3HYOA

Crystal structure of pyridoxal kinase from lactobacillus plantarum in complex with adp
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
273
structure length
273
Chain Sequence
LSTMLVAEDLSAVGGISLSSALPVLTAMQYDVAALPTSLLSTHTSGYGTPAVVDLSTWLPQVFAHWTRAQLHFDQALIGYVGSVALCQQITTYLEQQTLSLLVVDPVLGDLGQLYQGFDQDYVAAMRQLIQQADVILPNTTEAALLTGAPYQVTPDLEVILPALQAQLKTGAHAVITDVQRADQIGCAWLDEAGHVQYCGARRLPGHYNGTGDTLAAVIAGLLGRGYPLAPTLARANQWLNMAVAETIAQNRTDDRQGVALGDLLQAILALNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of pyridoxal kinase from Lactobacillus plantarum in complex with ADP
rcsb
source organism Lactobacillus plantarum
molecule tags Transferase
molecule keywords Pyridoxal kinase
total genus 82
structure length 273
sequence length 273
ec nomenclature ec 2.7.1.35: Pyridoxal kinase.
pdb deposition date 2009-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08543 Phos_pyr_kin Phosphomethylpyrimidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3hyoA00
1LHRA 3UMOA 4S1HA 3IKHA 1RK2A 4KBEA 5EY7A 4B8SA 2AX3A 2I5BA 1KYHA 2YXTA 4UBEA 3RTGA 2C49A 3RRJA 4JKSA 1C3QA 2AJRA 4XCKA 5COJA 2AJPA 2DDWA 1VI9A 3MBJA 3GO6A 2A9ZA 4KADA 1UB0A 4S1IA 3LHXA 3UQ6A 3RQQA 1V19A 2I6AA 3RRFA 4E8YA 4K8CA 3ZS7A 2JG5A 1YGKA 4PVVA 4B8RA 2JG1A 1LIIA 3FHXA 3I3YA 4JJPA 2ABQA 3RRBA 3KTNA 5C3YA 2DCNA 5C41A 1YHJA 3B1PA 2NWHA 2PKNA 1WYEA 2A9YA 3KEUA 3NL2A 3RU3A 4DU5A 4LC4A 2HQQA 3N1CA 3NL3A 4K9CA 3NL6A 1LHPA 4E8WA 4E69A 3IN1A 3CQDA 3B1RA 1V1BA 2PKMA 3QA2A 5B6AA 3UQDA 2PKFA 3NC2A 3B3LA 3PL2A 4GM6A 2HLZA 2V78A 1RKSA 3RQXA 3Q1YA 1ESQA 1BX4A 3NC9A 3Q92A 3RY7A 3FHYA 3UMPA 3RSGA 3JULA 4K8PA 3B1OA 3RTDA 2AA0A 3PZSA 4KAHA 4E3AA 1RFTA 3GO7A 3LOOA 3RQHA 1RFVA 4C5LA 4K8KA 3NCAA 4O1GA 5CGEA 3H49A 3K9EA 1RKDA 1LIKA 4YWRA 3RTAA 2XTBA 4KANA 1VM7A 4K9IA 3H74A 3RU2A 2YXUA 3UBOA 2Q5RA 1RFUA 1LIJA 1JXHA 3NL5A 2JGVA 2DDOA 3UQEA 3KD6A 1U2XA 1YGJA 2I6BA 2AWDA 2R3BA 5CM5A 4S1MA 3VASA 3RSSA 3HPDA 4K8TA 5BYFA 5BYDA 3NM1A 1TZ3A 3QAIA 3EWMA 4N08A 4LCAA 3IBQA 1ESJA 4KALA 4O1LA 3RQ8A 2RBCA 3IH0A 4LBXA 3RO4A 5F11A 5TRWA 2HW1A 4K93A 4N09A 2ABSA 3W4SA 2F7KA 3RT7A 2F02A 3DRWA 1JXIA 3VAQA 3RQ6A 2DDMA 3RS9A 4WJMA 3UQ9A 3RPZA 3HYOA 4C5NA 2PKKA 3BGKA 1EKKA 1LIOA 3RSFA 3B1NA 4YL5A 3LKIA 3BF5A 2R3EA 4EOHA 4LBGA 4EBUA 3RQ5A 4X8FA 5EYNA 4XDAA 4XF7A 3RPHA 3IQ0A 4C5KA 3RREA 5C40A 4S1IB 3OTXA 3RTCA 4E8ZA 5BYEA 3HICA 2VARA 3RT9A 4DC3A 2AB8A 3RM5A 3RSQA 5F0ZA 1VK4A 1DGMA 2FV7A 5TQIA 4EN4A 1TYYA 3RQ2A 2QCVA 5C3ZA 2QHPA 4EUMA 3LJSA 3NBVA 4C5MA 1EKQA 3DZVA 1GQTA 3B1QA 1L2LA 3RTEA 1RKAA 3K5WA 3MBHA 3KZHA 1GC5A 1TZ6A 4C5JA 3RTBA 5CGAA 4U7XA 1V1AA 2C4EA 4JKUA 3NM3A 4XF6A 1UA4A 3IE7A 5BYCA 3RS8A 4E84A 3NBWA 1V1SA 2AFBA 3GBUA 1TD2A
chains in the Genus database with same CATH superfamily
1LHRA 3HJ6A 4ZIYA 3UMOA 4S1HA 3IKHA 1RK2A 4KBEA 5EY7A 4B8SA 2AX3A 2I5BA 1KYHA 2YXTA 4UBEA 3RTGA 2C49A 4C13A 3RRJA 4JKSA 1C3QA 2AJRA 4XCKA 5COJA 2AJPA 2DDWA 1VI9A 3MBJA 3GO6A 3N2AA 1UAGA 2A9ZA 2UUOA 3QCZA 4KADA 1UB0A 4S1IA 3LHXA 3UQ6A 3RQQA 1V19A 2I6AA 3HN7A 3RRFA 1P3DA 1W78A 1E0DA 4K8CA 3ZS7A 2JG5A 4CVMA 4E8YA 1YGKA 4PVVA 1GQQA 4B8RA 2JG1A 3EAGA 1LIIA 3FHXA 3RQ8A 3I3YA 3UAGA 4JJPA 2ABQA 2AM2A 3KTNA 3RRBA 2DCNA 5C3YA 5C41A 1YHJA 3B1PA 4BUBA 2NWHA 2PKNA 1WYEA 2A9YA 3KEUA 3NL2A 3RU3A 4CVLA 4LC4A 4DU5A 2HQQA 2X5OA 2WTZA 3N1CA 3NL3A 4K9CA 3NL6A 1LHPA 4E8WA 4E69A 3IN1A 3CQDA 3B1RA 1V1BA 1JBVA 2PKMA 3QA2A 5B6AA 3UQDA 2PKFA 3NC2A 3B3LA 3PL2A 4GM6A 2HLZA 2V78A 4C12A 1RKSA 3RQXA 3Q1YA 4CVKA 1ESQA 1FGSA 2GCAA 1BX4A 3NC9A 3Q92A 3RY7A 3FHYA 3UMPA 2VOSA 3NBWA 3JULA 2JFFA 3B1OA 4K8PA 4UAGA 3RSGA 3RTDA 2AA0A 2XPCA 3PZSA 4KAHA 3ZM5A 4E3AA 1RFTA 3GO7A 3LOOA 1W7KA 1EEHA 3RQHA 1GQYA 1RFVA 4C5LA 4K8KA 3NCAA 3ZL8A 4O1GA 5CGEA 3H49A 3K9EA 1RKDA 1O5ZA 2F00A 1LIKA 4YWRA 1JBWA 2UAGA 3RTAA 2XTBA 4KANA 1VM7A 4K9IA 3H74A 3RU2A 2YXUA 3UBOA 2Q5RA 4BUCA 1RFUA 2VTDA 1LIJA 2WJPA 1JXHA 2Y68A 3NL5A 2JGVA 2DDOA 3UQEA 3KD6A 1U2XA 1YGJA 2I6BA 2AWDA 2R3BA 5CM5A 3ZM6A 2JFGA 2Y1OA 4S1MA 3HPDA 4K8TA 3RSSA 3VASA 3NM1A 1TZ3A 3QAIA 3EWMA 4N08A 5BYFA 5BYDA 5F11A 4LCAA 3IBQA 1ESJA 4KALA 2VTEA 4O1LA 2GC6A 2RBCA 3IH0A 3NRSA 4LBXA 3RO4A 5TRWA 2HW1A 4K93A 2UUPA 2ABSA 4N09A 3W4SA 2F7KA 2XJAA 3RT7A 2AM1A 1GG4A 2F02A 3DRWA 1J6UA 1JXIA 2GCBA 2DDMA 3RQ6A 3VAQA 3RS9A 4WJMA 3UQ9A 3RPZA 3HYOA 4C5NA 2PKKA 3BGKA 1EKKA 1LIOA 3RSFA 3B1NA 4YL5A 5A5FA 3LKIA 3BF5A 2R3EA 4EOHA 4LBGA 2VORA 4HV4A 4EBUA 3RQ5A 4X8FA 5EYNA 4XDAA 4XF7A 3RPHA 2JFHA 3IQ0A 4C5KA 3RREA 5C40A 4S1IB 3OTXA 3RTCA 4E8ZA 3PYZA 5BYEA 3HICA 2VARA 3RT9A 4DC3A 2AB8A 3RM5A 3RSQA 5F0ZA 1VK4A 1DGMA 2FV7A 2Y66A 4QF5A 5TQIA 4EN4A 1TYYA 3RQ2A 5A5EA 2QCVA 5C3ZA 2QHPA 2Y67A 3LJSA 3NBVA 4EUMA 4QDIA 4C5MA 1EKQA 3DZVA 1GQTA 3LK7A 3B1QA 1P31A 1L2LA 3RTEA 1RKAA 3K5WA 3MBHA 3KZHA 1GC5A 1TZ6A 4C5JA 1E8CA 3RTBA 5CGAA 4U7XA 1V1AA 2C4EA 4JKUA 3NM3A 4XF6A 1UA4A 3IE7A 5BYCA 3RS8A 4E84A 2GC5A 1V1SA 2AFBA 3GBUA 1TD2A
chains in the Genus database with same CATH topology
1LHRA 3HJ6A 3UMOA 4S1HA 3IKHA 1RK2A 4KBEA 5EY7A 4B8SA 2AX3A 2I5BA 1KYHA 2YXTA 4UBEA 3RTGA 2C49A 3RRJA 4JKSA 1C3QA 2AJRA 4XCKA 5COJA 2AJPA 2DDWA 1VI9A 3MBJA 3GO6A 2A9ZA 4KADA 1UB0A 4S1IA 3LHXA 3UQ6A 3RQQA 1V19A 2I6AA 3RRFA 4E8YA 4K8CA 3ZS7A 2JG5A 1YGKA 4PVVA 4B8RA 2JG1A 1LIIA 3FHXA 3I3YA 4JJPA 2ABQA 3RRBA 3KTNA 5C3YA 2DCNA 5C41A 1YHJA 3B1PA 2NWHA 2PKNA 1WYEA 2A9YA 3KEUA 3NL2A 3RU3A 4DU5A 4LC4A 2HQQA 3N1CA 3NL3A 4K9CA 3NL6A 1LHPA 4E8WA 4E69A 3IN1A 3CQDA 3B1RA 1V1BA 2PKMA 3QA2A 5B6AA 3UQDA 2PKFA 3NC2A 3B3LA 3PL2A 4GM6A 2HLZA 2V78A 1RKSA 3RQXA 3Q1YA 1ESQA 1BX4A 3NC9A 3Q92A 3RY7A 3FHYA 3UMPA 3RSGA 3JULA 4K8PA 3B1OA 3RTDA 2AA0A 3PZSA 4KAHA 4E3AA 1RFTA 3GO7A 3LOOA 3RQHA 1RFVA 4C5LA 4K8KA 3NCAA 4O1GA 5CGEA 3H49A 3K9EA 1RKDA 1LIKA 4YWRA 3RTAA 2XTBA 4KANA 1VM7A 4K9IA 3H74A 3RU2A 2YXUA 3UBOA 2Q5RA 1RFUA 1LIJA 1JXHA 3NL5A 2JGVA 2DDOA 3UQEA 3KD6A 1U2XA 1YGJA 2I6BA 2AWDA 2R3BA 5CM5A 4S1MA 3VASA 3RSSA 3HPDA 4K8TA 5BYFA 5BYDA 3NM1A 1TZ3A 3QAIA 3EWMA 4N08A 4LCAA 3IBQA 1ESJA 4KALA 4O1LA 3RQ8A 2RBCA 3IH0A 4LBXA 3RO4A 5F11A 5TRWA 2HW1A 4K93A 4N09A 2ABSA 3W4SA 2F7KA 3RT7A 2F02A 3DRWA 1JXIA 3VAQA 3RQ6A 2DDMA 3RS9A 4WJMA 3UQ9A 3RPZA 3HYOA 4C5NA 2PKKA 3BGKA 1EKKA 1LIOA 3RSFA 3B1NA 4YL5A 3LKIA 3BF5A 2R3EA 4EOHA 4LBGA 4EBUA 3RQ5A 4X8FA 5EYNA 4XDAA 4XF7A 3RPHA 3IQ0A 4C5KA 3RREA 5C40A 4S1IB 3OTXA 3RTCA 4E8ZA 5BYEA 3HICA 2VARA 3RT9A 4DC3A 2AB8A 3RM5A 3RSQA 5F0ZA 1VK4A 1DGMA 2FV7A 5TQIA 4EN4A 1TYYA 3RQ2A 2QCVA 5C3ZA 2QHPA 4EUMA 3LJSA 3NBVA 4C5MA 1EKQA 3DZVA 1GQTA 3B1QA 1L2LA 3RTEA 1RKAA 3K5WA 3MBHA 3KZHA 1GC5A 1TZ6A 4C5JA 3RTBA 5CGAA 4U7XA 1V1AA 2C4EA 4JKUA 3NM3A 4XF6A 1UA4A 3IE7A 5BYCA 3RS8A 4E84A 3NBWA 1V1SA 2AFBA 3GBUA 1TD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LHR A;  3UMO A;  4S1H A;  3IKH A;  1RK2 A;  4KBE A;  5EY7 A;  4B8S A;  2AX3 A;  2I5B A;  1KYH A;  2YXT A;  4UBE A;  3RTG A;  2C49 A;  3RRJ A;  4JKS A;  1C3Q A;  2AJR A;  4XCK A;  5COJ A;  2AJP A;  2DDW A;  1VI9 A;  3MBJ A;  3GO6 A;  2A9Z A;  4KAD A;  1UB0 A;  4S1I A;  3LHX A;  3UQ6 A;  3RQQ A;  1V19 A;  2I6A A;  3RRF A;  4E8Y A;  4K8C A;  3ZS7 A;  2JG5 A;  1YGK A;  4PVV A;  4B8R A;  2JG1 A;  1LII A;  3FHX A;  3I3Y A;  4JJP A;  2ABQ A;  3RRB A;  3KTN A;  5C3Y A;  2DCN A;  5C41 A;  1YHJ A;  3B1P A;  2NWH A;  2PKN A;  1WYE A;  2A9Y A;  3KEU A;  3NL2 A;  3RU3 A;  4DU5 A;  4LC4 A;  2HQQ A;  3N1C A;  3NL3 A;  4K9C A;  3NL6 A;  1LHP A;  4E8W A;  4E69 A;  3IN1 A;  3CQD A;  3B1R A;  1V1B A;  2PKM A;  3QA2 A;  5B6A A;  3UQD A;  2PKF A;  3NC2 A;  3B3L A;  3PL2 A;  4GM6 A;  2HLZ A;  2V78 A;  1RKS A;  3RQX A;  3Q1Y A;  1ESQ A;  1BX4 A;  3NC9 A;  3Q92 A;  3RY7 A;  3FHY A;  3UMP A;  3RSG A;  3JUL A;  4K8P A;  3B1O A;  3RTD A;  2AA0 A;  3PZS A;  4KAH A;  4E3A A;  1RFT A;  3GO7 A;  3LOO A;  3RQH A;  1RFV A;  4C5L A;  4K8K A;  3NCA A;  4O1G A;  5CGE A;  3H49 A;  3K9E A;  1RKD A;  1LIK A;  4YWR A;  3RTA A;  2XTB A;  4KAN A;  1VM7 A;  4K9I A;  3H74 A;  3RU2 A;  2YXU A;  3UBO A;  2Q5R A;  1RFU A;  1LIJ A;  1JXH A;  3NL5 A;  2JGV A;  2DDO A;  3UQE A;  3KD6 A;  1U2X A;  1YGJ A;  2I6B A;  2AWD A;  2R3B A;  5CM5 A;  4S1M A;  3VAS A;  3RSS A;  3HPD A;  4K8T A;  5BYF A;  5BYD A;  3NM1 A;  1TZ3 A;  3QAI A;  3EWM A;  4N08 A;  4LCA A;  3IBQ A;  1ESJ A;  4KAL A;  4O1L A;  3RQ8 A;  2RBC A;  3IH0 A;  4LBX A;  3RO4 A;  5F11 A;  5TRW A;  2HW1 A;  4K93 A;  4N09 A;  2ABS A;  3W4S A;  2F7K A;  3RT7 A;  2F02 A;  3DRW A;  1JXI A;  3VAQ A;  3RQ6 A;  2DDM A;  3RS9 A;  4WJM A;  3UQ9 A;  3RPZ A;  3HYO A;  4C5N A;  2PKK A;  3BGK A;  1EKK A;  1LIO A;  3RSF A;  3B1N A;  4YL5 A;  3LKI A;  3BF5 A;  2R3E A;  4EOH A;  4LBG A;  4EBU A;  3RQ5 A;  4X8F A;  5EYN A;  4XDA A;  4XF7 A;  3RPH A;  3IQ0 A;  4C5K A;  3RRE A;  5C40 A;  4S1I B;  3OTX A;  3RTC A;  4E8Z A;  5BYE A;  3HIC A;  2VAR A;  3RT9 A;  4DC3 A;  2AB8 A;  3RM5 A;  3RSQ A;  5F0Z A;  1VK4 A;  1DGM A;  2FV7 A;  5TQI A;  4EN4 A;  1TYY A;  3RQ2 A;  2QCV A;  5C3Z A;  2QHP A;  4EUM A;  3LJS A;  3NBV A;  4C5M A;  1EKQ A;  3DZV A;  1GQT A;  3B1Q A;  1L2L A;  3RTE A;  1RKA A;  3K5W A;  3MBH A;  3KZH A;  1GC5 A;  1TZ6 A;  4C5J A;  3RTB A;  5CGA A;  4U7X A;  1V1A A;  2C4E A;  4JKU A;  3NM3 A;  4XF6 A;  1UA4 A;  3IE7 A;  5BYC A;  3RS8 A;  4E84 A;  3NBW A;  1V1S A;  2AFB A;  3GBU A;  1TD2 A; 
#chains in the Genus database with same CATH topology
 1LHR A;  3HJ6 A;  4ZIY A;  3UMO A;  4S1H A;  3IKH A;  1RK2 A;  4KBE A;  5EY7 A;  4B8S A;  2AX3 A;  2I5B A;  1KYH A;  2YXT A;  4UBE A;  3RTG A;  2C49 A;  4C13 A;  3RRJ A;  4JKS A;  1C3Q A;  2AJR A;  4XCK A;  5COJ A;  2AJP A;  2DDW A;  1VI9 A;  3MBJ A;  3GO6 A;  3N2A A;  1UAG A;  2A9Z A;  2UUO A;  3QCZ A;  4KAD A;  1UB0 A;  4S1I A;  3LHX A;  3UQ6 A;  3RQQ A;  1V19 A;  2I6A A;  3HN7 A;  3RRF A;  1P3D A;  1W78 A;  1E0D A;  4K8C A;  3ZS7 A;  2JG5 A;  4CVM A;  4E8Y A;  1YGK A;  4PVV A;  1GQQ A;  4B8R A;  2JG1 A;  3EAG A;  1LII A;  3FHX A;  3RQ8 A;  3I3Y A;  3UAG A;  4JJP A;  2ABQ A;  2AM2 A;  3KTN A;  3RRB A;  2DCN A;  5C3Y A;  5C41 A;  1YHJ A;  3B1P A;  4BUB A;  2NWH A;  2PKN A;  1WYE A;  2A9Y A;  3KEU A;  3NL2 A;  3RU3 A;  4CVL A;  4LC4 A;  4DU5 A;  2HQQ A;  2X5O A;  2WTZ A;  3N1C A;  3NL3 A;  4K9C A;  3NL6 A;  1LHP A;  4E8W A;  4E69 A;  3IN1 A;  3CQD A;  3B1R A;  1V1B A;  1JBV A;  2PKM A;  3QA2 A;  5B6A A;  3UQD A;  2PKF A;  3NC2 A;  3B3L A;  3PL2 A;  4GM6 A;  2HLZ A;  2V78 A;  4C12 A;  1RKS A;  3RQX A;  3Q1Y A;  4CVK A;  1ESQ A;  1FGS A;  2GCA A;  1BX4 A;  3NC9 A;  3Q92 A;  3RY7 A;  3FHY A;  3UMP A;  2VOS A;  3NBW A;  3JUL A;  2JFF A;  3B1O A;  4K8P A;  4UAG A;  3RSG A;  3RTD A;  2AA0 A;  2XPC A;  3PZS A;  4KAH A;  3ZM5 A;  4E3A A;  1RFT A;  3GO7 A;  3LOO A;  1W7K A;  1EEH A;  3RQH A;  1GQY A;  1RFV A;  4C5L A;  4K8K A;  3NCA A;  3ZL8 A;  4O1G A;  5CGE A;  3H49 A;  3K9E A;  1RKD A;  1O5Z A;  2F00 A;  1LIK A;  4YWR A;  1JBW A;  2UAG A;  3RTA A;  2XTB A;  4KAN A;  1VM7 A;  4K9I A;  3H74 A;  3RU2 A;  2YXU A;  3UBO A;  2Q5R A;  4BUC A;  1RFU A;  2VTD A;  1LIJ A;  2WJP A;  1JXH A;  2Y68 A;  3NL5 A;  2JGV A;  2DDO A;  3UQE A;  3KD6 A;  1U2X A;  1YGJ A;  2I6B A;  2AWD A;  2R3B A;  5CM5 A;  3ZM6 A;  2JFG A;  2Y1O A;  4S1M A;  3HPD A;  4K8T A;  3RSS A;  3VAS A;  3NM1 A;  1TZ3 A;  3QAI A;  3EWM A;  4N08 A;  5BYF A;  5BYD A;  5F11 A;  4LCA A;  3IBQ A;  1ESJ A;  4KAL A;  2VTE A;  4O1L A;  2GC6 A;  2RBC A;  3IH0 A;  3NRS A;  4LBX A;  3RO4 A;  5TRW A;  2HW1 A;  4K93 A;  2UUP A;  2ABS A;  4N09 A;  3W4S A;  2F7K A;  2XJA A;  3RT7 A;  2AM1 A;  1GG4 A;  2F02 A;  3DRW A;  1J6U A;  1JXI A;  2GCB A;  2DDM A;  3RQ6 A;  3VAQ A;  3RS9 A;  4WJM A;  3UQ9 A;  3RPZ A;  3HYO A;  4C5N A;  2PKK A;  3BGK A;  1EKK A;  1LIO A;  3RSF A;  3B1N A;  4YL5 A;  5A5F A;  3LKI A;  3BF5 A;  2R3E A;  4EOH A;  4LBG A;  2VOR A;  4HV4 A;  4EBU A;  3RQ5 A;  4X8F A;  5EYN A;  4XDA A;  4XF7 A;  3RPH A;  2JFH A;  3IQ0 A;  4C5K A;  3RRE A;  5C40 A;  4S1I B;  3OTX A;  3RTC A;  4E8Z A;  3PYZ A;  5BYE A;  3HIC A;  2VAR A;  3RT9 A;  4DC3 A;  2AB8 A;  3RM5 A;  3RSQ A;  5F0Z A;  1VK4 A;  1DGM A;  2FV7 A;  2Y66 A;  4QF5 A;  5TQI A;  4EN4 A;  1TYY A;  3RQ2 A;  5A5E A;  2QCV A;  5C3Z A;  2QHP A;  2Y67 A;  3LJS A;  3NBV A;  4EUM A;  4QDI A;  4C5M A;  1EKQ A;  3DZV A;  1GQT A;  3LK7 A;  3B1Q A;  1P31 A;  1L2L A;  3RTE A;  1RKA A;  3K5W A;  3MBH A;  3KZH A;  1GC5 A;  1TZ6 A;  4C5J A;  1E8C A;  3RTB A;  5CGA A;  4U7X A;  1V1A A;  2C4E A;  4JKU A;  3NM3 A;  4XF6 A;  1UA4 A;  3IE7 A;  5BYC A;  3RS8 A;  4E84 A;  2GC5 A;  1V1S A;  2AFB A;  3GBU A;  1TD2 A; 
#chains in the Genus database with same CATH homology
 1LHR A;  3HJ6 A;  3UMO A;  4S1H A;  3IKH A;  1RK2 A;  4KBE A;  5EY7 A;  4B8S A;  2AX3 A;  2I5B A;  1KYH A;  2YXT A;  4UBE A;  3RTG A;  2C49 A;  3RRJ A;  4JKS A;  1C3Q A;  2AJR A;  4XCK A;  5COJ A;  2AJP A;  2DDW A;  1VI9 A;  3MBJ A;  3GO6 A;  2A9Z A;  4KAD A;  1UB0 A;  4S1I A;  3LHX A;  3UQ6 A;  3RQQ A;  1V19 A;  2I6A A;  3RRF A;  4E8Y A;  4K8C A;  3ZS7 A;  2JG5 A;  1YGK A;  4PVV A;  4B8R A;  2JG1 A;  1LII A;  3FHX A;  3I3Y A;  4JJP A;  2ABQ A;  3RRB A;  3KTN A;  5C3Y A;  2DCN A;  5C41 A;  1YHJ A;  3B1P A;  2NWH A;  2PKN A;  1WYE A;  2A9Y A;  3KEU A;  3NL2 A;  3RU3 A;  4DU5 A;  4LC4 A;  2HQQ A;  3N1C A;  3NL3 A;  4K9C A;  3NL6 A;  1LHP A;  4E8W A;  4E69 A;  3IN1 A;  3CQD A;  3B1R A;  1V1B A;  2PKM A;  3QA2 A;  5B6A A;  3UQD A;  2PKF A;  3NC2 A;  3B3L A;  3PL2 A;  4GM6 A;  2HLZ A;  2V78 A;  1RKS A;  3RQX A;  3Q1Y A;  1ESQ A;  1BX4 A;  3NC9 A;  3Q92 A;  3RY7 A;  3FHY A;  3UMP A;  3RSG A;  3JUL A;  4K8P A;  3B1O A;  3RTD A;  2AA0 A;  3PZS A;  4KAH A;  4E3A A;  1RFT A;  3GO7 A;  3LOO A;  3RQH A;  1RFV A;  4C5L A;  4K8K A;  3NCA A;  4O1G A;  5CGE A;  3H49 A;  3K9E A;  1RKD A;  1LIK A;  4YWR A;  3RTA A;  2XTB A;  4KAN A;  1VM7 A;  4K9I A;  3H74 A;  3RU2 A;  2YXU A;  3UBO A;  2Q5R A;  1RFU A;  1LIJ A;  1JXH A;  3NL5 A;  2JGV A;  2DDO A;  3UQE A;  3KD6 A;  1U2X A;  1YGJ A;  2I6B A;  2AWD A;  2R3B A;  5CM5 A;  4S1M A;  3VAS A;  3RSS A;  3HPD A;  4K8T A;  5BYF A;  5BYD A;  3NM1 A;  1TZ3 A;  3QAI A;  3EWM A;  4N08 A;  4LCA A;  3IBQ A;  1ESJ A;  4KAL A;  4O1L A;  3RQ8 A;  2RBC A;  3IH0 A;  4LBX A;  3RO4 A;  5F11 A;  5TRW A;  2HW1 A;  4K93 A;  4N09 A;  2ABS A;  3W4S A;  2F7K A;  3RT7 A;  2F02 A;  3DRW A;  1JXI A;  3VAQ A;  3RQ6 A;  2DDM A;  3RS9 A;  4WJM A;  3UQ9 A;  3RPZ A;  3HYO A;  4C5N A;  2PKK A;  3BGK A;  1EKK A;  1LIO A;  3RSF A;  3B1N A;  4YL5 A;  3LKI A;  3BF5 A;  2R3E A;  4EOH A;  4LBG A;  4EBU A;  3RQ5 A;  4X8F A;  5EYN A;  4XDA A;  4XF7 A;  3RPH A;  3IQ0 A;  4C5K A;  3RRE A;  5C40 A;  4S1I B;  3OTX A;  3RTC A;  4E8Z A;  5BYE A;  3HIC A;  2VAR A;  3RT9 A;  4DC3 A;  2AB8 A;  3RM5 A;  3RSQ A;  5F0Z A;  1VK4 A;  1DGM A;  2FV7 A;  5TQI A;  4EN4 A;  1TYY A;  3RQ2 A;  2QCV A;  5C3Z A;  2QHP A;  4EUM A;  3LJS A;  3NBV A;  4C5M A;  1EKQ A;  3DZV A;  1GQT A;  3B1Q A;  1L2L A;  3RTE A;  1RKA A;  3K5W A;  3MBH A;  3KZH A;  1GC5 A;  1TZ6 A;  4C5J A;  3RTB A;  5CGA A;  4U7X A;  1V1A A;  2C4E A;  4JKU A;  3NM3 A;  4XF6 A;  1UA4 A;  3IE7 A;  5BYC A;  3RS8 A;  4E84 A;  3NBW A;  1V1S A;  2AFB A;  3GBU A;  1TD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...