QNBA 1AMNA 5TE9A 4KREA 1CJBA 3PC4A 1XTSA 3EVGA 4ZJYA 2QIPA 2MTBA 3HXLA 2FRDC 1BQEA 4GPD1 2HMVA 1J0CA 3PDIB 5HIJA 5IBPA 2M1XA 2ECKA 4FCTA 3VR5H 2FDCA 2TECE 3PRJA 3PFNA 2CCJA 5ALEA 3D3WA 3GRVA 1KSHA 2I3BA 1BMQA 2O2CA 1J7KA 3PWKA 1ISFA 3QENA 1EGHA 1U99A 1C7IA 2VHQA 5F35A 2PUTA 5DHTA 1FE8A 3LK7A 4AIIA 5L3QB 1KETA 1U8YA 3GFVA 4HYTA 3AILA 1OD6A 2LIPA 4LWZA 2FW1A 3BCSA 1ZN9A 1O08A 3OZWA 4IXMA 4M9XA 1P1FA 5SYAA 4D8UA 4ZO6A 4KR6A 1QK5A 1VKRA 5IG2A 4HFNA 2XZDA 3LUJA 4NVRA 4FGWA 4KFCA 3OMWA 1Q0RA 1WW8A 2H11A 2BGMA 1PI3A 2Z2XA 4L74A 4KAHA 1X70A 4QBKA 1VL2A 3I45A 2R6CA 1SURA 5LL6P 4AWAA 3D5QA 3BQ9A 3UJ8A 1GT6A 1QV9A 1BC5A 2IZOA 2OQRA 1Z2OX 4QD3A 4QBHA 3RBAA 4KH1A 3NAGA 4Y0AA 3V1UA 4A6XA 4E12A 3MQFA 2Y1FA 4B6JA 4BCBA 4LOAA 4R1SA 3BZBA 3GLQA 3IHLA 3QM1A 3IFSA 4OH1A 4PWYA 2WBLC 4JP8A 3H9EO 2NU6A 1KEWA 4MV1A 3FVVA 4ENQA 1V1SA 1VL1A 3SEFA 5C8VA 3LOUA 3ZWKA 5EJ9A 1Z45A 1W7KA 1J0BA 5IN5A 4MKFA 2OGTA 1U0BB 1F7UA 1RKXA 1R6TA 2OGSA 2ZBDA 1JDBB 2CUNA 3SIRA 1SXIA 3KB2A 4WA7A 3GJ4A 4UJ3A 2HU8A 2O2GA 1U1EA 1NI4A 3G9QA 4B7UA 3VPHA 1BEUB 4B2IA 4C2BA 2VOSA 3QVSA 1E5DA 3HEBA 5JQGF 1OLUA 2B4QA 2C0PA 1ZWKA 2VQ3A 4MEBA 1E7SA 5IZCA 1J8DA 1ZQ1A 1XXHE 3BGIA 3KXPA 4FFWA 1ZH8A 1CLUA 1VYTA 3KR2A 4EF6A 1MP0A 2PKEA 2VXOA 3IS3A 3QXSA 4XCQA 3UWSA 1PWYE 3VZDA 2N3ZA 1ORIA 4IMPA 3L49A 4AX4A 3CSSA 5LXTA 2ZEJA 3LAWA 3MN1A 4HXGA 1C30B 1PV1A 3N53A 4XJXA 5K6AC 1YJ5A 3PEYA 1I32A 3R2JA 2NGRA 4IDGA 3C24A 3KFXA 2PNFA 3TE7A 5JWHA 3JQ8B 5IBRA 2EGGA 1HDRA 2F48A 4EY6A 4UDXX 1PQYA 2VSOA 4QDXA 3M9LA 4CR6A 1AHPA 2BIFA 1HNXB 1EVYA 4ARBA 1IDN1 2DR2A 3PQ5A 1IEXA 3GLKA 1LF0A 2AJCA 3SX0A 3ZZNA 3DOJA 1PSDA 4BL5A 1QB7A 1H3FA 1VPEA 3CUSA 3EA4A 2HF7A 2J6BA 3OQ6A 4UHBA 1N8SA 4TLEA 3ZNPA 1UWLA 4ZTUB 3B1RA 2HBZA 2TRSB 3PL1A 4GMDA 2PL1A 2ZJAA 4NQRA 5AM0A 4HATA 3RPEA 3K0FA 3EG5A 4Y2QA 2QZZA 3IBGA 1EK1A 4JEMA 2JFHA 2NAFA 2R66A 1UAAA 3DL4A 2VHZA 3SKYA 3ZWCA 4BQIA 1W8DA 3H2GA 4LHVA 1DV2A 3OX1A 3S40A 1E79A 4R1LA 4OHMA 4RHCA 2KYRA 1QE0A 2D1YA 1E2BA 3EZYA 5J43A 3EDCA 4G1FA 4QOGA 4OQ4A 3BGWA 2XYRA 4CMGA 4G84A 4O59O 4DSZA 2PGJA 3L7CA 4FFDA 3OFSA 1SZPA 1F2DA 2I1WA 3NCTA 4LSGA 5G1OA 3AR8A 1IHXA 2WVGA 4UOQA 2JFQA 2GCNA 2YFHA 3LWNA 2FGKA 4RTPA 1V16A 3M4XA 4RXMA 5A06A 3FZGA 5IVIA 1SN7A 2E55A 1J49A 4FMCF 4FJ2A 4XYGA 2EWWA 2J5BA 3EQ2A 4TYQA 1F6DA 4OMUA 2ASVA 1SXJD 1RLUA 2B9VA 3IAAA 3T4XA 1GPDG 2BR5A 3BMOB 2O3UA 5DLQC 4O4JB 2IHKA 16PKA 3M1LA 4UZEA 3RKSA 2VO1A 3UY4A 5JNWA 2CEAA 3GJ8A 3LE8A 4N0QA 3EOAI 4PC2A 3UJ7A 1NASA 2B3DA 3NBQA 1G1AA 2IGBA 3KYDA 3VDQA 4IMRA 6GPBA 3K0CC 2G8NA 3UBTA 3EPRA 1LX7A 4MW9A 2B20A 3ZE6A 1SCAA 5BVGA 1QANA 2YN4A 5CB4B 1UPFA 2M1ZA 4K3UA 3RFVA 1DTWB 1JYEA 3NORA 2XMCA 1MO3A 3O1JC 2R7LA 1X1AA 5EXEA 5KYXB 2JGVA 1Q0UA 3BXPA 1NW7A 2QD5A 1GL6A 5DVZA 3EASA 2ZDHA 1EBBA 2JGDA 2H7VA 3GLHB 3VR4D 4IWYA 5DZSA 4KRFA 1K6EA 3S29A 2PWAA 4FX5A 4YH1A 1QDEA 5KVSA 1KMNA 2XB9A 4YQZA 3WOVA 5F5NA 4ZU6X 2HLZA 3A6HA 2O7NA 3S55A 1CP2A 5CDFA 2AG1A 4NAHA 2ZUDA 4NFYA 4KRGA 5TMEA 5A4KA 1RBZA 2VSFA 1E94E 1CF9A 1X42A 5F2KA 3PPIA 3R44A 4D41A 1J1UA 2IU6A 4RJIA 5FP0A 2C7VA 3SVTA 4D74A 3BD9A 1NULA 2WJ6A 2K87A 3SC2B 2QG9A 1U8AA 5D51S 5EE9A 1L4KA 2Q46A 1U8TA 5FJJA 2WTEA 4AZ3B 4EHIA 4HAOA 2YNMC 3ZK9A 5KVVA 4MV3A 1Z0JA 1KS9A 3HZOA 4FGSA 2C42A 4TVBA 1D1QA 2XDAA 3GIDA 3CR7A 4NCHA 1XKTA 4D5EA 1VL0A 4L95C 3UIEA 1VHTA 4J7UA 1D03A 2DBZA 3SQNA 2R8PA 1WMEA 3BEDA 3HDQA 4XUGB 3ZKWA 3E1SA 4J94A 2C7RA 3GRKA 2A3RA 3OM8A 4I3GA 1RNLA 2AJDA 2G0AA 4GIBA 1FY2A 4NZ9A 1X1CA 3UK6A 4AJNA 1JBKA 3RAGA 3QVVA 3F7MA 1HYGA 1A77A 2TSYB 4K40A 5ERGB 5A4JA 1SHUX 4FW8A 3TPFA 3P9NA 1PK7A 1O5TA 1MO5A 5KREA 3TLKA 1I2BA 2ZSKA 5CT5A 3LX8A 3DHNA 1M1XB 3CY6A 1I0IA 4NU5A 4LF4B 1KH1A 3MJDA 1QH8A 1R6UA 3IHTA 2H3EA 1NC1A 3EF0A 3H2ZA 3K8OE 5EKXA 3RF7A 4F1KA 4PG6A 5BSGA 2F8MA 1XOIA 4XD2A 4QRHA 2FWPA 3DXXA 4L07A 4NDNE 5EWMA 2HHCA 2KLHA 4XQEA 3L02A 1NVDA 2FSPA 3HMKA 3B3FA 5C8YB 2FR8C 1EGQA 1KHTA 1QJCA 1TPZA 3G0BA 1QH1A 2HW8A 1I3LA 2X5NA 4PQFA 4RZIA 1VJTA 4D9NA 3L04A 1IDOA 2B8EA 2XZPA 1OFUA 2PX8A 1LIIA 4RQTA 3SHWA 1CFZA 1BD4A 1EVLA 1O77A 1OA0A 3P4UA 3A4MA 3WV4A 1NXXA 1ST3A 4HFMA 4LOIA 4KPFC 5IT5A 3FMVA 2AMFA 4NJEB 1RCFA 1N5IA 1X7WA 3K5IA 4GX1A 3QBVA 3S2SA 3SF8A 3QX3A 4WY8A 1ZOPA 3KIPA 2N1MA 1Z12A 3KJNA 5DW3A 3EWAA 4KIWA 2H8GA 3KLBA 2Q5IA 1VG9B 2PKNA 3L6EA 3FPSA 2QMEA 3JR3A 3RFUA 4R69A 4EVSA 4G5OA 3G9TA 2W2LA 1QGYA 3UMCA 1E58A 2O3JA 1SB8A 1JHOA 4GLBA 4OJKA 2CCKA 2DEUA 1V4BA 4I50A 3VNBA 3L7YA 1W59A 2V3VA 2G82A 3WQBA 2JLVA 1RAGA 3DO8A 3K73O 3L40A 4LWQA 2Q1XA 3AHGA 3UCXA 1P6QA 4RTQA 1JDTA 5KVQA 2V03A 1DKOA 2BF4A 1S9DA 2G3YA 1ILEA 1CUAA 2UUPA 1DJPA 3RE1A 1UM9B 1WV0A 3AR7A 4EA9A 2A0WA 2R3EA 3AI1A 3WDMA 8OHMA 3NHPA 3OCXA 4IUDS 4MCIA 3HZRA 3PGMA 3RU7A 4KWIA 4B4KA 5BMOA 2CE2X 4ZQIA 4O4JF 5AVVA 4P35A 3SR4A 3HP1A 3W7AA 2N9UA 1UMBA 1R4MA 3O31A 2VCEA 3P32A 1G0OA 3FZEA 4I8IA 1KBOA 5HIAA 5KYYA 2FRXA 1A2OA 4CETA 2CYAA 2CWDA 3REFA 3IAUA 2E89A 3O83A 3K6SA 1DCFA 1G21E 3C6MA 2XUKA 3HY6A 1HOTA 2Q5EA 2DUNA 3L8HA 5CB4F 4MQMA 4PS0A 1O96A 2I4NA 2X0IA 5T8KA 3VNVA 4WIAA 3D64A 3DDOA 1THZA 5CRIA 4KX3A 1RAHA 1WMFA 2QE6A 2NNWB 1RFLA 1Y5RA 3LMKA 3NKFA 4HYQA 4IEFB 4IZHA 3AM5A 3FSGD 3GEPA 1P81A 4MQEA 4RV9A 2UVDA 4EG5A 4O2BB 2YASA 4Q48A 4P83A 5ED0A 4KN6A 3UAXA 3WMFA 4U5QA 3BXEA 4FCCA 2PGLA 1HLDA 1THTA 2X8LA 1KORA 3CNEA 2Y76A 4EGJA 1I3KA 1TJ5A 1RJFA 3PFHA 4JJKA 2N75A 3WLPA 1ADBA 1DBSA 4WCFC 1XQYA 4ACBA 1VIAA 2FZGA 4D9BA 3DVQX 1Z5NA 3H1GA 5DLDA 4OJTA 2XRZA 1UMKA 1ORTA 1KEZA 3GXBA 1DEHA 3IESA 5T67A 1L7DA 4DNPA 5JIBA 3DLPX 1DCTA 3LOOA 1F06A 1QIIA 2GBGA 3Q98A 5KCMA 4AKIA 2QN8A 3I28A 3W5CA 2RHMA 2ONZA 3CR8A 3SOZA 1Z9BA 3ND8A 2VJKA 1DU4A 3D7KA 2EP8A 1QHGA 3GZTB 5LQAA 3SJZA 5AVTA 1YDHA 2JLZA 2ZYUX 1SR8A 2CN1A 1KWKA 4GZ3A 2KI5A 4XXHA 1KI2A 1VYUA 4WXPA 5DYWA 3RIEA 3E35A 1RHMA 4Q3LA 4U4AA 1D6NA 5GGYA 1V25A 1CY8A 4EPWA 2RE8A 2EBFX 5EKTA 5K0JA 4DLLA 3NRBA 4RTRA 1UDXA 3G0HA 1XROA 1BMFA 1MENA 1FYXA 1JP7A 1J7JA 2BCEA 2D1QA 2UDPA 2I4OA 4L6IA 4LBYA 3MERA 4BNWA 5JC1A 3HDYA 1Y8RB 2I78A 1FVOA 2R5NA 2PGIA 2XUFA 3C3MA 1MG5A 4M1OA 4B40A 4ER6A 4IYRA 3PEUA 3WNCA 1CYDA 2CLHB 5SZKB 2WHQA 1FCJA 2YXNA 3AZPA 4XX0A 5CR9A 3LWBA 1ZH2A 2I8CA 1WVMA 2Y0BA 3DV2A 2P4QA 4I8DA 3PT9A 3UMYA 2I7CA 1M2FA 2WSSA 3ZIAA 4LF5B 4IV0A 4EOGA 1T36B 2LGJA 1DKRA 3EEYA 1G5FA 3KZCA 2W70A 4NP6A 4BPRA 4ECAA 1PT6A 1LTHR 1YQUA 3QU2A 4MULA 2WB4A 1YZ3A 1BG6A 4IG4A 3TS1A 1CUCA 1H2AS 4YK7A 1P18A 2ACWA 3BF7A 3JV7A 4YJGB 1GFZA 3S3TA 1JDJA 5C8YF 2UZIR 5G3ZA 3GWZA 4LYEA 2P90A 5H4HA 4GKKB 2GHIA 5DTJA 5J23A 1YS7A 5JH7A 2R2AA 4TSRA 5KU1A 2WM9B 2QZPA 1OX4A 4GZ5A 3MK31 4UAJA 3G1WA 1VZ2A 1RSZA 1T29A 3R6GA 4I14A 4DIDA 4DL9A 1H6CA 4C3OB 2MMCA 4LZLA 1G20B 1S6YA 3NIFB 2VH2A 5JU6A 2IY9A 2E49A 1TQHA 1WLYA 3MMNA 4QOJA 2VH1A 3FWYA 4H6PA 4AY5A 1CQWA 3SIXA 1RRVA 4EZIA 4BNLA 2R7KA 3MHPA 1A4UA 3I9MA 3LDUA 4G8DA 3ZGYA 4EFMA 2P4EA 2JC3A 1AKNA 2IYZA 1ZD4A 2W8ZA 3ADOA 3MWLA 4KALA 5BYFA 3RUIA 1A1VA 3MTDA 1GOTA 4HWRA 3FF4A 4RZ2A 5AMXA 3PQ6A 2GKOA 2PX2A 5K6RA 1TQ4A 3OPYA 1JKXA 1JQJC 1KNXA 1N3LA 3QLVA 3HJNA 3R40A 4HLCA 4NFLA 4WLFA 2VPPA 1FFWA 1VLZA 2VSXA 3RSCA 2AOWA 1F6WA 2BDUA 2ZJ7A 3PK0A 2ARKA 3KKZA 1XDSA 2DQZA 3QKUA 5TV2A 3JD4A 4M9UA 1I7PA 5SY9A 2VDKB 3ZUPA 4IIYA 4IDDA 1P5FA 2BHRA 2AN5A 1B3BA 2N47A 3L4BA 4JL5A 4U39A 2G9QA 1RPTA 1D04A 1UP7A 1V9SA 3U3RA 3U62A 1ZW6A 4GLLA 2VDWA 3I9OA 4DQKA 3PE4A 2VTKA 1Y9DA 4PZCA 3WNBA 1T2VA 3ZE8A 1PSZA 2EJVA 1SVKA 3QLUA 5JXIA 5AT1A 1Y5LA 4V0QA 4L0DA 3DD5A 4PXYA 1Z62A 3PCTA 3R75A 5EY7A 1U0TA 1ES9A 3RTDA 2ZTMA 3L4JA 1TKAA 1XNQB 3B9QA 4DBVO 2Q2WA 1V35A 1QPBA 2A9FA 2OKCA 5EHQA 2YHSA 4BO5A 4F72A 4YMGA 1VE3A 3G2NA 2PY6A 3GLGA 4TM8A 4DRXA 4LVNA 4CGYA 3LY5A 3EZNA 4O2BF 5CM5A 1RTTA 3UGQA 1I94B 3AUSA 5A6SA 4DKJA 3GLFA 5D00A 3O8QA 1JPJA 2HIGA 3GN1A 13PKA 1RZ3A 3WBJA 1CEYA 1P1JA 3IUNA 4KR0A 5I7UA 4BBAA 1QZUA 4GICA 2HCRA 3W2TA 3ZM6A 1I51A 3U7FB 2BFWA 2R48A 3L41A 1XU4A 2R85A 4O8ZA 3HSKA 5DBGA 4CV3A 1U4NA 1ODTC 1YS6A 1Z8NA 1BSVA 5BOSA 4K1XA 1T6XA 2JARA 1TA0A 1BX1A 1E1MA 5B7GA 4NONA 1ADGA 2Q3FA 3L6RA 2QJRA 3VYWA 2XXAA 4IX1A 2CLDX 4BX2A 1VHWA 3AR4A 1G7SA 4ZVQA 5BW4A 2ZJ3A 3ZHQA 1CVRA 4U7HA 5E7MA 4YRRA 4N3GA 1NTOA 4ZI2A 2OSVA 3H1TA 1VKJA 1P77A 4QOIA 3WTCA 4CUKA 2H0AA 1P31A 1YMUA 1RWPA 3G5TA 4KO4S 5DCUA 3SEAA 1THMA 3IE7A 4YLEA 1KVQA 2O1EA 2BVNA 4HVTA 2P7HA 4E08A 4HH4A 1C8VB 2WVAA 5HKBA 4XR4A 2QTVB 1EE2A 1OTXA 1OZ0A 2GNOA 4YECA 3LDGA 1Z82A 2J9YB 3E70C 4KIFA 5ICGA 4G4JA 1XB2A 1Z7EA 3QEOA 1YE5A 1RM4A 3ANNA 3DDCA 3E15A 3WDLA 4D25A 1M2OB 1PJ4A 1B6TA 2D0DA 1M73E 4YCMA 3AVXA 3SZLA 3HO8A 1K3FA 4OGGA 4QULA 1RYMA 3ELBA 3PFCA 1NYRA 3DF7A 3DDZX 2PU5A 3DTTA 3S7ZA 5KTNA 3RQHA 3JARB 1HDGO 3ZJ4A 1K08A 2ONJA 1YTUA 2AOTB 1E3TA 1DBVO 2V7QD 2VA8A 2XGSA 2XUAA 3ASYA 2ZRCA 3CH4B 3KO8A 2W90A 3FUTA 3NHAA 4JOBA 3RRMA 5ESWA 1ZAYA 2ZJOA 4B31A 4RKWA 1UZNA 2W7TA 4UNPA 4WAUA 4CDGA 3PKZA 3FCEA 4DMRA 1PS9A 2FV8A 3O8NA 5A9TA 5BY2A 2G88A 3P9YA 2HXGA 1WP9A 5A3QA 3H49A 5A6VA 1SXPA 3PD1A 3II6X 1D7AA 2OFWA 3MUEA 3GP3A 4PG4A 5EXSA 3S4YA 3ZHXA 4WK0B 1C29B 5ITWA 5KOIA 3PFWO 1TM4E 2CLOB 4HDNB 4R40A 5DFAA 2B8TA 4P22A 1WZNA 3FNIA 4NBRA 5EIOA 221PA 5HJ7A 1LFAA 1OLXA 2BM0A 2DWOA 1KI6A 4GG1A 4M98A 5AHWA 2GCAA 1FDWA 2Q9UA 3UYKA 3BYZA 2VORA 1QP4A 2QR2A 4EZBA 4YC7A 1X1EA 3T12A 1EDBA 2JIZA 1R9MA 5AXAA 1VSUA 1ZUNA 2N42A 3L3BA 4O2AA 4UFOA 5L7TA 2IUSA 3PYMA 2DMRA 1JI0A 4NR0A 4OBXA 4X44A 4X85A 4N65A 2C98A 1DINA 1D9ZA 1O7JA 2Q0XA 1IQUA 2RJNA 4GOOD 1K7FB 1K8YB 3X1DA 1GGJA 3IKMB 1NC3A 2PMWB 4FDVA 5CAEA 1GPNA 3ZU2A 2OTCA 4QDUA 4ZYYA 3HYOA 1ZD1A 4BP1A 1WG8A 3COVA 1G4UR 4YASA 4KPUB 7REQA 3OHPA 4NMWA 4GL2A 3L93A 1FFYA 3COYA 1U31A 2OM2A 3TZLA 4CEJB 2FJUA 2JGEA 1AUQA 4BZXA 3TFOA 3WQQA 1ZD9A 1HNWB 2O19A 3T1NA 3EEFA 3DTYA 4OP1A 4AU1A 3B8EA 4DLWA 4QJ3A 9ATCA 1DAHA 1DC5A 1DBPA 1QNFA 4FFBA 1I7SB 4L8YA 3W5VA 1W73A 1JTFA 2C2GA 4BJ6A 4IUCS 2BWJA 2PN1A 3GFGA 1BE0A 3D02A 3CRNA 4MP8A 4MVJG 2HGSA 1QAMA 1XRNA 4LZOA 4TKVB 3T7KA 2BMVA 3HKDB 3S2YA 1UWVA 2LRHA 3ER9A 5HJ5A 1IULA 3HCAA 4PC3A 1H93A 5JJBA 2GNAA 2OCXA 2RHCA 2CXSA 4TOIA 4E3AA 1FFXA 5ALWA 1X77A 5JTUA 2E5LB 2AG0A 2PSEA 3GUHA 4D56A 3W8DA 4TTSA 4J76A 5AI0A 3C5EA 4CLRA 2POQX 2CHQA 3BGSA 5IYZB 2Q7DA 4NLLA 2II6A 4H27A 2EC5A 5FUYA 4U2DA 3U7HB 1YGKA 3ST7A 1FGSA 3HVRA 4L22A 4OOEA 3FE2A 2R2GA 2QQ5A 3MLBA 3BWXA 4NMHA 4P0TA 3E2MA 4KITB 4WOJA 1TDJA 5MFPA 1P0FA 4IJ5A 5B1YA 3JWGA 4JT9A 3TG2A 1BDJA 1J9GA 2I7XA 1X15A 2RKOA 1RI4A 2ZRQA 1AV6A 3FUWA 2ZSFA 5ULLA 1P5ZB 4G0VA 4LTNA 3P2MA 2J0QA 4AN1A 3PFIA 1A72A 2C1ZA 3KETA 4B79A 1P74A 4KO8A 4KADA 1N33B 1GDDA 3JD1A 4REMA 4UM8B 3SZMA 4ANFA 2NAPA 1X7GA 1VI6A 1ISIA 3EC1A 1CLEA 1LB1B 4G8BA 4PVCA 3ZDCA 2WDPA 5DHQA 2YIJA 5EMLA 2F3PA 3PC6A 3ESXA 1GNVA 2ZIXA 4KXUA 3EXEA 4C01A 1EZ4A 2JHAA 3P9XA 1W47A 2QW0X 5I6DA 5L45A 3U7EB 2J5QA 1TAGA 2UAGA 2CZGA 2HFJA 4TTQA 3UB4A 2I8AA 4L8WB 3K7EA 3ZWQA 5EJFA 4DCMA 1MKYA 1QOPB 3FMFA 1P2UA 4RAOA 3ZQ6A 1E0KA 1C1XA 1E4EA 5FPYA 3KS9A 2ZYVX 2HPHA 1CQJA 2NW6A 3EQ6A 3H6GA 4AZ0B 2HA4A 1BXKA 3RVJA 2GDJA 4ZI3A 1WCIA 4I5DA 2XDQB 5FD8A 4YIHA 2PS3A 2QSZA 2P9ZA 2OAGA 1ISSA 1EWVA 4GOMD 4X5OA 5FA5A 4RNDB 4MWDA 2ZZKA 5KKNB 1EEHA 2C3YA 1SXJA 3ASUA 4IDCA 3V2HA 1E5TA 1T2NA 1XEAA 1FUUA 2G67A 2QAGC 3BB3A 3HGMA 4J0HA 1QTIA 2WTAA 4IZ6A 5EKUA 4MHTA 2H9AA 2AK3A 4XQCA 3WWEA 1UIRA 2DHDA 3MB8A 1C9KA 2HAEA 4J3JA 4KBFA 1DRUA 4BC0A 4E2YA 1G8PA 3MTEA 2H1RA 4BZWA 4E51A 1M75A 5GJWC 4QPCA 3NTLA 4TLMB 3JZIA 3SXUA 3BERA 4HXFB 4D0LB 3QXGA 4TT3D 4DDMA 5JAHA 4G81A 1OFIA 1F38A 1P1CA 5LZ9A 5KAMA 5I9NA 4DWVA 4W5HA 5KQRA 2XNHA 3OTIA 3FDZA 4CTJA 3N5CA 4MROA 4A1OA 3F9CA 3K4HA 5AVSA 1ZQ9A 1XGKA 3QEAZ 3UQYS 1M33A 3GH1A 1XPOA 3AVWA 2DFLA 2I7VA 1H9CA 4M3NA 2NXCA 5JLJA 4Q93A 4N5NA 1RFGE 1XK7A 2PUHA 4CLHA 1ANKA 2E7ZA 2Z9BA 4LRYA 3BBLA 2BZ1A 4E5SA 1G8SA 1II8B 1NVBA 1XTJA 2ORED 3OM1A 4MAAA 2V5AA 4URFA 3H5IA 3WZ2A 5J4LA 2CV2A 2A0KA 2G5CA 4MYTA 2CHGA 4NJMB 3ZHCA 4DSOA 1ZXBA 4RTJA 4UBEA 1NFRA 4WADA 1H0SA 4BOYA 2BCGY 5IN4A 1PFQA 3ICCA 2EKLA 3EGOA 3W5DA 5HDQA 1B1CA 5GINE 3K71B 1W0CA 1YZNA 3HZZA 4AG6A 4TL8A 2YXTA 4HKTA 5I51A 3MBIA 4FHGA 3TJRA 4ID9A 3N8HA 4WEQA 4XYBA 3ZK7A 3X1JA 4WLUA 4ZIRA 1H9BA 3TDKA 3EWIA 4D44A 2FZ4A 4MS4B 5A3VA 3OZ7A 2BTEA 2H29A 4ER3A 5C4GB 2MINA 3JD2A 2C61A 4GRDA 1XLVA 2Q3DA 4LJLA 1XTRA 4MUIA 1Q1QA 4YEDA 2RIPA 2Q3MA 4K0RA 5TNXA 3ZW8A 1KXJA 1O5OA 1QG4A 2QLNA 3M6IA 3UANA 3U6KA 2PX4A 1NHWA 1EDOA 5DTEA 3W7BA 1CY7A 3WWOA 3EUWA 3JYOA 1US8B 4N1AA 2FWBA 5JFTA 3DXZA 4MKGA 3N2KB 1MT0A 5FL7D 1IK4A 3TO5A 4YP0A 2FPOA 5EEHA 3LC1O 5HRAA 1V4NA 2WJVA 4JLPA 5TF4A 4EO4A 1G2OA 2VEDA 3KJHA 3R20A 2ZCJA 1GG5A 3OG9A 1NPYA 4H08A 5LIPA 2IZ1A 5ALIA 1EUCB 4GMKA 1DJQA 2HNKA 1U9ZA 4CIDA 3LHFA 5DB4A 2WPDA 1VHJA 3KAJA 1B7GO 3T52A 5IYZF 3GGJA 1V8BA 3FUXA 4CHTA 1GPYA 5H82A 1UKEA 5HZKA 2HRRA 3GFTA 1WSAA 3ICVA 1AQIA 1PZMA 4LZAA 4RJLA 1F5SA 4NG4A 3WOHA 4BMVA 4YP1A 5F23A 4Q3AA 4L28A 3WR5A 4B35A 4FFNA 4FIDA 3W34A 1RP1A 3AUUA 3KLPX 1IUNA 3DLTA 4Z9AA 2C5SA 3QBEA 4AJ1A 2A9ZA 4OHWA 4QXPA 1X38A 5CLFA 4PICA 1WBDA 3ZM5A 3LUHA 1DDGA 3FMGA 1SQ0A 3IVGA 3W3AD 3DHYA 5TMPA 1CR0A 3TIVA 1PHRA 2VI5A 4IDFA 4M37A 2C8JA 4U2BA 5LQUA 4YCDA 3FTNA 3QQ5A 1JN0A 4S1MA 1H2EA 2Q28A 4R2MA 4JLNA 2GFHA 3HU5A 1OR8A 3SR3A 5ARBA 3LFHA 1PL6A 2C88A 2AMVA 3B6KA 5JZ9A 2DU8A 1ZVJA 1XFAA 3EODA 4Y9UA 1H4TA 1E61A 3SLRA 4Q34A 3NAZA 4KGDA 5JSZB 1T1SA 1Q91A 1Z2NX 2JK0A 2P2YA 2WJHA 3KOWA 1T13A 5AW5A 2ZITA 1N6IA 1P5JA 3H8WA 1GN8A 2ZYRA 3IQEA 1XX6A 3KQSA 4FZ5A 4AS2A 2RK3A 2C2WA 1E2MA 4Y2HA 2NU8B 3MINB 1XUOA 4EFNA 2LW7A 3PFBA 4KKVA 5IH3A 3QAIA 3QTTA 4YACA 4LV5B 4WCFB 5ICSA 3OF3A 2EP5A 4H3KB 5BWOA 1QNLA 2OA0A 5KYUA 3NM1A 1HYQA 3LGAA 5LR6A 3MBOA 2ZJFA 3N2AA 1FQKA 3A70A 4FLMA 4KDCA 4O8CA 4RVNA 2ZBFA 4ZTBA 1P2VA 2GZ3A 3CN7A 3RH0A 1CNMA 4TKLA 1SPXA 3SQMA 3BF5A 3MT7A 3L1VA 1X7ZA 3OZEA 4NC9A 5B7QA 2AMLA 1AQ6A 1EXNA 5FNZA 3JS5A 1M6VA 2ID9A 3IUQA 4R0NA 4QTYA 1MU0A 2G76A 3KDAA 3REQA 2HU2A 2O5RA 3TWOA 2Z09A 3RVQA 3WYGA 3NNSA 2F3QA 1DQYA 4H17A 2H51A 4ITUA 3Q8MA 3NIDB 1KP2A 1YNSA 2J08A 4L3OA 3VI4B 1GR0A 3ROGA 5K4GA 3FSGA 3DAGA 3IT0A 2O5VA 5K8JB 4MYCA 3JATA 3J80A 2IGTA 3TM4A 3N07A 2HWYA 3O21A 4GDFA 4TZ0A 1H85A 3Q2KA 4D98A 2DECA 3LVBA 4AXXA 2ZULA 2C4MA 1N3BA 4XIJA 3G0IA 1PEYA 3D4BA 5CH8A 3DWGA 1RC8A 2Q07A 2PJUA 1YACA 2GYUA 3ANXA 3CZMA 4NCKA 4AQYB 1S3IA 3M6UA 1B74A 3AUKA 3DE1X 4LN1A 4CV1A 3WLOA 1JT2A 1RBYA 4PPFA 1QZXA 1MO4A 2W6JD 3A3KA 3PUHA 1YB7A 4LQCA 3QTLA 3O4VA 1X9HA 4JT8A 3L7DA 3Q7TA 1FNDA 5IVHA 3RTEA 4WESA 4ES6A 2YS7A 3AINA 3HJAA 1DRKA 2FOLA 4HHEA 1YIAA 5K1ZA 1DFIA 1M3SA 2A9PA 2DPGA 3AG5A 1C9JA 4D3DA 2GN1A 4CKBB 2HC9A 3FSEA 5LZ8A 3HGQA 1UADA 4UE6A 4MPJA 2TS1A 2MYPA 3E5RA 3JQBC 2WILA 4BLOA 1RJ9B 3LDFA 5K8LA 1E1RA 1J2JA 4M9CA 4PSKA 3WIDA 2BKAA 2RBKA 2PQ0A 4JB2A 1EJBA 1G291 3HWX1 4UULA 3WLEA 5AW1A 2H5JA 4JODA 1IONA 2FU5C 4KOEC 4Z51A 3HNOA 1JMYA 3VO8A 4C1NA 3H16A 3Q3HA 4CQMA 4M0DA 1FX1A 2VWPA 4XM1A 4FSHA 4E15A 4H7KA 1Q3HA 4FXPA 5A03A 4X7MA 1B2RA 1Y4UA 1M6YA 3EFEA 2CHUA 4I7EA 3TX2A 2NUPA 2O06A 4RJTA 1DRJA 1OMOA 2VLBA 3JZAA 5LQCA 2QEQA 2V5UA 1VTKA 1L6RA 5ALXA 3DTVB 5FR2A 3DZCA 5BW8A 3GP5A 3VHXB 3VXKA 4NHOA 2MSWA 1P39A 4JLWA 1S02A 1KZ1A 1J5EB 2BBOA 1JQKA 2RBCA 1GGKA 4CEIB 2QZJA 2DFPA 2VYND 2Z2IA 5K0NA 1I24A 4GSYA 1ZGJA 1WO8A 1AHNA 2C9DA 3KSDO 4EAAA 2QBYB 4JLVA 3M89A 3FTDA 4M53A 3V8VA 4WXHA 2WTBA 4UDOA 4PFQA 4E5MA 3PC2A 5C3ZA 3T0FA 2GHTA 1RI2A 5JO0A 2I6AA 2GCOA 4JCOA 1L0BA 1XU7A 1MPXA 3BA6A 3UB2A 5IW8A 1KIAA 1Q77A 3NRCA 4HTFB 4WKCA 1GZ4A 5TY0A 4TS9A 3D54D 4KBYA 1DWPA 2ZG6A 3RGGA 1EQAA 1USGA 2VAXA 2XA1A 3NC0C 1GZ7A 4K6OA 4TN1A 4EW3A 3U4MA 5FO1A 3NIWA 3A4TA 4UUMA 5C1OA 3DMDA 4B3GA 3VDXA 3T06B 5C46F 1E9EA 4BB9A 1BIFA 1U7HA 2QZ4A 1Z0AA 1RC1A 1USUA 2I8LA 2VP4A 4A10A 4QDJA 5A5FA 3FR7A 4RZSA 4Z5XA 3E0XA 4MGZR 4N5IX 4YRLA 3RSGA 2QPLA 4EB8A 1XE3A 3A28A 3R41A 5EG5A 5KJ1A 5FH9A 1K68A 1P4HA 1VFPA 3J81k 3GRZA 5B4VA 3GJ0A 1LXCA 1YFKA 2OBFA 3ZI0A 5IFLA 1T1JA 1V6SA 3OLWA 4Q6BA 1I13A 3ND9A 4LY3A 4R1MA 4ND2A 4W82A 4ZDIA 1U65A 1VL5A 2FCAA 2ZS9A 1GZSA 1N9GB 4K03A 4O02B 4P82A 3SF0A 3GHYA 1AKQA 1AE1A 3WMGA 3ZI4A 5J2TB 3EQZA 4I81A 3FGNA 4UAUA 1Y5IA 3QUCA 3GG9A 1RR6A 3OKFA 4EUKA 1U6KA 2DQ4A 2XXBA 5HKKD 4XDGA 4CM3A 2D7JA 2O7VA 4W5QA 1SVSA 2V58A 5LBTA 4QYTA 1KMHA 2VNAA 4CFZA 1U81A 2WIJA 5ALGA 5FA8A 1IN1A 4QVGA 4DA8A 2DBQA 3TCXB 1W0KA 3E8MA 3PIDA 3K70B 3FMPB 2A67A 3R5TA 4ND4A 3DZHA 1UJBA 1XRPA 5D5QA 2SICE 3X1KA 2BGGA 3BFJA 2CLLB 2QZ9A 5F2NA 3OJXA 2WD9A 3RU9A 4AJJA 1UOQA 4JLOA 4DCOA 1P33A 4ZVKA 2WSIA 4EUSA 2YCLA 4DEVA 1T2UA 1RADA 4I0WB 4K6MA 1N0UA 1YE8A 4LJ4A 5DNAA 2P6MA 2V6JA 4NZOA 4AN0A 3D6AA 2OFFA 5ED4A 3ADDA 3B5IA 3LP8A 2QX7A 4GOND 1SCUA 4Q4JA 1NYLA 3LT4A 2J9GA 4W4TA 5C80A 5DM0A 5I9IA 1QP0A 1CUIA 1Y33E 2P9TA 4DC0A 4Y2UA 1CS0A 1EM6A 3N1UA 5A0TA 1DE0A 1QG6A 1VPVA 4BO3A 1IOLA 3F1LA 1VKHA 4CLOB 1EM8A 1SC6A 2CDCA 2PQ6A 2QUBA 1D2MA 4IBOA 1J06A 3V5NA 2ZDGA 5C4IA 2IQ5A 5JSFA 1VKNA 1XTTA 2ESRA 3MWFA 1JF8A 3FIUA 5EFOA 3VV3A 3FZQA 4X20A 2VH5R 1CRPA 2O57A 2O2ZA 4FR2A 3B9PA 3IIMA 3KPJA 4OUKX 4F5DA 3WB0A 4RPCA 5EMMA 5H3LA 3E18A 3QKTA 1Y7LA 4WNAB 4G25A 4DMMA 2Q4DA 1M1NA 1ZN7A 1ZBQA 3DL0A 3GAZA 1OFHA 3K1AB 5CLHA 3I2GA 2Y1XA 3D8RA 4L6AA 4RPKA 4JK3A 4GM6A 3ABZA 1PR0A 5DEIA 2OCGA 1K27A 2ZWPA 3AYXB 1IXYA 2XF8A 2QVCA 1NNI1 4NABA 4X45A 3IUPA 1B6RA 3S27A 3UMPA 1N0WA 3NAMA 2FW7A 3BGVA 2HADA 2DG2A 1JBEA 1F4VA 3UM9A 1PWXA 3CINA 4YJ2A 4GPZA 2IODA 3H83A 3IOMA 2YFQA 1GSAA 1P2TA 1QAQA 2BEVA 3AJEA 3NDIA 3KZKA 4IVQA 2RGNA 4Y9RA 1ECJA 5FBHA 3MAAC 3TZQA 1QCCA 2WOJA 1K5PA 3GBVA 2NZ8A 1VLLA 2N46A 2YXUA 2RGEA 3RREA 3Q12A 1Y6RA 2VPZA 1PJZA 3PNPA 4ZOLA 2C5FA 3KEFA 3L84A 3S70A 3UMJA 1C3EA 4A5SA 3OF5A 1I7NA 1XHEA 5DNYB 2JCSA 1K3UB 4QPZA 2X9NA 4XGNA 4O33A 1FEZA 5JPDA 1W49A 3AYZB 4N4AA 2VP5A 3HYCA 3PQ8A 2A9JA 4QQFA 1JXHA 2NO1A 1B8OA 1R0LA 1WUJS 1B76A 5LQJA 5EGNA 1FQWA 3PNOA 2MU1A 4CQLB 4OHFA 1XMSA 5A9SB 4PGAA 2OBYA 3LBIA 1LWOA 2WKRA 2ODQA 4U9HS 5H1YA 2OM6A 3DV9A 3ZDFA 3ZV4A 2CVQA 3F4KA 2I2WA 2JLXA 1VM6A 1IUPA 1W6UA 3I4CA 4FBGA 4LJ7A 4NYMR 1EXMA 4QELA 2LXNA 2V55B 2Y8EA 3CLTD 1KAQA 1Y5MA 2C3UA 3KEGA 1GNSA 3GT4A 4QYIA 1W6RA 3O4IA 1NY6A 2GYWA 3IOYA 1HG1A 4WECA 3TL6A 1E6MA 4E5PA 1DQRA 4RZQA 4ZOEA 4IGKA 4YROA 1AQJA 3IPCA 3MCTA 3H5OA 5TGZA 4RKFA 3KWFA 2Q50A 1KP9A 2IV3A 1Y8CA 2XBUA 4B0OA 4HAYA 1XZDA 5C1PA 2XBMA 3O26A 2CXRA 1N2BA 2GA9A 2W2KA 3PFGA 5C1DA 3SMVA 1CPYA 2W11A 1L7NA 5JISA 2BBTA 1Z47A 3WLTA 1RZUA 2Q5LA 4EA6A 3CWQA 1DEOA 5HNKA 2EF0A 2HA3A 3ZXSA 4BUBA 1V8PA 3BJIC 3N0TA 1CE8B 5EXXA 4B9EA 3IEXA 5CP8A 2HA7A 4DV5B 1Y6QA 2AEFA 2XKBA 4JJFA 5J2TF 4DR4B 3BILA 3H3FA 4J0EA 2I6UA 4LF6B 1KYTA 1QIGA 4Z7OB 3EFBA 3DEHA 4A8HA 4LY9A 4E30A 2NV6A 3AY7A 4AUKA 4ESOA 4BVEA 1TM2A 1MQSA 2H4ZA 4XGIA 3ZE0B 1O3YA 3JQGA 2GESA 5A2QA 5C1BA 4RYDA 4B6RA 1A7JA 4IY1A 1NU6A 5HK8A 1AHIA 3ETEA 1LBQA 3LA6A 1NRJB 3STXA 3WYEA 1NNEA 2DB3A 1MOSA 1TD1A 1LC0A 3JZFA 1DL5A 1U98A 1SCNE 4PNHA 5L7WA 3I8SA 2QRVB 2DQYA 3N2ZB 5F9MA 1PW7A 1OLSA 1BDMA 2Z56A 3HXTA 4U7WA 3C8HA 2JI7A 3JVDA 1XMOB 3BHJA 1LDYA 4XJTA 2FDXA 1JGTA 2ZWOA 1CV2A 3ZHRA 4BQSA 4ZMRA 2E4ZA 1QB8A 1YZVA 2Q1SA 5HP4A 2ISQA 4Q9NA 2P4HX 1QH9A 2AWDA 1KA9H 4QOFA 2WT4A 4MXDA 3FGOA 5CB8A 3OJEA 2QTZA 1W5FA 3ZCXA 4AP5A 3N7AA 1TMKA 4IKPA 1U11A 4EHJA 3TDNA 4JXZA 3NBFA 3O82A 1YE3A 2IEIA 2FN9A 4G0OA 1GQSA 5FX2A 1NMXA 4PS1A 4FWIB 4MV0A 4JLKA 1PBTA 1RKAA 3WGNA 3M3HA 3FNQA 3OSUA 2DAPA 3OESA 4WXRA 2GZ2A 2OBXA 5DYTA 1IEQA 3L6BA 3EA0A 2QLMA 1MJHA 1W87A 4JC8A 3WKEA 4A6DA 4BKUA 4CKEA 2QL5A 4L78A 1E96A 3TVTA 3W05A 3DOUA 1DGQA 1ISGA 2PH7A 1Z6QA 4BTLA 1E5VA 2WD8A 3I3YA 2G28A 4X7RA 4BVFA 4YR9A 4PX9A 4V39A 2I71A 1L7QA 3GT3A 3ANYB 2B6NA 4LTMA 2YN0A 1C3QA 3K9FC 2FN4A 2J7KA 2GPNA 1JJBA 4AMUA 3EH1A 3I92A 1DKNA 5DTQA 3Q10A 2NPOA 1YF3A 1OZAA 1SOAA 3MTAA 4CU2A 4OM8A 3I9NA 1Z07A 1GHTA 1BW9B 4I9HA 1T0UA 2DTEA 4OVKA 2NVBA 1MJNA 1UZMA 1EQ2A 1FP4B 3IPRA 3MIZA 3P9PA 4ZGGA 1UZAA 3DMTC 1E3JA 3H5NA 1MOZA 1G4HA 1NWHA 2A9KA 3ICOA 4KQ1A 2C20A 4MO9A 4P4NA 3RWMB 1L5RA 3P52A 4IJQA 1L7RA 1ONBA 4R7TA 1N3IA 4N76A 5BUQA 1KYHA 3ELYA 2DJIA 4HNRA 3ZZUA 1GLNA 1RKUA 3FNFA 4ZVPA 4TT3A 3D6FA 1UF9A 4CFYA 1MXHA 1Q0PA 4ZQBA 5HM8A 3RADC 3THXA 5EFZA 1GPBA 1NGSA 2FQQA 1JR6A 4RUKA 5ALRA 4ZFNA 2PXCA 4PWZA 3B7WA 3G7UA 3A6FA 4FSXA 4GPEA 4Q7JB 3QPAA 3RQQA 1YCFA 2PO5A 4NAVA 4BWFB 2PD3A 2UYYA 3E9EA 4MR7B 3WJ7A 4EJ0A 2X8AA 2D0IA 4HH0A 1V0JA 5HTOA 5L95A 1CIJA 1GRQA 2B2CA 2UKDA 4NF2A 4DXAA 4YCSA 5KYGA 2QW1A 3D43A 4D4LA 1GC5A 2EKPA 4WBNA 1MNQA 1Z74A 1XP5A 5JQGA 1LVHA 5AICA 1DUVG 2PWBA 3AONB 4IXDA 5J4VA 1JH9A 3G6KA 3E2IA 4EHDA 4D3XA 2XTJA 2O2YA 3S2EA 2ZLBA 1T5BA 5GZ3A 4CMJA 2W8BB 2ZPAA 4ROSA 3VR6D 1FZTA 3R0VA 1NF9A 3CT4A 1TJNA 3QJGA 4WV3A 1W5EA 4B2YA 4B3RB 1CJTC 1EQUA 4MWBA 3L8CA 1YRHA 4RIIA 4DR2B 4X6LA 3IQIX 3GJTA 4JJPA 4QIHA 3CZRA 3GJYA 2C2KA 1PWHA 4A91A 1EE9A 5CEEA 2Z9DA 3DBRB 3NX4A 3V1KA 2YWJA 3ZU6A 4DVJA 1TOAA 3O2QB 4V03A 1X2BA 4LJ5A 1O95C 1ZSVA 3WDKA 3ZS9A 3PPVA 1PZGA 2J33A 2Y27A 4XA8A 4F96A 3IXLA 2ZZMA 5BMVB 1RI1A 2BR4A 1CY0A 1CNEA 2ICAA 2OEPA 2OZKA 2XEDA 4YYEA 3U7RA 4AO6A 2YWRA 5JC8A 3GQBA 3RYCB 4MPPA 1AV7A 3E81A 3L1KA 2CHVA 4JXKA 3MYYA 2CY0A 1Y9AA 5FL7A 3VX4A 4HVCA 4RCZA 2HGZA 1Z6YA 2HEIA 3UATA 3UXHA 1XXLA 2AFHA 2PZEA 3W5IA 2WJ3A 1ESJA 4GI2A 3RB8A 2DWUA 1A8HA 2ZI3A 4MEJA 5DNDA 4F91B 3O8RA 1H94A 1PR3A 1IBLB 4BECA 2YV4A 3U17A 3U44A 4HBGA 1YB4A 3G2IA 4V24A 5JY1A 1WVIA 4NXNB 4TMXA 3IV7A 5YASA 4YMWA 1PR5A 2XF2A 3H11B 1CZLA 3ANSA 3FWKA 4ECEA 3D3EA 4HEA1 5SYMA 4R2KA 2GEJA 1V39A 3FUVA 4TMVA 1DWUA 4WNIA 3T61A 2F55A 2A8YA 4K05A 3NJRA 4QVKA 2BP7B 2WNSA 3HA3A 4P38A 3C5HA 2XGMA 1GV0A 2HTEA 3D8NA 4Q16A 3RLFA 3LF2A 3WYFA 2R4TA 2I9PA 2PR2A 3AP2A 4A2PA 4DUGD 2CW5A 1HFJA 3MWDB 2DKOA 5FWNA 2OR3A 3PQCA 4RESA 1T9HA 1SIBE 4YJHB 3ZEAA 2Z30A 4EJMA 5DNWA 5EJEA 3DDSA 4RSMA 5FPPA 3RYFB 1LDEA 2YJGA 2BSQA 3QHPA 2RGCA 2BKUA 2X4GA 4DIOA 5ADUS 2GN2A 3EPLA 3KEUA 2BFFB 3EXAA 1N6OA 3GUUA 3W3AA 4FR5A 4K6FA 5CK5A 4MIEA 4EVIA 3K1ZA 2M6KA 3NYWA 4PXAA 4XGQA 3UMSA 1P75A 2JBAB 4UM5A 1DC8A 2RHDA 1T0JB 4DLPA 4FOLA 4RY2A 4JVLA 1IJBA 2J0UB 4N8EA 5EQDA 2V8OA 5H3CA 3UAYA 3UMFA 1JI3A 2ODEA 3LPAA 3T34A 4PPQA 2QD4A 1WOYA 4GP9A 4E4YA 4JJ6A 4MS1A 5FUVA 1YA8A 2ASEA 3OPVA 5AKEA 5TS2A 3DZGA 1E9BA 2G1UA 4RVFA 4ZT5A 4TWAA 5K20A 1NOJA 3KKMA 4WOCA 3WGIA 1UZUA 2KHZA 4G5YA 2BFAA 1DTEA 4GVLA 5HA5A 3QJ5A 4M0FA 2J41A 3M6FA 4RANA 4KBEA 4EYQA 2JIOA 2OFPA 2YYAA 1ENPA 3FNBA 4CE6A 1JWBB 4S1WA 4H0CA 5L3QA 4UVHA 5EJAA 2G6BA 1GXSB 3IPLA 5G41A 1IQPA 2PTGA 3DMHA 2VEOA 6REQA 4M21A 1IBMB 3GPBA 5JG7A 1YR1A 1FU4A 2B8WA 1R0YA 4IXWA 5CNKA 3C74A 4NPAA 1Q74A 2JFGA 3ITNA 3JPWA 2L18A 3JR7A 2YJNA 2H1HA 1E63A 4HB2A 4Z3KA 1GQFA 3IBTA 5FWXB 1EAYA 2ALJA 2WUWE 3A1VA 2C5LA 3C70A 2V3WA 3EGCA 5SZJA 4MQFB 3E2PA 3FHLA 4DPKA 2FSGA 2X5XA 1WU7A 3MW8A 4PO9A 5AKLA 4D0NA 1AO0A 4OHBA 4BAUA 3IUYA 2Y1WA 3SAJA 4DM7A 4A6EA 1QX3A 2H7CA 2OP0A 2ZWIA 3O75A 1AMOA 4RACA 1XCJA 2IYPA 1P17A 1MORA 4EA8A 3PLAE 1QQAA 1ZESA 2V98A 3HLYA 3WK9A 3VKHA 1NN0A 3IQHX 3TOCA 2HMSA 3TLJA 1T6BY 3T3IA 3UMVA 1OI4A 2CLIB 3H8SA 4H6XA 4Q9AA 1GNTA 3IIIA 2P0AA 4ND1A 4U0JA 1EE1A 4CT0A 1NBEA 1CVLA 2GSDA 1BOFA 4YCBA 4DQVA 1KMMA 5EIFA 4BQQA 4Q66C 4IJKA 1FYEA 2ZYAA 3EXIA 4ETNA 4K9LA 5BXYA 3HJBA 1W1UA 1XMJA 4Q5IA 3ETLA 1PBNA 5HS4A 1IBSA 1NWCA 3Q1KA 4EOHA 1JG1A 1FDVA 4RTKA 1XNGA 4G0WA 2HIAA 2XXJA 1T3LA 2JDID 3VOAA 1GG8A 4H9GA 3SZRA 3FI0A 4EG4A 3BA1A 3NL5A 4Z2AA 1YZYA 5ENVA 5ERYA 2F59A 1TT7A 1EK0A 1KWGA 4D4KA 2R0QC 1E7MA 1WEKA 3CNLA 4JBYA 2O8BA 5FHQA 2IF0A 2I29A 4MKZA 4QODA 4ADSG 4BO4A 4BTEA 4HK4A 2W6JA 2FN8A 4YUWA 1SRQA 2K6GA 2NOAA 4QGHA 3WXMA 1EA5A 4C0QC 1G6OA 1S01A 2GCEA 1QC5B 1JQEA 3S1LA 1C30A 3DGEC 4C6RA 1PR2A 4NCAA 5IUJC 3LX6A 5F52A 1QVVA 1V5WA 3V55A 1EFRD 2APJA 1PZHA 1UEJA 4G63A 2JCXA 4YMUA 4G2TA 1L3CA 4BV9A 3JQ8A 2NO7A 5BMVF 1U94A 4CG2A 5ALMA 1LJLA 2EGUA 1TTQB 4CDRA 3CVVA 3PT5A 4IJMA 2I1QA 2IHZA 1C9EA 4HRYA 4QDKA 5C4MA 2HA2A 3QLTA 3OSZA 3GJRA 1A9XB 3I8OA 3KZOA 1B16A 1C7JA 3P9IA 4NENB 5CUQA 2FSIA 2A1TS 3G8BA 3DE3X 2VF4X 3LKDA 4D46A 4KGXA 2PKKA 1YOVB 1G8AA 3HN7A 2HBYA 2IDZA 2DBYA 2OL4A 5TR9A 1BWPA 1YC5A 3OWOA 4W6ZA 5T3YA 1N7GA 3OZUA 3G9UA 3LXMA 4UTPA 1G5QA 4BLWA 2NMVA 4I66A 3ROXA 1O0CA 3R3JA 3FNEA 3U31A 5EP3A 3HB7A 5EGSA 1YCGA 2R6GA 3NPAA 4JOQA 2I33A 4R7ZA 2G70A 2JCYA 2GAFA 3HCPA 4FHDA 4OB7A 3ZTYA 4POAA 1QU3A 1XYVA 5DXJA 3GDHA 3B7PA 1SEVA 3O3CA 4B7CA 1Q0QA 2VPWA 3NRJA 4RWZA 4JR2A 4KHPB 5KJCA 2VYNA 3CWZA 4Q4AB 4MI1A 3S0JA 4JJIA 3OBIA 1WB6A 4INJA 2PYIA 1SGWA 1QVZA 4J0DA 5IXYA 3L8MA 3GMIA 1ZW1A 3L4EA 3U37A 4KDEA 3V00A 4IDBA 4CMEA 1QWSA 4RTSA 3RQ2A 1FW8A 1RC0A 1KC3A 2VK2A 2ZIUB 2B83A 2FA9A 2IHBA 1C3LA 1UMDB 4HGQA 4IEEA 3DZIA 2WWTA 1VPLA 2FZVA 3IQGX 1IY8A 2XIQA 2D00A 4IEIA 4P53A 5FPHA 1VSTA 1BE6A 3B1ZA 4ZDJA 1DFGA 4TTIA 4DARA 2VHWA 2YC2C 2CLFB 4KMSA 4UM9D 5ER6A 5FQOA 4V3CA 4D79A 2DDOA 3DZVA 4JNKA 1VGRA 3ZZMA 1OWLA 5CB4A 4QG3A 1HXHA 4JLDA 3TR5A 3JWPA 3NC2A 1M54A 2OT3B 1YQTA 3P0FA 3QNUA 5HE9A 1DTWA 1LIOA 3H75A 3G1UA 1ODJA 1K5DA 1XDGA 2I2FA 4RFVA 4DMLA 3H2JA 3B1FA 2C5HA 5AM1A 3AVPA 3VOBA 1ATIA 1YL6A 3D6TB 3SJ7A 2BEWB 2WDZA 1DO2A 3DNMA 4DCNA 2VR1A 2QN1A 4B6PA 2CNBA 1QF6A 3I2FA 2RI6A 1Z2EA 2GM9A 4DXDA 2R00C 2XE4A 1R8YA 5K3FB 3RQIA 4RHXA 4EUHA 2AXNA 2E4XA 4J49A 4TYWA 1VI9A 2CHFA 1P60A 4J6FA 3DOCA 1L4UA 4N0PA 4EB0A 4NV3A 5B3AA 2AFIB 3NBWA 2NP7A 1Z15A 4QUGA 4FHFA 4KQFA 1N1EA 4KUHA 1CCWA 5CLQA 2WE8A 4YT4A 4CXMA 4FGUA 1FDOA 2PG3A 2VZ9A 1EP1B 4M1EA 4RK1A 1WRBA 3JQQA 1WA5A 3PDHA 3PEFA 4ON9A 5DBIA 2X1MA 3VR3A 2R62A 4K87A 2GXSA 4NWIA 4TWRA 2COEA 4ZICA 5C3MA 1T43A 5FTKA 4XOUA 4NNOA 5FLXA 2FQYA 2VF8A 4C88A 2XYGA 3KK0A 4RDCA 4Y3UA 3BWCA 3AEYA 3ZCRA 4OHRA 2IS4A 3TTVA 4NG5A 5BNFA 5AW3A 2JD2A 4EPRA 3RQ8A 1ADFA 4D8VA 1TKBA 2WZCA 1KDZA 1ZL2A 2ZBUA 3ZJ5A 3I0ZA 4DKXA 1GZVA 3T1TA 4OG2A 4B74A 2XMPA 4WVFA 2ZREA 3MXOA 2Z1DA 4ABYA 1MEOA 2QR3A 1A9QA 4MR9A 3ITDA 4JSRA 4TV8B 1HDCA 1A9PA 1N75A 3RIMA 2DM6A 2MYNA 3ENWA 4MUMA 2HRDA 3D5EA 3Q6IA 2WFMA 5KQPA 3OCZA 4RIEA 4R4JA 4P36A 1JDUA 3PC8A 4J0GA 4BVLA 4Y67A 3SSNA 1OU4A 4US2R 4LXHA 5D7BA 3NJ4A 5KB3A 3P0RA 2WIKA 4HNUA 3NQ41 4OYHA 4IFEA 2ZRNA 3F6YA 4N7JA 4OQZA 1LUAA 2SCUB 1QVRA 1SUFA 4RBNA 5ENZA 2ZYIA 3LK6A 4WKNA 2A84A 5C8YA 3ZC3A 2FXIA 1KFBB 2CE7A 1PK8A 4I9GA 4F11A 3LHKA 8GPBA 5E38A 4TMWA 4TV9B 4DHEA 2B1GA 3GDGA 3P9KA 4ND8B 4YFYA 2P27A 5EIAA 3VZSA 3ZTWA 5EPOA 4CCAA 5BP7A 2HF2A 2YZ2A 4GQBA 1NOKA 4MMYB 1RJGA 4TZ6A 1DJOA 2JD0A 1UPXA 2NO0A 4LXIA 1R74A 2QRJA 1USVA 1ZVKA 3AU9A 5EXDA 1WZIA 2XD4A 4S1IB 4A6PA 1NQAO 4YRGA 1HT0A 2JRLA 3K32A 4IVNA 5KYVA 4HDMA 3U3ZA 4C0SA 4NCXA 4QDZA 1LVUA 1I2CA 4R9SA 5K8CA 1BMDA 2AOVA 1HFEL 1ZNXA 3G2JA 2DRIA 2ZBPA 2XZLA 1UZLA 1UQUA 2ORIA 4EPTA 1IZ8A 2VWGA 1C80A 1YGJA 4GC9A 4PQYA 1KPGA 3TEJA 3VRHA 4TMTA 2YC4C 4DLXA 1PYDA 3OEHD 3I1JA 3VSBA 1Y6JA 4M8LA 5P21A 4Q7LA 2P75A 1DQPA 3PA8A 2H3HA 3KR0A 4A82A 4GOXA 1L8OA 2G72A 2NT4A 3DUWA 4KAJA 4UM7A 3NM6B 3AY6A 2FWJA 3B2EA 3I2JA 3EVNA 5FUXA 1SD1A 2YWHA 3NOQA 1S2OA 3T9AA 5BVHB 4F6RB 1BDBA 1JZSA 5LJLA 2J3EA 4PQGA 4D26A 2JH8A 3C6YA 5GIPE 1J0XO 5T8KC 2DDWA 5K0GA 4IRXA 1TZ2A 2B30A 2R4QA 2AZDA 5BYJA 5BO5A 2AR9A 1AQYA 1TFRA 3PBKA 1B15A 3MNFA 1Q6ZA 3AL2A 4YRNA 1VMIA 3LH5A 1PR9A 1XQ9A 3DR3A 2XT9A 2AN1A 3R74A 1YR9A 4AP6A 1YH3A 3D81A 3M5PA 1BGXT 2L17A 2A33A 2FPXA 3VI3B 2JBHA 2CXNA 3FPHA 1XRQA 3MJTA 2RH9B 4GLOA 1QHNA 2INGX 3JWHA 5T4BA 3NT5A 1PGJA 4B3FX 5AD1A 1B1AA 2Z8YM 1M7GA 3CSDA 1R6AA 3AF5A 1JG6A 4WUTA 3RSZA 1ZZEA 4MV7A 1FRFS 1Z5OA 5C8DA 1ACLA 1XWFA 1C9YA 5C7OO 4FD2A 3KKLA 4YHBA 4W5TA 4DRYA 1JLKA 2EHDA 2RB4A 2FPGA 3AH8A 3MD0A 1W1WA 4WK2B 4YJ3A 3VZPA 3ZWOA 4BO2A 4UHFA 3KQQA 3EGIA 1A7UA 4K8TA 1CT9A 2I2AA 4Q00A 1W5SA 3EWSA 4HDAA 4LHXA 4BUJA 5K9ZA 1DC3A 1U2DC 3EDRA 1HDYA 1KH3A 1X1RA 2BRUC 2AR7A 3GRRA 3IXQA 2VA9A 3PXXA 2IUUA 3RC3A 2EFHB 1CETA 2QGFA 4ARCA 1TA9A 1Y89A 2HMTA 2PV0A 2B25A 3ENNA 5FLKA 2ZI6A 1FX0B 2GPYA 3JQ6A 4IV5A 4PGHA 3U9TA 4BE9A 4ZEVA 3IDFA 5EIXA 1XL1A 3T3EA 4R9NA 1VA5A 2AK2A 2YV3A 3DJYA 4LTDA 4MICA 3N6VA 4DLBA 2DH5A 3A9CA 4TS1A 2WAXA 2W58A 4EGSA 1YQXA 1HTBA 3EZ7A 4RY0A 5EHZA 1NVVR 1P8JA 4UHCA 5HKAA 4YQEA 1PX0A 1G7TA 1SWWA 1UXGA 3DEZA 1WWKA 4L2IA 1GTG1 4IHJB 4EP1A 5FBLB 2VDQB 4XARA 3V7NA 4A2WA 2K7FA 2QLJA 5FUWA 3ORFA 1XZBA 1G3IA 5EIWA 5IJXA 5D84A 3QUSA 1R8XA 1WF6A 3WGJA 4U00A 5A3RA 4BDTA 2JD1A 3CW8X 4H59A 1E7QA 3V1YA 3JTMA 4ZZ3A 4RTMA 4DQLA 4DIKA 2W2NA 5DHAA 2AQ8A 4YCJA 4TV8F 1KAHA 1GYRA 1J8YF 1E99A 3U4IA 3H9UA 3ZDRA 4P3NA 5EZYB 1G9SA 3AFNA 4BQEA 2EW2A 1KKLA 1JPNA 5BPHA 2ZXFA 1LDBA 1K9SA 2FZKA 1Y8QA 1JIUA 2P2GA 3BC1A 1QHHA 3B1WA 4URUR 4Z99A 4FFLA 3DVSX 4DVGA 2B82A 3ZR4B 2EX1A 5LFAA 1S2NA 1OSNA 1T9ZA 1KOJA 3PUIA 5J63A 3DPIA 3QCZA 5B1EA 3GLGE 4YJGA 2C03A 1BGVA 4WX2B 4DV6B 3V6MA 4GM4A 2ZAMA 5EESA 3ZY5A 4ERNA 3BKXA 4TV9F 3GLFE 4R7GA 2JLWA 4XDAA 1V3QE 3TMKA 1IWBB 1QIJA 2GPSA 3VR1A 4RDXA 5C32A 1M0SA 1RFVA 2BN4A 4RL4A 2Z6QA 3QHAA 1JQBA 3HKCB 4F1WA 4E33A 4EW6A 2JIRA 1UOPA 4H3SA 4QC2A 3TW6A 4D6XA 1SVLA 1K0FA 1IY0A 2FPRA 3QLVC 4WVLA 1G20A 3SFZA 4MJ7A 2OCDA 1N2SA 2L69A 4PCAA 5T5QA 4AYXA 4ED9A 1J90A 3JULA 5FPSA 4JP3A 3OQPA 2KM1A 2ANBA 4C7VA 1JX6A 3OU2A 2I9KA 3RO7A 2IHNA 2PH1A 1T4CA 4DLYA 4BB6A 1JLMA 2HSEA 2XCSB 3LC0A 2HDHA 3NCHA 4Z0NA 1M72A 3KKKA 1L3BA 1X9GA 1NQ5A 1YZLA 2RGXA 1DO0A 3AHIA 3PI7A 3VJLA 2OYSA 2GF0A 3ZHYA 1GA1A 6CHYA 5HFJA 4J1QA 3HXPA 2JHPA 2P2CA 3TDMA 1BU5A 3FOWA 3GYBA 4G89A 2P91A 4UMDA 2QD1A 1Y1TA 3UXMA 5JDIA 3VU0A 3EY9A 3LP6A 3QLUC 1LH0A 4RORA 4IIGA 4HB0A 1F2UB 3GW8A 5KQLA 4XPIA 1Z0SA 3KT8A 4KK3A 4PZUA 4Q1FA 5A7HA 3R3UA 3MQ2A 3UJ6A 4DE5A 1APBA 3L18A 1W581 1UPUA 3GQVA 1T9KA 4BNIA 1CUFA 1U4OA 2F7SA 2AD1A 2GZ1A 5EI5A 2XUQA 3UCEA 3GLUA 2WR8A 1E3EA 1ZGCA 3QMMA 3M1IA 2OHHA 1NG1A 1OX6A 4MUGA 1S3SA 4B84A 3ZNOA 4BMPB 1OH5A 2I76A 4MDFA 5AUOB 2AYXA 2JNWA 3VR6A 3LY9A 4L5CA 1E5QA 2W93A 4C3VA 4ZCQA 4PLYA 4UU7A 3K70C 4G1MB 3FTFA 1JG4A 4YLYA 1LHRA 4F56A 4K9QA 2CC2A 4HRVA 2D06A 4MRPA 4DCPA 4JXXA 3KV1A 1YKSA 1VFNA 3FCAA 1VLHA 4E5VA 4U0KA 5IKPA 5I48A 1QVWA 2FETA 1Z0KA 3DZKA 4W9NA 3L8DA 1JPUA 2WYIA 2JHFA 4HZUB 2XUPA 4OFBA 5TQVA 4ZVLA 2CLMB 4AQDA 4LXXA 1PS8A 2WFAA 1B8VA 1JU9A 3N0WA 4P58A 4PRZA 4YMIA 1WSWA 1IOWA 3FETA 2EFEB 2I3DA 5AK5A 4FJ0A 4AMGA 2AB8A 5IJ0B 4QU9A 2XDYA 5LCXA 3Q8LA 2FFBA 4U7JA 3V8RA 5KNDD 2FPLA 4F5YA 3QH4A 4AG5A 4N82A 2ZCVA 1V9CA 3MRTA 4YDSA 4CCWA 3ETCA 3IKLA 1WZUA 1K2VN 2XYVA 1TJ3A 5E4YA 5EJIA 1ML3A 3FOCA 1E1NA 2OV8A 3A1TA 3D1LA 5AOVA 1IN4A 3L46A 4LOJA 5AQ1A 2CUTA 2FRDA 3OQOA 2J31A 4H1VA 4BJHB 3R5XA 1UQTA 4YT5A 1SELA 1R4AA 1IAVA 1XEWX 4K9PA 1L7PA 1Z8FA 3BB4A 2XUHA 1W7AA 1AKMA 1KEPA 4RSHA 4DUGA 4NMLA 1HE5A 2Z5LA 3OPYI 3RIXA 3MWJA 2GC6A 3MUFA 2IZZA 1Z36A 1EJ0A 3L1JA 4IHJF 2CV1A 1AKWA 4LOKA 4BRUA 2PRZA 3OU7A 4ZAFA 3PUKA 4YCLA 2C99A 2RHGB 5A4FS 3CEHA 4H1HA 4PZPA 3PLRA 1PIWA 4OYRA 1HDZA 1V1JA 1M2KA 4M99A 1T8WA 2NU6B 4PIMA 4TXLA 5CVDA 4BNGA 3WRXC 5K3DA 1NDHA 4GRIA 3EYWA 2Q5FA 2J5XA 2X8JA 2IYVA 1OCEA 3RJ9A 5HPYB 1QOQB 1LV8A 5EZYF 2OOKA 4MVJH 2OESA 1KVUA 2GR9A 4YAEA 1TU4A 1POXA 1P2BA 4LMBA 4PO3X 1TM5E 3JARA 4OKSA 3KKNA 4IGEA 2GKGA 1NI4B 2Q4BA 2AOTA 2ZT6A 3GD5A 2MIIA 3KLOA 4ZEMA 2LNDA 3HE3A 1Z37A 5DIFA 1K8RA 1OLUB 5IASA 1Y63A 2Q3CA 1YD7A 5KDOA 1L8LA 3B7GA 3PHJA 5L4SA 1ZEMA 2MWMA 4ENWA 1J5XA 3GBSA 2A59A 2ZE8A 4S1PA 1KFJB 4PHGA 1U6JA 1SAYA 1RXYA 1C3VA 4LJ9A 4HMOA 5HR5A 5LXTB 3MCVA 4UTRA 1N1GA 1HE3A 2WUFA 5ES3A 3VC2A 1JIJA 3E3AA 5KHLB 4C05A 3ZDBA 2J9ZB 2PKRA 2B0CA 2IQIA 3GO6A 1WDTA 1DKQA 2ZUVA 5IC6A 4B8YA 4E5UA 5CB0A 4EKGA 1GTJ1 1NI5A 1LBIA 1IRIA 2DLNA 2R7AA 5AW9A 5JALA 4X64B 4KZKA 1U5BA 2JLAA 2OGUA 5EE0A 4KPEC 4H3VA 5ECWA 2GK7A 3AMVA 3DWIA 3N0VA 1NW9B 5PGMA 2C2YA 4LDRA 2PBLA 3RC7A 3ZWNA 1YDMA 2FX2A 8ATCA 5JD6A 2B69A 1GNLA 1CS4C 1E32A 1ZD3A 1JA9A 1E2GA 1JDPA 1NF2A 2NSYA 1Y98A 3PHCA 2ODWA 3S7TA 2WICA 5GIOE 1DX6A 2DC1A 4PTZA 1TAQA 5KYKA 3PYXA 4JYPA 3AP3A 4WWHA 4HWSA 1NW8A 1P73A 1PG0A 3D3JA 4GC5A 4KPUA 2V7VA 4OQMA 4P92A 5HOEA 3R1IA 2WABA 3FHOA 4X8LA 1KMQA 1TQ6A 4EMSA 3RC1A 4TLDA 2CXTA 1U7ZA 1SUEA 2CFOA 3G5AA 2A78A 1PTJA 4LE0A 4ZK2A 1AS0A 3ZD6A 1YU6A 5F51A 4EENA 2JFUA 1ZI9A 1KEVA 5DLPA 4NEQA 1N2CA 1ZOLA 1KAMA 2ZIZA 1OBFO 2G0TA 3O47A 3TN7A 4XIYA 2JDIA 2XNKA 4KIJA 4XDHA 1XWWA 9ABPA 1V41E 4CLXA 4P9NA 3SC4A 2P1ZA 2ZI5A 3HKDA 3U4HA 1DHTA 2BPOA 3FUCA 1ZRMA 4GYKA 4DCTA 5A4IS 1V16B 4P7BA 4X8OA 5IEBA 1YB1A 1Z7WA 3SX2A 3VDRA 3HCBA 4N3BA 5JAPA 3C6XA 1XD9A 4KDFA 3GLIA 2HIMA 1VJ5A 3B6EA 2VT2A 3FVTA 1UOOA 1OJLA 2TMGA 4DDHA 2VHYA 3WHKA 1EFRA 1KTVA 1XXHA 2G9NA 3CS3A 3LUGA 4E13A 4OI1A 4K28A 4CTOA 4IO0A 1TYEB 3U9SA 1BFUA 4BATA 3KYDB 1ZN2A 3C7TA 3NATA 5BNZA 3IRUA 3TF5A 4E21A 3FOEC 3Q0EA 3VGPA 5CX4A 2ZRPA 2ZPUA 3EFOB 2ERCA 4NK4A 4RE5A 1SIUA 2BZGA 3CVYA 1UA4A 4L4UA 2J32A 4U7XA 3U7GA 1LI7A 1D6JA 4N3NA 3LBAA 4L5IA 4L8VA 4RMGA 4IV8A 1PWZA 2XCUA 4OLAA 4FDLA 1VBMA 4IH1A 1E98A 1A9TA 5EHNA 5JZBA 2JGDB 4HNQA 1YCHA 2BFNA 1TT5A 1EGMB 4UQOA 3CPJB 4G85A 4XCVA 1H2XA 1YVDA 2FEPA 2RHJA 4QJ5A 3RBXA 3RHTA 3E5NA 3STUA 3QUBA 3DOEA 1Y3FE 4J29A 5AKGA 8AT1A 5F33A 1P0IA 5IKEA 3WA6A 4GXTA 5LZ4A 2X9VA 3KPUA 3KQWA 4PZLA 1KJZA 3R6WA 1XLTC 1XQWA 4KLNA 4WKOA 3UYLA 3T9CA 5IT0A 3L1UA 3SOPA 4DAOA 1Z88A 4EF4A 1IHOA 1WABA 3BQMB 1LBTA 3RROA 3SYTA 4Q4CA 4YDQA 2AJPA 1O57A 2VARA 3E7PA 1NNSA 1Z18A 4YJKA 2UUAB 4LKRA 4N8DA 1H65A 2V4UA 3K1YA 5FPKA 2BGWA 3DAYA 2RC6A 5AESA 2R7NA 2O8VA 1UFQA 3VTZA 2VJMB 4C20A 2VATA 1T5IA 1NUSA 2IF2A 4IYJA 4TLCA 4HT3B 4B32A 1G38A 1RCUA 1KL7A 4ZOQI 4OJYA 1YRBA 4MITA 5SY4A 3ZKWB 3NXSA 2KX7A 1U9JA 2WYVA 1E2QA 1FTQA 3AIKA 5HXAA 3JQ7B 2NQ2C 2XRMA 2Y0DA 4TX1A 1NVGA 3LUCA 3T15A 1WVGA 2FWAA 4EBUA 1SCIA 4U2FA 4EY8A 2GN0A 1HQYE 3I6BA 4M88A 5ALUA 1M6EX 3OTQA 2QTGA 2WF8A 2FQ1A 1ZK0A 3IEVA 3GFRA 1X2EA 3GMDA 4A92A 3MLEA 5LXTF 2PIAA 4JJ7A 2V7XA 4QUIA 2IU0A 2F3TA 5EIBC 3KE8A 1FLNA 5JI2E 2JAQA 1CY2A 2EYQA 1Y4AE 3IMEA 1QH8B 5E1DA 4LYDA 2UZ1B 2VPQA 1HA3A 2HZ7A 2JCVA 2BKLA 2KBEA 3BULA 4UUNA 2Z2JA 1F9AA 2AI2A 2LIVA 1KFCB 3ABQB 2RGWA 1YO6A 1QH1B 2BHTA 2CSUA 4F97A 4B8ZA 3IL2A 1TC2A 3OJWA 4FYJA 4IXNA 1QIMA 3I73A 2NZXA 4YMVA 2ODTX 3TB4A 4TS4A 4EY7A 4OLBA 2Q4EA 2IYOA 5BWLA 2WF9A 4ILKA 1JFTA 3JW8A 4CIVA 1B0AA 4HJRA 3SF8B 1JHYA 3W90A 2WYWA 1IY1A 1KK0A 2TMKA 5C5DA 1FS6A 4RTNA 4K6KA 3NUGA 3PDWA 4YV2A 4LHZA 3B3LA 3NWOA 2RHTA 1PKEA 2XZTA 3GV0A 2FMIA 3F5DA 1GU7A 3NBXX 2ZRLA 1TZKA 4MS4A 1ZR2A 2H8KA 3E0QA 3KVRA 4MRVA 2ZTUA 1QU2A 3VU9A 1ZLYA 3L8ZA 4HL6A 2P9CA 3TD2A 8ADHA 1YB6A 1MO6A 2DKNA 4PYIA 1QWOA 2H4JA 4UUAA 1K1EA 3QU4A 4AG3A 3U7QA 2KSQA 3VTKA 1V48A 4H7DA 2I1LA 4I50B 4LK3A 3OLZA 3PSHA 2ZR0A 1Z7BA 2JJ1D 3UAVA 3WIVA 1NVVQ 3E1GA 4Y6SA 3ZX5A 4PRKA 3E9YA 4BVAA 5ELXA 3V4SA 4MTLA 3H5VA 1E3MA 1U7WA 1K06A 4HNHA 1JHRA 1QXSA 3A9RA 4EVQA 1ZH0A 2J6IA 2C4TA 2QAJA 5KNDH 1S8FA 3H4MA 3DZFA 3KJIA 3U3OA 1EUCA 3MJCA 3BFXA 1W76A 4RVHA 4MHSA 3HQ4O 5CMLA 5I45A 1UR5A 3YASA 1U2GC 4D2IA 1ECPA 1LLCA 1SQFA 5ITZB 2DETA 3NS7A 5CXSA 5HIMA 1UMBB 1BVRA 2ATXA 2YJTD 3CUKA 1DDIA 1OC2A 2GN8A 2SBTA 3BJMA 3KHSA 4B3XA 5KYYB 3MCWA 4YI3A 1J2EA 3K6SB 1WF3A 3O9ZA 4U7PB 3WYNA 2L19A 3UT5B 3D5TA 4BMSA 3AKEA 4REQB 4X3OA 2D5BA 1C0KA 1C3JA 2ODBA 4I3HA 1HDIA 5D5HA 3IP8A 1E8MA 4P2GA 3RTGA 2OV2A 3EC7A 4ZQHA 1I2MA 1A9YA 2C9YA 4OPMA 4ZVUA 3BXGA 1OJ7A 5IUNC 5KQMA 4HXEB 3CB2A 3OP4A 3VOSA 1VIYA 4R8SA 1V1MA 3MBKA 3PL2A 2ZXEA 3CF0A 1FU7A 4D9HA 4CMIA 1Z38A 2C57A 3PWTA 2P9BA 5KINB 3UH1A 4PBTA 4B3SB 3NBVA 3QE9Y 2I6GA 2YY6A 1USWA 5GM1A 3WL7A 1XQXA 2H4XA 1ATZA 1YA4A 4R1QA 4D4JA 2ZT5A 1E3WB 1NQOA 1X86B 1R50A 3QA2A 3OEHA 3THWA 2JF0A 1RXUA 1UXKA 3I9JA 2YDYA 3Q6MA 3CO0S 1R9NA 3QOXA 4N6OA 3RRFA 1NJ5A 2NO9A 1XD2B 3N2IA 1OX5A 1VLMA 3RRYA 3ZD8A 2OXRA 1B6SA 1VXOA 2XLBA 1P0QA 2ZSDA 4G9EA 2IS1A 3K6KA 3PX3A 4AP9A 1CF4A 4B80A 4QHTA 4CDMA 5HF8A 4EWLA 4FYIA 1Q3TA 1E7WA 2WP8J 1YRQA 5ITSA 1C7QA 2XITA 3H4VA 2JGNA 3C97A 3OHSX 4BVBA 3L5KA 4KU4A 1F60A 5FBQB 2YJ6A 2FZLA 3DAPA 3TSAA 4U7DA 3KQKA 2VBGA 1E6LA 1LSJA 1FOEB 2AJBA 3R9KA 1DELA 3F5QA 2QRQA 1JR3E 2Q49A 5FI5A 4AULA 1KAEA 3C3EA 3CGGA 2H57A 3WWPA 4C4AA 2A9YA 1G8YA 1YFLA 4HH3C 3LC2O 4P84A 4KWCA 3LTNC 1V1BA 1V47A 1WKCA 5AI4A 2YMLA 3NTRA 3IDSA 3RAPR 3EXG1 5IVKA 1UJCA 2O0MA 1L4HA 2J07A 2NV2B 3WRYC 1DLJA 3INTA 4EKEA 1OB2A 5BYKA 2Y1EA 3C98A 4V0RA 4IIBA 2B4YA