3RSFA

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima in complex with p1,p4-di(adenosine-5') tetraphosphate
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
490
structure length
490
Chain Sequence
b'HMKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
molecule tags Lyase
source organism Thermotoga maritima
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
total genus 178
structure length 490
sequence length 490
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rsfA01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3rsfA02
2F7KA 4KAHA 3UMOA 3RQQA 2HW1A 4S1MA 1DGMA 4UBEA 3GBUA 3RTDA 2PKKA 3IQ0A 3RQ6A 2V78A 3ROXA 4XF7A 1WYEA 2AFBA 3VASA 4E3AA 3NL3A 2QHPA 4K8PA 3NC2A 2O8NA 3RTAA 5COJA 3RO4A 3RQ8A 4GM6A 3ROZA 3RS9A 3RQ2A 3H74A 3K9EA 5CGEA 3KEUA 3NM1A 5B6AA 4S1IB 3IH0A 4N08A 3RPHA 3RU2A 1JXHA 4YWRA 2ABQA 3Q92A 2XTBA 1BX4A 1TZ6A 3QA2A 4XCKA 1LHRA 1YGKA 4C5JA 1LHPA 3D3KA 1GC5A 4KADA 3RTGA 4K8CA 5C3ZA 3RM5A 3K5WA 2R3EA 4EN4A 4LBXA 4JKSA 3LJSA 3BF5A 3NL6A 3QAIA 2AJRA 5BYDA 3B1NA 3Q1YA 2I6BA 3LOOA 3DRWA 3N1CA 4JJPA 1RKDA 3UBOA 4E69A 2C4EA 3UMPA 3B1RA 1ESJA 4K9CA 3IN1A 3NBVA 3BGKA 4YL5A 4LC4A 3LKIA 3B1PA 3EWMA 3RY7A 2RBCA 3KD6A 3NL5A 2HQQA 1V19A 2JG1A 2AX3A 1RFUA 3RNOA 4DU5A 4E84A 4K93A 5F0ZA 3UQ6A 1V1SA 3NBWA 4KALA 4PVVA 2JG5A 5EY7A 2C49A 1KYHA 4X8FA 4XDAA 4C5KA 1TYYA 1JXIA 3H49A 3D3JA 1JZTA 3FHXA 1V1BA 4LBGA 3RO7A 4O1LA 3LHXA 1TZ3A 2Q5RA 1EKKA 3B3LA 3MBHA 3IE7A 4K9IA 4KANA 3FHYA 3RRJA 3RQ5A 4O1GA 3RTBA 4EBUA 4E8ZA 3MBJA 1RFTA 3GO7A 4XF6A 1RFVA 2AA0A 4LCAA 2I6AA 2DG2A 4C5NA 2QCVA 1LIOA 3RTEA 3HICA 2DDMA 5CM5A 1UB0A 1RK2A 3PL2A 3RS8A 4S1HA 1ESQA 1UA4A 2JGVA 2PKFA 3KZHA 3NC9A 1YGJA 5BYCA 4U7XA 1VM7A 3ROGA 3NM3A 3RSFA 1LIJA 3UQDA 3RSGA 4JKUA 5TQIA 4E8YA 1YHJA 1V1AA 2A9ZA 3RSQA 3RRBA 2DCNA 3RT7A 1LIIA 2ABSA 2AWDA 4K8TA 3RPZA 3UQ9A 3RRFA 3RSSA 2HLZA 5BYFA 3RTCA 3PZSA 4B8RA 4B8SA 3RU3A 4N09A 3JULA 2FV7A 2DDWA 1VK4A 1U2XA 3NL2A 1C3QA 2AB8A 4S1IA 4WJMA 3HPDA 1RKSA 3IKHA 3UQEA 4EOHA 3B1OA 1GQTA 3DZVA 3OTXA 1TD2A 3NCAA 3IBQA 4K8KA 3RQXA 5C40A 3KTNA 2YXUA 3B1QA 2NWHA 4DC3A 4KBEA 5CGAA 2F02A 2A9YA 5C41A 4C5MA 1RKAA 5TRWA 3GO6A 3RQHA 3RREA 2R3BA 2YXTA 3W4SA 4E8WA 5F11A 2PKNA 2VARA 1EKQA 3ROEA 3ZS7A 1LIKA 3CQDA 2I5BA 3I3YA 2PKMA 5EYNA 3RT9A 1L2LA 2DDOA 4EUMA 3HYOA 5BYEA 5C3YA 1VI9A 3VAQA 2AJPA 4C5LA
chains in the Genus database with same CATH superfamily
3WAGA 3LCVB 4MVWA 1QFZA 4X1KB 3DOFA 3RK1A 3VVMA 2ABWA 1J39A 3DVAA 2C78A 4DW8A 4C3OB 4QT0A 3PKZA 1T9GS 3CEHA 2GLTA 5BMOA 3WLJA 3PQ7A 5SYMA 5JWHA 4PFJA 1MVOA 4KOEC 1R0ZA 2VQ6A 3H18A 3U7IA 1U9JA 2B4KA 4JX9A 3KEUA 3HWRA 1G59A 1BQEA 2ASEA 3LLVA 4C14A 4RIGA 3N7TA 2FN8A 2OVFA 4F11A 2FK7A 5BRNA 4B7UA 3B6MA 5A03A 1T6BY 1U2SA 3WJ1A 3PDCA 2SECE 1UIMA 1UMDB 3N2YA 4HGRA 2Z95A 3PLAE 2OGTA 2NX2A 2WUVA 3IMGA 1KH2A 4WNIA 1YQGA 3Q7EA 3O90A 5IAEA 4DQKA 2BM9A 1JLLB 1YU6A 4WOCA 5J23A 2C5AA 4AURA 4K8RB 2VSNA 4IF4A 1M1YB 2GN4A 1X7XB 1YL5A 3MSXA 3P94A 3RSZA 3SAJA 3FPJA 5LC1A 4ARVA 3E9RA 1VJRA 4D42A 4GDFA 1LU9A 3C7AA 2IZOA 3QKIA 3MW8A 5BPHA 1H9CA 2G08A 5CURA 2JG1A 2VH1A 1NSYA 4N9QA 1Z0ZA 2XE4A 4MEAA 3OQMA 3MWJA 2J5KA 3V4SA 3P9NA 4OREX 4RPKA 1EFDN 1BGXT 1I51A 1RSZA 5E4YA 4B75A 4II7A 5AJHA 4LAFA 1F1BA 2HMSA 4UZFA 5FFNA 2ZR8A 4HADA 3VZQA 1Z5VA 5IWCA 1I4DD 3KO8A 4FFLA 1YS9A 1E2HA 4OLJA 2E0IA 2CMFA 2E6KA 2AFHA 5JXIA 1QIMA 1UINA 4NE9A 2C4VA 1UL1X 4B6PA 1JIQA 3MGGA 4ZCSA 5KC9A 1IOLA 1IY0A 3OWXA 4KQJA 5C0OE 1FSSA 1B2RA 1YA8A 2C0CA 1D2MA 1UP7A 2BBSA 4LISA 4BJ1A 2VXBA 5JW6A 3MUEA 3E22A 1S8NA 4MI1A 3S2UA 1ELOA 2AOVA 1NN0A 4DQVA 1Z4MA 3WWCA 3EZ2A 2HB6A 4M0UA 5EIBD 3TS1A 3UGKA 8ABPA 4N82A 3WB9A 3FSEA 4X3PA 5JALA 1L7QA 1KVTA 4XUDA 3OZUA 1EKXA 2I2BA 2TMGA 3JR7A 3SQMA 3FVVA 4LJKA 1YQUA 1RAIA 2HREA 1BW9B 1WF6A 3F9IA 2ZB7A 3KT3A 3P2EA 2ATEA 1YZHA 3IJEB 4JIMA 3NBMA 4YASA 4JI7B 1MB9A 2E87A 1HFEL 3AP1A 2PGDA 2VF5X 1J8MF 1NE2A 1WA5A 3DAGA 1NV9A 2IZ1A 4NJMB 5A6SA 4G84A 2FW0A 2FEPA 3NATA 1II0A 1JQJC 1QQ6A 4ALJA 2RE8A 3EMVA 4MINA 4MSUA 2B1RA 4QUKA 4E5KA 2X0JA 1PGOA 4IIFA 4BU1A 3UHOA 1TEXA 5F64A 2WWYA 4LV6A 2GO1A 4BQOA 4EJ2A 1UQRA 1QHHB 4TYYA 3HWSA 1J09A 2L82A 4FGSA 4FZRA 1JFSA 2A9OA 1HQYE 5ALMA 1V7PC 4XQEA 4E70A 3ZZUA 3PNQA 2XCQA 1L1QA 3TVDA 4NWIA 4RELA 4I8IA 2P9QA 1TAQA 3EPRA 5H7XA 4LN1A 4GLJA 1K4MA 5TC4A 1EJ0A 4LRWA 3KUDA 1G2QA 3VC1A 1S3IA 1UBRS 3R7BA 1SQ5A 4LS3A 3EWSA 1QANA 5BR4A 2EKPA 5AW2A 3N3AC 4NYMQ 4QGSA 2OM6A 1GNTA 1XXLA 2PBRA 3KCQA 3QV1A 5CCEA 3UJNA 4AKIA 1PUJA 3H9BA 3GYBA 5FJIA 2P9HA 4J7CA 2H8KA 5A9SA 2POCA 5FADA 1ONPA 3H8VA 3ONFA 2O5CA 2VUIB 1F2VA 1CJVC 3EZ7A 4GNKA 2D2VA 2R6FA 4DCJA 1QRSA 3KSZO 3NKVA 1Y7LA 2ADOA 1FMTA 3HEAA 4WJKB 2C4WA 2D1QA 1UOOA 1TNDA 2EGUA 4F3NA 4HQFA 1DRJA 2FWBA 3WRXA 3ER8A 4WEQA 3KZCA 1M33A 1TT5A 2Z5VA 1NUSA 2PUEA 3L9WA 3C1TA 3DMYA 4GYKA 1E4OA 3PDUA 4HAUA 1Z28A 3NJ4A 4X9XA 3KVYA 3LVBA 1R5OA 3L7JA 3EXAA 2FWIA 1G5QA 1EUDB 4UBNA 1N34B 1C1XA 4L7VA 1S8AA 3M4XA 3FGPA 3CCBA 1N0VC 1O95A 3OFND 4EG3A 1JR4A 5BWOA 3K5PA 1SQ0A 3VZRA 4ENWA 1FJHA 3GA5A 4FFPA 3AKYA 3K35A 4J3JA 4DIEA 3PFIA 2OHIA 2UXBB 5ENDA 4EIWA 1C7EA 3AR3A 4LSMA 3PNOA 4GPBA 4LBGA 1FYFA 2X5XA 1GPDG 4AT1A 4OQFA 1ESEA 1O6GA 2QI9C 3BQNB 4GLBA 4YJ3B 2PT5A 3QZUA 1L8QA 1D09A 4A8JC 5I7EA 2I4IA 1K98A 1RPAA 2WTEA 2WE8A 4FJ1A 4JGBA 2IEYA 4ZC8A 5JDCC 4XUEA 5TPWA 3RH0A 4OK5A 4DV2B 2IOQA 1JEQA 3CT4A 3JX9A 1H5UA 2BHSA 3MXTA 3COJA 2BDEA 3VHXA 3PUHA 2QCVA 5IEBA 2Q4TA 3P4YA 3JD0A 3GJ7A 3PFWO 4PO3X 3TSOA 3K31A 4BP3A 2WTZA 2P7IA 3I2IA 1DDOA 2BJVA 2PKFA 5ENZA 3KCNA 1KVRA 1PWYE 2CWWA 1TYZA 2K4MA 3WB1A 3R24A 4KAJA 5KYYA 3UQDA 4FBMA 1CUBA 4JXXA 4UHHA 3WLOA 5C5IA 3JQ9A 1KI8A 1KMHB 3M9LA 4M38A 2DGDA 2BMAA 1EP3B 3CLHA 3UQ9A 1A4IA 5KYKA 2FP3A 1HZJA 1X14A 3H3XA 3H9QA 3P20A 4A9AA 1G6HA 3O8CA 5GZ6A 4PY2A 4TRNA 5DIFA 3QE4A 3WFIA 5I5GA 4H4DA 3W6ZA 3ULKA 2O7VA 5CM9C 1I7NA 3OE5A 1P44A 5K3OA 3R6DA 2D3WA 4H0NA 1N6LA 2XWJI 4MQ6A 5TGZA 3HKDB 1AXEA 3PEWA 2O3UA 2Q7OE 2N3ZA 3HXLA 3B7WA 1PFKA 4ENQA 3G2IA 4YJ3A 4CIVA 3TUIC 1ADGA 1J33A 1S2MA 4P58A 3UJDA 5AVWA 1WZNA 3L1KA 3LYUA 4N8DA 4AROA 4CF3A 2YIMA 4JJIA 4AZ0B 4GI3A 2IYRA 2FGJA 4RCZA 3TD9A 1JFFA 1QIHA 4DJAA 3KLMX 1NM5A 1N0UA 2PWYA 5EPUA 2CXXA 4TXMA 4O2BA 1F9AA 3MTJA 3IVRA 4G1VA 4K9NA 4NENB 1X1BA 1ENPA 4YRDA 4S04A 2E5LB 2ATVA 2WIGA 4K0RA 2C5LA 3DZJA 1ZK4A 4Y1EA 5T4BA 3WBBA 5HMMA 3C6KA 3WS7A 1YZGA 4B76A 3O26A 1NVXQ 4JK3A 4LUCA 3TL2A 4S1MA 3LXMA 4IHJA 2BSQA 2V7GA 2I4TA 4IJ5A 4HGQA 5DNUA 2PUBA 2A3RA 2WBLC 1L3CA 4KRYA 2DHCA 4W8OA 2FR0A 3ADPA 2X3UA 2Q5FA 3OJLA 1W34A 4QOEA 5I6DA 2BEKA 4HKTA 3KM0A 2WV9A 4RK6A 4E08A 4HOYA 5CGEA 1DP4A 4DCPA 3ZE7A 4YT4A 4GOXA 1JN0A 1LC3A 2GEDA 2Q46A 3N76A 2ZI5A 3TH5A 2EOAA 1E60A 2XUPA 5HBGA 2QMOA 2GTHA 1E9BA 2HQRA 4CLOA 5IT4A 3S8EA 3IC5A 1KFKB 1R12A 1ZVMA 1K7FB 2ZIXA 4ZJYA 2R6ZA 2JBHA 2ILVA 1AOXA 3L0DA 3L79A 3Q15C 4DL9A 1Z33A 1HE8B 1XKXA 3OLQA 2X0KA 1YA4A 4GBGA 2VNJA 4C30A 5KVCA 4AKHA 3N2NA 1EQAA 1G1AA 1NLFA 2XXAB 3W90A 2HQOA 4HYQA 1HDCA 1RWPA 1EFCA 2IFTA 2PUFA 4JT9A 2NUTA 4M36A 1NFFA 1EPUA 2HTEA 3B1XA 3F2VA 3GRRA 4MJ7A 4W7IA 5AJZA 5FNVB 4CKBB 4UNPA 1FX1A 1ATZA 1MIOB 1JQ5A 4C13A 2OK7A 1CNMA 1LRJA 2UZ4A 2J0SA 1NBMD 1GGKA 2O2ZA 3GBPA 3V34A 1DADA 4JI8B 4HX5A 4XUCA 3WWZA 3DTTA 3RIMA 3UQ6A 1PT5A 3EDCA 3NPAA 3MS2A 2A33A 2RDMA 3OEEA 1RAHA 2BVNA 3ISJA 3NT2A 2NU8B 3WG9A 3I2KA 5BSKA 4P7BA 3SEQA 1KDPA 3U7GA 2JHFA 3QVWA 3O4IA 3SDBA 3DLPX 1ORTA 3OP4A 1KU6A 1HG0A 3P5SA 3U5TA 4EBUA 4E11A 2AB0A 4PVCA 1CQJB 1OMOA 5JDCA 3N53A 4TWAA 2D3TA 2OCAA 3P27A 4GX2A 2WYVA 5K0TA 4RE6A 1RK2A 3SYNA 3LQ4A 4BZPA 1DNPA 3Q1LA 3GJ0A 1X7ZA 3UHPA 1KO1A 4DQLA 3DMTA 4HEHA 3M4ZA 1SXHA 1PT6A 1EP9A 4DZTA 2HIAA 4LZPA 2PGLA 1DBQA 4G9GA 2ZANA 4I5EA 1ZMXA 3DV9A 5IDQA 1NW6A 3JD1A 1RKUA 4PQEA 3S1AB 2H16A 3MWEB 2DTEA 2A88A 4M1SA 1CY4A 2C2OA 4A4DA 1JG3A 2AVDA 5JXJA 3BIFA 2XCSB 1GILA 1GA4A 3VTAA 1BGWA 1R8SA 4B6QA 3CO5A 3E0XA 3AEXA 2E5FA 5G4LA 4PZYA 3FDJA 5KYTA 3R3YA 2D7DA 1OLXA 2ZZMA 2RHJA 4GWLA 1RKSA 1GGHA 1R4MA 1ICEA 1NIPA 3ZS9A 4OBWA 1S01A 4MVJF 3TWOA 3R9XA 2I7DA 4EYQA 1AZSC 2PGJA 1YCHA 2ZREA 5HK9A 1L5YA 2DYKA 3Q2OA 2NU8A 1GZ5A 5L9AA 5LQUA 4KN5A 4JEUA 1NKVA 5F4BA 1PLLA 5KSPA 2QNIA 1MW9X 4A36A 3DMDA 1F3LA 2I7VA 4FKZA 4GVLA 4C78A 4Y2GA 4Q9JA 4EPYA 3BDVA 4U7DA 1W8IA 2N42A 3HXOA 1DWQA 5LP6C 3OPXA 1Y33E 2OBMA 2XUIA 5IDWA 5FNZA 3SZRA 2O5RA 4RESA 4J7AA 4NYIQ 2HRRA 1UC4B 1LPPA 2RIRA 3DV0B 5HKLA 2EF1A 5H59A 2C29D 4NPHA 3VTFA 3C3DA 2HWUA 1QTIA 4A8JB 2IJGX 3WRXC 1ZD1A 1Y1LA 1U8TA 2BKEA 2EFHB 2PZMA 1D1TA 3SI7A 4PC3A 3OIWA 1E1CA 1TTPB 5JPIA 2P4EA 4LJYA 1XWIA 1EMDA 1UODA 5CBPB 3A3OA 2QU7A 3BFJA 3HUTA 1EB8A 4LJ9A 5J2TF 4B9AA 3Q92A 3CX7A 3QY9A 3LQRA 4CQMA 4G25A 2W2MA 2FWNA 1A9OA 4IIGA 5L7TA 1QOPB 1ZBDA 3G5AA 2Y1KA 3MS7A 5TS2A 2OXIA 3VYUB 4ZXPA 1MFPA 4Q6BA 1P9OA 4KN9S 1TT7A 4IVPA 1RKQA 3Q9NA 5EYPB 5CFQA 4E69A 2PPVA 3UMRA 3A6GA 4MW1A 2R751 4PCLA 4QUEA 2IX3A 1D0VA 1BYIA 2JAQA 4MQFA 2G1PA 3LX5A 2X2FA 3FNBA 3O8OA 2B9VA 5AKHA 1M75A 3VJMA 2ERCA 4JLNA 4DKJA 1F20A 4YO7A 1V19A 4GT1A 3EG9A 1KRXA 2H51A 2O7RA 5FPPA 1E5QA 2BEWA 5C4IA 3EMKA 5KTOA 1YRBA 2IE8A 4KBFA 5CPFA 3EVZA 5JAOA 2O0HA 2WJVA 3BHNA 4PPYA 3GMSA 2YHBA 1Y8CA 1UFVA 4QGFA 4JLWA 1HT0A 3EVAA 5CH3A 5HRCA 2F1HA 3FYUA 3KJXA 2RBKA 2Z9CA 1U0JA 4R1UA 3HA3A 3ZGNA 5KJCA 1P1IA 1WSWA 2ID7A 3M5PA 2PWAA 5EKXA 2H92A 4GI2A 1AMNA 3HCPA 4YTEA 1M9NA 2CXUA 3X1KA 2MSLA 4EY3A 1R4MB 2PTGA 3I83A 4HFJA 1MO6A 1V8DA 3OFKA 4YJHA 3BG5A 2AKYA 1FZQA 2OHOA 3T35A 4LTMA 3OP1A 3ZCPA 1M2OA 1PNQA 1O94C 2WWRA 1VPVA 1I3MA 4PF1A 1FXUA 1HSOA 1U2PA 2BFFB 3V8EA 3PWKA 1DAIA 3UENA 3P2OA 1GLNA 1E0AA 1CZNA 2PX6A 2H52A 3MBKA 5EXTA 2UUCB 2R8BA 3WL8A 1TECE 2V3VA 3RHZA 4PZEA 1ZH8A 3LPDA 3W8FA 2H8GA 4IILA 3PHBE 3WADA 2OCIA 4TMZA 4PNZA 3EEYA 1MOSA 4RZIA 5D84A 1YRWA 2QX6A 3O4VA 4B47A 4DT1A 1QB7A 1Z68A 2RHGB 2HCFA 4YUVA 3MJCA 4R68A 1USIA 4UAJA 2O50A 4GECA 2PLAA 5A3JA 4U3JB 3IAAA 1HFKA 1RD4A 1T6ZA 4QATA 2XUAA 3U1BA 3PC2A 2WUGA 4MVJD 1EVIA 4RF2A 3EIQA 2ZRNA 3S55A 3HSKA 2FWJA 1PR4A 3EXIA 3TW8B 2VWGA 4PGGA 2VJMB 5KHLB 4J7UA 2B2CA 1E92A 1W4AA 2VPYA 4CG1A 3OPYI 2AEMA 5U4QA 1ZMOA 2XYQA 3GZNA 1XQVA 2IYZA 3QLUC 4WXMA 5FI3A 1WZ2A 1MDBA 3B12A 2AV6A 4NS4A 1PEAA 5TMEA 3CZAA 3HKBA 3J81A 1OH8A 3BKWA 2ZYSA 4BVHA 1WUJS 221PA 3MNFA 4GE3A 3L4BA 3UPUA 1E3MA 2VYCA 2BUAA 3IQ0A 2PNFA 3DL4A 3ED5A 1MUUA 3G8BA 4L3WA 4Q1VA 5B3KA 1WR8A 1E2IA 4RMJA 3PXDA 4XYGA 3AILA 3PFNA 1Z4KA 4O08A 5EEGA 3WV4A 4M0DA 2HT1A 5PNTA 2X6QA 7MDHA 2OBLA 1DO8A 1OAKA 1OI7A 1YRLA 1F2DA 2H00A 3L7MA 4J1TC 3THXA 2LUOA 1NW5A 2NUPA 5B4UA 5FUMA 4FLEA 1XQ6A 2VPZA 2R25B 3BGVA 4B3CA 1DELA 1M0WA 4J0JA 4NESA 1NMQA 1M2WA 2QMYA 2X14A 3BH0A 3QPCA 1MGOA 1P6QA 3DBHA 4DA6A 3BIOA 3GC6A 1MO5A 4UHFA 2CNLA 3FNHA 3NL6A 4ARCA 3ACBA 2RJNA 4DTIA 4W4TA 2DOKA 1NZJA 3DZBA 3GEHA 2XUHA 4PZ9A 1GA1A 2GCGA 2QDXA 3C24A 3UK6A 1QZ3A 4YUXA 3RVBA 2B35A 2MSEB 2QS9A 5IBQA 4HGPA 1H42A 3UV3A 1GV0A 3TW8A 3UXHA 1K66A 1TM1E 3FDIA 1YQDA 4QOSA 4U8HA 1HE4A 3RSCA 3H42B 5LVAA 3E7FA 1J8YF 3B6ZA 1LDYA 2X0EA 3LGSA 4HQRA 1TZMA 4JU9A 4UE3S 1MOZA 2JAPA 1C8BA 3KBOA 4K9OA 1YC2A 2HEIA 1QKKA 2B1IA 4YRCA 5F7JA 4II2A 4XDAA 2ZUBA 3BHMA 1N6IA 1RAFA 3VR2A 1MO4A 2FFHA 1W25A 3RRJA 1RC1A 1YL6A 4LXUA 2DQYA 3V3TA 2PJZA 2XNKA 2QVGA 3CRNA 5I7VA 3FDFA 5AVJA 5JSQA 3RV3A 4R2KA 4G1MB 1VL1A 1QBGA 5AHWA 4A73A 3HCWA 4QZVA 3BJZA 4J03A 3G5LA 1GYPA 3T6KA 5JJBA 2E4VA 3O6VA 2H9IA 3PC8C 1NUAA 3PT5A 4UTVA 1A76A 1O96A 2VPXA 2YL2A 3RI3A 3DSRA 3SJ7A 5C46F 2C7PA 2GK3A 1BE6A 3IBCA 3M1IA 2B7LA 2QB5A 4FFOA 3U4QA 4MPRA 2YINC 2OEPA 4KCGA 2C5FA 1YHJA 1BTOA 2ZYRA 2C7BA 1XAJA 5DYYA 3I42A 2VJMA 1REQB 1BHJA 3IQEA 4Y7DA 1FP1D 3QMPA 2JLQA 1XWWA 1NQUA 4IIYA 2YJ3A 1RE1A 1GN9A 3IPYA 5I7RA 5LMUB 1PJ4A 3B89A 4K9PA 4X97A 3BTVA 3IPRA 3OZWA 3B1OA 3G2OA 5IRCD 4KXVA 2WQ6A 4FKBA 4FMDF 3U1VA 3LT5A 4PLFA 4Q82A 5CB8A 3TX6A 2X9GA 2ZUUA 2F48A 3IP5A 4UEOA 4Y2JA 1PLKA 5DTRA 5LU9A 3M83A 3MTGA 3I8OA 3T9DA 2HU8A 3SKXA 4IGFA 3I4FA 2BE7A 4E51A 1NJ1A 4BEBA 2AYZA 2GXSA 1FMJA 2QVLA 3EGOA 4MW2A 3CNNA 5ULLA 4TXNA 5I7FA 2I80A 4WA7A 4X85A 7REQB 1O89A 1PIWA 2G06A 3OZDA 2I03A 2F8LA 2FSGA 4PZ0A 5TGTA 5I7WA 5KYNA 1XPUA 1ZEMA 1KBQA 2CT8A 1FQJA 3I61A 2IEZA 4Q3CA 5E7IA 2H0RA 2HH9A 4DB2A 4WQMA 1N1MA 3R4CA 4XR4A 3E5HA 1PV1A 4M0EA 1Z56C 3TBFA 4U1RA 1YRYE 5KDOA 2I1WA 2W6QA 3R5JA 5DIZA 3UAYA 2CNWD 3MCUA 4HWRA 4HDCA 1PWHA 2WY2D 4CEJA 3PIRA 3JAKB 1X9HA 4FCTA 1R37A 2C7VA 1RIFA 1LTHR 3L92A 4HDOB 1CVLA 3EVNA 1G8GA 1UEJA 1GZVA 3G2KA 1MB2A 3LPLA 4V0NA 4WKNA 4DMMA 3V4PB 5L3SA 2I9PA 1QHGA 3F1KA 3W2HA 5IUNC 3GCWA 4HVCA 1YDEA 2WVHA 3KPUA 1SK9A 4XVQA 1D8AA 4P4SA 5FR1A 4YGXB 2EQ5A 4MVJP 4OFBA 5D3ZA 1Q2XA 5JCOA 2XIQA 1E99A 3ZDYB 5EJ9A 1B6RA 1P2SA 4EFKA 4LRXA 1HLDA 1L1FA 2HJHA 4BJHB 3IJ5A 3K0BA 1Y8QA 3N2GB 1BXGA 1UPCA 4FZVA 1PR0A 1HORA 1EXWA 3AI7A 4FOOA 3ZE8A 2G9RA 5JZOA 2VFAA 4CTOA 4CLRB 1L7MA 5LB2A 3EQ8A 1L5VA 1AKVA 1W49A 1QGUA 2W42A 2D4HA 2PAAA 3ZBPA 5LQMA 4YRTA 4RF4A 3HNPA 2E55A 2VHJA 3PV0A 1C0KA 1SUWA 5J4LA 2YMPA 2V0GA 3KX2A 4QDTA 1HK7A 3I32A 1TM4E 5AKIA 2QTLA 5H02A 1N6PA 1ODFA 1X77A 2ECOA 2I4RA 2GAAA 3RKUA 3ND9A 3VR5D 3WDLA 3MSCA 4ZI2A 1GAJA 2GRUA 5BUZA 4O6VA 1KIAA 3LKDA 3X1YA 5ALGA 2ORIA 4WE3A 3P9SA 1YQWA 2AM2A 3O8LA 5BRJA 2XGMA 4HWPA 4RV4A 4N3CA 4QGBA 5EJ4A 1L4LA 1E5TA 1H2WA 2MINB 5HPYB 5JHHB 1CLUA 1XQXA 4L1KA 5GADl 3OTQA 3OCVA 4Q3EA 4DWVA 4MCAA 1H2FA 5TDHA 4K8CA 3W5HA 2FQ1A 1XRSB 4HYTA 4R5MA 5EJGA 1GXSA 3STUA 2J5RA 4RVSA 1A9RA 5HF8A 1V7ZA 3LZ6A 3K09C 4IDNA 4XRGA 1AA9A 1V5GA 4O2AA 2AWNA 2PGNA 3L8DA 4JB2A 4B3IA 1MEJA 1AHHA 1PKXA 3QVKA 2GZ1A 2QZSA 3RG8A 4R1TA 5FP0A 1LDGA 1L4HA 2JI4A 3H6KA 4TTTS 4HGOA 4AUMA 2L17A 2GF0A 3ESZA 5KX5F 1JDSA 2Z43A 3BIJA 1XJ5A 3ZK9A 2Q62A 3O8QA 5D85A 5GJCA 2VUTA 4ZQCB 3DF9A 1U98A 3KYBA 2VRNA 2PD3A 4L5JA 2BZGA 2V3CC 3NHJA 1PD1A 4ZYYA 2MR6A 4R1QA 1SQ6A 1GPAA 1SC6A 4OPMA 2GAIA 4Z9YA 3DDSA 4CPDA 2BFWA 3CJRA 1RQ2A 1XMXA 2Q6KA 1Z6PA 1UMKA 4OGWA 4P9NA 4A92A 3UWPA 1HTBA 1EIWA 1ONBA 1PZNA 3AUFA 2QHPA 1V4VA 1Z2NX 1QHFA 3QF4A 3RS9A 1SHKA 3K9EA 1ZD8A 4YIHA 3KYJB 1YVPA 5FQNA 4YWRA 1WX1A 1J1ZA 4JI6B 3GPCA 5F3RA 3GLFB 1G55A 1E66A 3FCYA 1H8EA 3K5IA 4ANFA 4AULA 1HDXA 5BVHB 1HC7A 3FRHA 5KDDA 3L7DA 5DSZA 1A4UA 4S1TA 1D2CA 3CUTA 3F2IA 3EA4A 4QRHA 4FI3C 5CK5A 4JI4B 5JFOA 3F3YA 1YD7A 3HUUA 1QAOA 4Q7MB 1OC2A 4QJBA 3QE2A 2HUPA 3TCXB 3SBDA 4E2FA 4D8VA 4TL6A 4C87A 4FXOA 4DAOA 2VKTA 3QXCA 3COPA 4TWIA 1Q0RA 2VF8A 3FLBA 4HSEA 4BBPA 4B73A 4IRUB 1YKGA 1Z4JA 3ZIAD 2BHNA 2GK6A 4P4TA 4BMCA 1V9LA 1D4ZA 3PI6A 4E33A 1E9DA 2J3MA 2PO7A 2V58A 3Q11A 1IYZA 1L8XA 2ZIXB 3K2QA 5E6SB 4R8KA 5HZMA 1RZRD 4PO9A 4PLPA 1I2AA 3H49A 4MP8A 1ZZEA 3FFXA 3WLSA 2H5JA 2WJHA 4UEWA 2HL6A 4BNXA 4O33A 4GI1A 2C5GA 3L2OB 4Y2QA 1U3GA 4OGGA 5K3BA 1GQFA 4JBNA 3R0JA 4EQ6B 1PZHA 5K20A 2PUDA 4WTOA 5AVVA 4KDCA 5DNYB 3ZWNA 1I4LD 4RD6A 4XYMA 4WHMA 4AS1A 2BUBA 3VR6A 5J47A 3GJXC 2ZUFA 4P3YA 2FUCA 5JARA 3E6AA 3EW9A 2OPHA 2WHQA 2YYZA 3GPBA 3UXEA 5LNK1 5HSGA 1JEQB 3FYTA 1SBQA 5ALOA 2WA2A 4O1IA 1FFYA 4U7GA 3EHDA 4KNWA 4LQ4A 4HT3B 1FB5A 1QCDA 1U0TA 4A0RA 2VYVD 5KC8A 4KUHA 2YRFA 2ZRGA 3HFRA 4KO3S 3LK6A 4JI0B 1QR6A 1ULZA 4ZOLB 1WRBA 3NC0C 4KXFB 1VGQA 2ZB8A 2BY4A 1I1NA 3REOA 3OTXA 4GYWA 4LKRA 4QBGB 1GQ2A 3A6KA 5JAUA 1RLJA 2ZWAA 1AV6A 2O1EA 1CU1A 1P33A 3GD5A 4DUYB 5K0EA 1A71A 1G5IA 1KYZA 3QE9Y 3SM9A 1YJBA 3DUFB 1C9DB 1RBQA 5F1OA 4PSVA 2JEYA 2GBPA 4EB8A 3WMFA 4NBUA 3AONB 3W04A 4B80A 2WHPB 1OFTA 1RYZA 4LJ8A 4O1HA 1EX7A 5AM4A 3QELA 3UJCA 2GSDA 4H18A 4QBIA 3ZHZA 3H1TA 2BIFA 3OMLA 5DXFA 4EQ6A 2CC2A 3FSGA 5AR1A 3S29A 1XMPA 4HXYA 4TKZA 2CLLB 4B4KA 4EVIA 2NNLD 3A58B 3EXHA 1MJNA 2BKXA 4RAOA 1VPEA 4UTZA 3SDSA 1YJ8A 4DMCA 3FCXA 1Q0SA 2WTUA 3RIYA 4W9NC 4BBZA 2PKKA 4YI5A 5GP1A 1KETA 3PFGA 3E3NA 1JR6A 1D0SA 2YVLA 3DAHA 5LA6F 2OCGA 4RMGA 3TSYA 4GM6A 5EE3A 3L6BA 1M2NA 4NENA 1GAXA 2O2YA 4PYRA 4S1IB 4AO7A 3OA0A 1U3CA 3GQBB 4Q9DA 1KZ9A 5AW4A 2P4UA 5HQ3A 1E8MA 4MR9A 1YGKA 1IQPA 5FWDA 3R7FA 3JD4A 3ZE1B 4INZA 3UUWA 3C3MA 4WGFA 3O9VA 3DVLA 4XLTA 3KKKA 3P0HA 5K0JA 5JAHA 4JEHA 4WV3A 4PZLA 1MRNA 2N0SA 5JS2A 4NTZA 3DBRA 5AHKA 4OEHA 3K6KA 1V48A 5IDXA 4L72A 5EZSA 1V35A 4CMEA 5LD2C 1WQ3A 2EX4A 2WHPA 3CW9A 1KY2A 3GARA 3ZV5A 4B32A 5FPKA 3GCDA 3C3JA 3ILYA 4CUJA 1NJ5A 4W8GA 4R01A 2CF5A 5EIHA 1C81A 2JIZA 3PGVA 1UJ4A 2OA0A 3HWWA 1J6UA 3K0AB 2OCLA 5BXYA 4H3SA 1GNVA 3FKSD 4JGIA 4G07A 3ZY2A 5IAAA 3WNQA 2J32A 3Q7QA 3VU9A 1H8ED 3IV9A 4BNIA 5CLGA 4A82A 1DC4A 1E5VA 3BXHA 4OJMX 2BFCB 3U7EB 1S0UA 5A9TA 3IX7A 5JRJA 3ESYA 4Z4GA 1J56A 2XADA 2YHAA 2P8SA 4K9QA 4MS1A 2PVSA 3I2HA 3OCWA 5EPEA 3UGTA 5KU7A 1B15A 1MIOA 5D87A 4WIAA 5FOXA 4EHFA 1ZLXA 4RGVA 2NU7A 2AA0A 4LCAA 4XF6A 4PPGA 4KGVA 2ZJ6A 3THYA 3LWDA 4UM9D 3F47A 1VSVA 4ICIA 3VPAA 3GJ6A 3OCZA 4GP6A 3TXAA 4C3VA 5EE1A 2Z9DA 5C1PA 1CFJA 1D2AA 4H4CA 4D0SA 1ID8A 2P3QA 2OHVA 1J5PA 5BYBA 3TNJA 3LHDA 4YUZA 1MPXA 2P3LA 1OA1A 1HE1C 1UDWA 1Y3CE 2Q6LA 4FB5A 5E1DA 4IIBA 4HRVA 1RYMA 1JECA 2IT1A 2JIOA 3FCUB 2ZQZA 4IG4A 1N8SA 5TF0A 5G40A 3GMIA 4BATA 2VK8A 1LS1A 4UEJA 2I6FA 1NRXA 1RYHA 1U9ZA 1OKKD 1KVUA 2YBDA 3WVNA 3SQDA 4Q4LA 4A2CA 5I9SA 4MA5A 3ESAA 1B2LA 4UZSA 5IU6A 2VOSA 3PHLA 3LY5A 4AS3A 2OOKA 5BNIA 2FQXA 2TRSB 4ND8B 4CMIA 2P2YA 4WGGA 1D1PA 3M8KA 3W3AD 5FH9A 4V3BA 4B9EA 5IM5A 2CLIB 2OP0A 3KQVA 3KTNA 2XNSA 4DPMA 1F0PA 3MWEA 1ADFA 4X54A 4Q37A 4AJ1A 4EPVA 1C30B 1E64A 2IKSA 3EFHA 4D82A 5IX8A 2FKNA 3AUKA 1P1HA 2P7HA 3EGWA 3NEAA 4JKYA 5D8DA 5A3SA 1GOTA 4BN4A 5AVZA 3K72B 3DZIA 1DAEA 2I5BA 1ZSYA 5JO0A 3KQMA 3U61B 5AK4A 3UAZA 1FFCA 1OXXK 1M8PA 2HQ1A 2KS6A 2DDOA 1KJIA 5ALSA 4AJPA 5EKSA 2VYQA 4HRAA 4JUIA 2Y27A 4IWXA 4HUJA 4FHCA 1RI3A 4IHJF 4CMEC 4YC7A 2VC2B 4XZ3A 2D5CA 1Y3AA 1F51E 1E1RA 3H6HA 3K1JA 3LBNA 3MWGA 4HEA6 3KEFA 5CVEA 3I9LA 3SD7A 3NHZA 3AMVA 3S81A 4DC9A 1C7IA 1N2CB 3GLVA 4JBHA 4KFUA 2YRXA 4MV6A 4RF3A 4E7PA 1Y9ZA 3AHFA 5B6AA 4PNPA 2PX5A 1SRQA 4KXMA 1LUAA 4MDYA 4HB3A 1TZJA 3ZUPA 1HBJA 3LHSA 5EIFA 5KNCH 2Z8YA 3VO9A 2H2GA 1P72A 1EVEA 1BFKA 1Z37A 1TMGE 3GEGA 4MVJE 4OY3A 2HKIA 3SP1A 4YRBA 4FJ0A 2L69A 4WKGA 3RVOA 4PR3A 1QLWA 1PD0A 3E53A 4OXKA 3W8EA 2GHQA 3DVRX 5C32A 1V3TA 4LRQA 2YVUA 1V16B 4S24A 1JTFA 2XYRA 2A5JA 4E2WA 4B85A 1YR8A 1RRKA 2I29A 5SZIA 3THYB 2AXQA 3IE2A 1U3WA 2FH5B 1RWWA 2B4RO 5ILGA 3KUCA 1ILWA 2YH2A 1X15A 2OWDA 1NP6A 3CF2A 3R6WA 2JLVA 4HGNA 3BORA 5KZMB 1UJ2A 2DJIA 2K7FA 1JILA 4ER5A 5KOHA 2VHUA 4YCJA 3S4YA 2DFLA 1H8HD 3FX2A 4GEKA 4TXJA 1TYYA 3HDHA 5AM1A 3OTIA 3TNFA 1D6JA 1DLJA 4B7AA 5GINE 1DQSA 3C43A 3C5WP 1NJSA 3KPVA 4ARZA 4NCBA 1JTVA 1I24A 3MPUA 1G8KA 5EHGA 3RFCA 2O52A 3DE4X 5BV2P 2IWRA 4KP7A 4L8WB 3D6MA 1IRXA 3IELA 3B51X 1Y9JA 2H06A 4KE7A 1WVIA 2ZI9A 3G2PA 4TLCA 4D4MA 3U6KA 4GBMA 2CBGA 4RPIA 4YRKA 3X3HA 5K6TA 2Z1MA 4NYIR 2OV2A 1ISIA 3TZLA 1D5CA 1XDUA 2IYVA 1VZ3A 4BAGA 4BRSA 2RB5A 3AB3A 3GEDA 2PZKA 1QFYA 3VVBA 2Y76A 5LLDA 1C30A 2P27A 1VPLA 2WFZA 4J2OA 3UJHA 1I4WA 4YRIA 4JXJA 2Z5LA 1TLTA 1Z2EA 3NVDA 5LSAA 5IYZA 4JJ7A 4KG7A 1VTKA 2DTXA 3C97A 1XRQA 4F4DA 2QW8A 2P0YA 3GPDG 4X7BA 4BX8A 5C53B 3IXLA 2HLZA 2VORA 2PH7A 4JP2A 2ICAA 2NUAA 5EWJB 3OLZA 1T3ZA 1YHZA 1K3TA 1RM0A 1AF4A 2WF7A 2X9QA 5TPZD 5G1PA 4P92A 5KJ1A 5JSUA 4QKQA 2SCUA 4FONA 2OKGA 2VNAA 1YV9A 4C4ZA 5MGBA 4EUEA 3C3PA 2UYGA 2IP4A 3ENQA 2DKOA 3Q4GA 1YR6A 5THKA 2VF4X 2GZMA 3H2YA 5AK6A 3UCEA 4G5RA 3S2SA 1LVUA 3P2KA 3PSHA 1P29A 5IC6A 4HQLA 2X41A 4C76A 1CF4A 1RMTA 2C31A 2Z3ZA 2ZJ4A 4BQPA 3T3NA 3DC7A 3QVJA 3FOWA 2EVWX 2X22A 3NVMB 2G1KA 2ZM5A 2P41A 3D59A 1QHEA 5GAJA 4BBJA 2QBYB 1TCBA 4CV3A 1ZG3A 2FJUA 3KFLA 1YA6A 3D7SA 3NU1A 3L0YA 4MV5A 1NKSA 3LKBA 3R0XA 2NO4A 1C7JA 1GTJ1 4IV8A 5BSEA 5ERYA 5K0BA 4E2ZA 3U4DA 2AN1A 2YCLA 1X1SA 2BR4A 3A70A 2JVIA 3R7AA 2BW0A 1YJXA 4P3KA 5EQTA 2PMBA 1PE0A 4BO8A 4EKNB 1ZCFA 4EWLA 4DR3B 3H74A 1Z0DA 4C0XA 4CMCA 5BSHA 2QVXX 3IUEA 2AHRA 2RH5A 1F7VA 1BWRA 1AS3A 3JALA 1WKCA 5IT5A 2X86A 3EZFA 2HF7A 4RV5A 4NDNE 3KQYA 1UXHA 3K5WA 5NULA 4PX5A 3LO8A 2QU8A 1GO2A 1C9YA 2PFKA 4EA6A 2EYQA 1TIPA 3QQPA 1VDZA 1XA4A 1SEPA 2Y0EA 2Z0MA 1PG0A 1SKBA 1KIFA 4GG1A 4BNJA 1T8PA 1E5LA 3VR3D 1XELA 3BB4A 2PX2A 4FFRA 2B8TA 2W0SA 2G40A 3LQQA 3REQB 4YJ2A 4DGSA 4EHKA 2FMUA 4K2AA 5D5QA 5FUWA 5CHEA 5DLPA 5E95A 1VHWA 2ZIWB 3AZQA 1ZOOA 3BS4A 4J4HA 4MI3A 5CGQB 4ZVUA 2CLDX 2GHTA 2P5TB 3TKYA 1GGNA 4PQYA 3V2IA 2JEZA 1RXSA 1XLUA 2RGCA 3KT8A 3BBPA 3V9AA 1B26A 4P6VF 4Z51A 3DDZX 4OMDA 1G291 2J9XB 4WBXC 4YN3A 4A3SA 5DWVA 3D3JA 2D06A 3L07A 4JUDX 3BXGA 2DPHA 3S1LA 3OE1A 1Z4QA 3B2QA 1PAUA 3PE6A 3OQBA 2IHTA 3DXXA 4RQTA 3L0PA 2VP6A 4R51A 1DJOA 1U1CA 2FZEA 3QA9A 3MIZA 1FTQA 2DT5A 2ZI3A 5BT8A 3K0EA 4E5DA 2JDID 2PJUA 1XMOB 4QULA 3RWBA 3UQZA 2D0IA 3U6BA 5HYVA 2AYXA 4JUCA 2H7YA 1FTNA 3LTEA 4FTWA 3RIGA 3O8BA 3QFFA 3FNRA 5HM6A 4I1SA 5K09A 3LHIA 2E4ZA 2IDMA 3NDJA 5GJBA 1STOA 2R1VA 4AMYA 2GN1A 3FZQA 1MABB 3UCFA 3IIKA 1LZKA 4J76A 1FSFA 3LVRE 1KI1A 1GL6A 5JCPA 3SKVA 4C0HA 2IU6A 1JDVA 1S8FA 2VYND 1RP7A 2XAAA 3MB5A 4LV5B 4RVNA 1RXUA 4W5JA 3HVIA 1QP7A 1QFJA 2CMDA 5JVDF 2V5VA 3ZXXA 1L4NA 2GKSA 3E7WA 3LV8A 1A27A 1DUVG 2QSJA 2ZK7A 3DXYA 4RM3A 5DX0A 5LOVA 1UOEA 2B4QA 1P2TA 3FTDA 2B1GA 3HRHA 4LGVA 2OILA 2O7QA 3RBAA 1M7HA 3UPDA 1BQ3A 3AI3A 3NDPA 4L27A 2FMHA 4YROA 4D41A 1CUXA 1NG9A 2IY9A 3SNHA 1ZM7A 1QQBA 4PZUA 1YUNA 5KYWB 1BDBA 2BONA 5D6OA 4LYJA 1X1DA 2ZTLA 1YTUA 3B70A 2E85A 4TQGA 1A9ZA 3FPKA 3LJKA 4RVFA 4RBNA 4Y6PA 1TA4A 1M0SA 3U4CA 3BWXA 3QU7A 1KMCA 3CF0A 2OQIA 4DYHA 3AHHA 3AFIA 3GT4A 5JU6A 1HFJA 3OY2A 5KVVA 1JSXA 1DVRA 4BB9A 4O4HA 4BPBA 1NI3A 3CG4A 3ICCA 4EKGA 3CR7A 3AF6A 1EUCB 1XC7A 1C2YA 2BHLA 3CURA 1JXMA 3BGWA 1E1QA 4XKJA 3VPCA 2QJOA 2Z8YM 4BNDB 1W29A 2W6ID 1GRNA 4LGCA 2ZRMA 3P2JA 5LQDA 4LJSA 5KTPA 3FETA 4DNQA 4WK6A 2PRKA 1SKMA 2UV8A 4UDNA 2ZJYA 1UJNA 3UHJA 2JGEA 4GLOA 1SBZA 1B93A 1YE8A 1Y98A 3A2MA 1TI7A 2KB0A 3H65A 1Q6ZA 1B3RA 1BFUA 1P2FA 2QMEA 3P2YA 4QD3A 3BQMB 3ER9A 3REQA 5KMGA 3Q12A 4ZV4A 4QYIA 3TLGB 5BMVA 4DSUA 3ZR4B 2I5PO 2PSDA 3LJSA 3D3WB 4MYRA 4P35A 3ZGYA 4J07A 3QMMA 3LBHA 5A06A 4UNIA 5AD1A 3FSJX 4H60A 5DT9A 3VZCA 1FC0A 2EF0A 2VHQA 3TZKA 4LFAB 3W9UA 4LOJA 4JNKA 4L6IA 5ERGB 4B82A 4OI0A 3WGTA 5JZBA 2J6IA 1G42A 2VAXA 3ZLVA 4E12A 4WCVA 3V80A 4AB1A 4C4RA 3CRMA 3WLTA 3EYWA 2P9YA 2R6JA 3QFTA 4X44A 2PL1A 4KPEC 1P3Y1 2R6R1 4JYMA 3AINA 4M2LA 2F8SA 4WK4B 1NDUA 2BSAA 1IQUA 4GOND 2YV1A 3K96A 1NQVA 3HB7A 1OTHA 1RM3A 5H9VA 2EJVA 1A98A 2XWQA 3MA0A 4B3HA 1N4DA 1FYEA 2IELA 3DYIA 3Q40A 1B0ZA 3ANTA 3HJFA 3B3LA 1ISJA 2YHUA 2OPBA 1IBCA 3RBXA 3A1UA 2X9LA 1CJMA 1PSWA 3KC2A 2QRVB 3G85A 4KFSA 2CDBA 3WNZA 3GLGA 1JJIA 2IYOA 4TUYA 1KQPA 1OXBB 4BEVA 1HL3A 1LPBB 3GN2A 5CLHA 1ZLYA 1R3DA 3OM0A 3R7DA 1LVGA 2A30A 2VRCD 3P4UA 2ZT5A 4MUKA 3WWEA 4ZJUA 4CIAA 3COWA 4PGFA 3G0BA 5BYCA 4M55A 3C3KA 3LY9A 3AVYA 1E2NA 3D0RA 1Z07A 3N2ZB 2EFJA 1U28A 4FYIA 2JHAA 1OT5A 4KU4A 3IP8A 1NZFA 4MVCA 4NG5A 4R05A 4NMWA 4IDFA 4RMHA 2O8EA 5F9FA 1V1AA 4K9MA 1QPGA 5DM60 1N6RA 1EDEA 5DASA 5J2UA 3VOSA 1YBAA 2WJ6A 1CEYA 3JS5A 4YFVA 2PBZA 1KDYA 1V11B 2VPWA 1VK4A 2ZXEA 3ABRB 4N41A 4F38A 3IUQA 2B30A 4PYJA 1VG8A 3RUAA 5BVGA 1XT6A 2AC4A 2Q2WA 3DHNA 1ZX1A 2FSVC 3ZM5A 4OL0A 1BKYA 1GPNA 3I0NA 2OV3A 4QREA 2FPWA 5EMKA 5JCJA 5LQJA 2O8FA 3UWKA 3AR9A 4PHHA 5HQTA 3TQSA 1DUIA 5DCWA 4F72A 4CL2A 5K0ZA 3LTNC 2R7KA 2VZ9A 1NF9A 3DMTC 3SDZA 2PZEA 4QYMA 1JLRA 3KPJA 3TQRA 5FA5A 3S2ZA 2QRVA 5HIAA 3ZGXA 3H1PA 4PR0A 4AMVA 4IQ8A 3EXG2 1CVIA 3S2EA 4K6HA 7ADHA 1EWRA 1S6YA 3AXTA 1VB5A 3C6BA 4O25A 2FE4A 2W7TA 3JYQA 3IBTA 3N59A 3QNMA 3TGWA 3UB2A 4EMBA 5I3ZA 1U5BB 3VSCA 5E8JA 421PA 3JPYA 4G0XA 3WZLA 3R8FA 2P65A 1A77A 2KBEA 4XF7A 5K6AA 4ER0A 4ZRNA 4TXHA 5TMBA 2F17A 2OO7A 4AF7A 4BL5A 2XVMA 4HV4A 2HADA 3UA3A 1QK5A 3ZU6A 4LCJA 1M6VB 2P67A 2EAUA 1M2EA 2EKBA 3H9GA 3A1CA 3OPMA 1BX4A 1NNLA 3P19A 1N5OX 4P7FA 5B64A 1P6UA 2BZ0A 5EMMA 3E18A 3W8RA 2HA0A 3D2CA 3D7LA 1JA0A 2BGMA 2NQ8A 3ITEA 4HVLA 2IUYA 3O8DA 4BJ5A 1PQUA 3A4MA 4FOSA 3IT0A 1JAHA 2EJWA 3H16A 3HS3A 2G5CA 2EEZA 1LPOA 4ZEXA 1EFPB 3N8NA 3BSSA 3DDNA 5EXXA 1RJ9A 1U7WA 2O59A 3D6VA 1OE0A 2M6LA 4EGJA 4R7GA 3KR0A 3K1AA 3ND6A 1Y8RA 1CY6A 1PS8A 3KB1A 1XHEA 3ZY3A 1SXQA 5UKDA 3OHPA 3L7YA 2PKEA 2WZBA 3QVTA 4N40A 4O2LA 3I4LA 1RBMA 3JWIA 4URZR 4WJLA 5IMSA 2PG3A 3DLBA 2OY0A 4YXWD 2NXCA 3I5MA 3JARB 1T4MA 2JK0A 2PXCA 3OEHD 1XD8A 5KREA 1DIGA 4B6RA 4NOLA 2IF0A 3TZEA 2F55A 1Q1NA 2Z1DA 3EF3A 3NANA 3HDTA 3VR6D 3JZAA 3HA5A 4P5PA 2QPTA 4DMRA 1DV2A 4MI6A 3ZE9A 1T0JB 4YP6A 3VPFA 5I45A 2OZVA 2QTCA 3DHWC 1DBWA 1NXPA 1VKRA 4YECA 2KYRA 4HN4B 2GAFA 4Y0VA 2JGAA 3A8TA 1HDZA 3HP4A 4UFOA 5E4FA 4X65B 2P79A 5KAPA 1T5TA 1WL8A 2PH5A 4B33A 2X76A 2UZAA 2AJDA 3VH3A 2F9MA 3TZBA 4PBRA 3ZHVA 3IVAA 3ZCRA 5COQA 4Q9LA 3FVTA 3O94A 1JG1A 5D7NA 4C43A 1GSOA 2FLWA 1FTGA 2OTCA 5HWSA 3CEJA 3PDJA 4J7XA 1IWPB 4IDPA 5KDLA 4E5UA 2ACVA 5IDYA 3TQQA 2H2WA 1E6EA 1PR9A 2HD4A 5GGXA 4RM2A 3HZRA 3N6XA 4A8HA 1G8HA 1ESMA 2AFIE 1ECLA 2NU7B 4TWRA 3ITDA 2P4QA 4XDYA 3VNBA 3RWMB 4IRXA 1NHGA 4U6NA 2BTEA 1CQIA 1DJLA 3HN7A 5HZKA 1EEXB 1S9DA 2GN8A 4NDAA 3AG5A 3T15A 3UCXA 1YR9A 1A9XB 3OT1A 3WLHA 5JXWA 1NX9A 3H2ZA 2P6PA 3W2IA 3ESBA 3AKEA 5EXPA 1QF7A 3FD8A 4PC1A 5JCXA 3MT0A 2FX5A 3FCEA 1K5GA 3PHHA 3HUEA 1AS0A 1IOWA 1DIRA 3CQDA 4XVUA 1WW3A 3RS7A 3SS9X 4BMYA 5JDIA 3E1GA 1SIBE 5B1IA 2Z8XA 1G9TA 2VA9A 4BMVA 2C2GA 1ZW6A 2WKRA 2ARKA 4LNHA 4EUMA 1KERA 3DQZA 1Z0IA 4KLRA 1EK6A 2EGGA 5FTNA 2P6RA 4FGKA 2BGKA 4NABA 4UUMA 5ESWA 2KBFA 5T8KC 4DIBA 2IGBA 3T9EA 2I22A 3GGGA 1KORA 1U2GC 1Y63A 4FUQA 4TMYA 3WP0A 4BFXA 1EFPA 4HNAA 5FJJA 1W2WB 1RJ9B 1AHIA 1T3GA 1AKWA 1DPGA 4JASB 4DANA 4B34A 1G20B 1T9BA 1LI5A 1L7AA 1YULA 5I7AA 3UF0A 1KOJA 4DLBA 2A9KA 4LY9A 4WZBA 4G5HA 4FE4A 4ETIA 2CXNA 2QTBA 1DSSG 1RDFA 1V1RA 3DB1A 3DM9B 4H1UA 5AOAA 1RPNA 3ESRA 2I91A 2FW6A 2ZUVA 4JR2A 4MV8A 4X20B 2XZOA 4H3KB 3GUVA 4N0PA 1DWUA 3W05A 4OHKA 4MUJA 2IHUA 5CX1B 4RD3A 1PHPA 3WJAA 4CUZA 5AFSA 5K8TA 4KADA 4AICA 3BA1A 2LXNA 1DJQA 3HBAA 2E49A 1BQ4A 1FU4A 1L7EA 1U8UA 2QRGA 3N39C 2XNHA 1IIBA 3GDFA 2FG5A 4X1IA 2JIZD 2OOSA 3GDHA 4C2BA 1ZUWA 2RB4A 3AEZA 4JELA 1NNEA 4YMTA 4EVRA 3TPFA 1XP5A 3THSA 4NL4H 2FWAA 1K4YA 2HCBA 1WM1A 3H1GA 4OQYA 4EYOA 1MJ5A 1RQNA 1V7QA 1VCIA 3E9YA 1CHNA 1DAGA 2C4MA 2GBLC 4IFEA 4LOIA 4MQBA 1NUUA 2I3AA 2UVPB 1XDGA 3LW7A 4OB8A 1ETUA 2J0EA 1R64A 3D5QA 4P3NA 3V1NA 3VAYA 2EKZA 1QRAA 4MWTA 5FB3A 3DLHA 4N5MA 4XGRA 3HV0A 1KEZA 1NQTA 4DMKA 4RW0A 4HC4A 2C92A 2G9VA 2YMLA 4I2VA 3FNQA 5WRFA 1KAQA 3CX6A 4YRSA 1R18A 1HURA 3LOQA 3JYPA 1KGSA 3SC4A 4HNVA 4NAUA 3A04A 3I9JA 4TYPA 5DFAA 4AKEA 4CV0A 3M89A 4IOJA 1ZGGA 1R15A 4KMOA 2A9JA 2WJGA 3PSAA 3QU9A 3PVCA 1GGEA 3T4XA 4XCXA 5IJXA 3D0QA 2DQKA 2HGSA 4B6FA 1OROA 3G5TA 3RSQA 1A72A 1QIDA 5KQMA 3D6HA 5KNBD 3V97A 1T91A 4O4LB 1AKRA 1PR5A 2I87A 1B74A 2X9NA 4N49A 5AH0A 2A57A 2VP5A 2WTNA 5AI5A 4KLNA 5A04A 4OJYA 5CU7A 4EFMA 3R1IA 1CF9A 3DE0X 4D81A 1FYWA 2B5VA 1JWLA 1QYDA 4TLEA 3H5VA 2H5LA 2JFFA 3DKKA 5C40A 4G0OA 3RQXA 4GUAA 2BMJA 2OXRA 4CKWA 4A8JA 4X6UA 3EVCA 3FLEA 4X5OA 3NKLA 2PMWB 4C21A 4YAOA 5F78A 3SN6A 2ZWMA 1T2DA 4MS1B 2C9CA 5EP1A 1RVDA 4PC7A 3NAGA 1Y9EA 5DLDA 1MN6A 2H7XA 3BMQB 1SR8A 5FI5A 5AKEA 4P31A 5EKTA 2CLOB 1Z36A 4MAMA 2P6NA 2Q4OA 4XLZA 5F2KA 3L1JA 4MQUA 4UW9A 2NVOA 5IHPA 1Z9BA 3B1YA 2D1SA 2UUAB 3K30A 1HNNA 1D7OA 5LDGA 4F1JA 2JGDA 1CDZA 4WZAB 2V55B 1IU9A 1W76A 2PD4A 2QORA 5IUKC 3ROXA 5I9LA 2J6BA 2NYUA 4E3ZA 2BD0A 3ZEIA 3C3WA 1JYFA 3PF8A 1U2DC 4L4RA 1LZLA 1SHUX 4MVXA 4OU4A 5ITWA 3H1AA 2AQHA 2JA2A 2X3YA 6LDHA 2PKXA 2JVKA 3QEKA 4C01A 3WSTA 1JQKA 1TADA 2W2PA 3C3BA 4NMLA 5K4AA 3RU2A 4KGXA 1QG6A 1L7NA 5KNDA 1U0HC 5IZCA 4ISCA 1KI2A 4I2NA 3ZE2B 4CMIB 2QT9A 4WN9A 4Y67A 1XZAA 3BCUA 4JMPA 3DMGA 4I4LA 1EWKA 1K6XA 1OREA 1Y3BE 2XDWA 3L93A 1P6XA 1PR3A 4GPTA 1QCZA 4MDHA 4IKEA 3B53X 5AW5A 3UEOA 1OH5A 2B9EA 4KE9A 1HT1E 4ZN6A 4A2PA 4BO1A 3TMAA 1WXWA 3O92A 4Z1MD 1LK7A 3DD1A 3ASZA 4CT5A 2CY0A 2GLUA 1J0BA 3FZGA 4ZPJA 2P75A 2JVJA 1I3NA 5ALRA 3NXSA 3WLKX 4CQMD 2C4NA 3QHAA 2H2FA 4P0TA 4W5NA 1KOLA 2CK3D 2QUIA 4PSUA 1PRYA 2CSXA 1LIJA 1EFTA 1JH9A 2DLDA 2WB2A 1ESDA 1Q1BA 4PFSA 2ZW9A 1K6MA 1JEOA 4V1CA 4L6CA 3SM3A 2I4NA 3GGDA 4QDXA 1E2UA 1XQ1A 2P9GA 5KYUB 5B53A 1VBFA 4JB3A 1UDXA 4W9RA 2J48A 1VMEA 2CL5A 1C8VB 3V7WA 3ZHCA 5HW0A 2GWHA 3Q88A 1KTIA 1F2TB 2BGIA 5J4VA 4U02A 1B8OA 2CDCA 2OP1A 1CY8A 1QOQB 2CXTA 3CX4A 1QKIA 3R6GA 4QPZA 4RC9A 1TZCA 2IYLD 2J9FB 3BJIC 4Z7QB 1YE5A 4GMKA 5CDFA 1JDBC 3U3RA 2H6EA 3WO0A 1QWSA 4AL4A 1SVOA 4WN9B 2Y3IA 3ROPA 4RSRA 3Q87B 1SVKA 2YWJA 3QE3A 2TECE 1BE0A 3EIWA 3MTDA 3LIPA 3PE3A 4Q12A 5TMPA 4FYJA 3EIFA 4C0WA 3TGLA 3B3GA 2OZLA 1KHTA 5C8XA 4GM0A 1UK8A 3BERA 4HDQB 5JYDA 2PPLA 2GPAA 1FP2A 1GSHA 5LBTA 1G38A 3D7KA 1N5RA 4ARAA 4OATA 1W0KD 3OJEA 5T7BA 1TA0A 1E2EA 1SVNA 1W6RA 3OM9A 1PV2A 1T1JA 4QJIA 3V8RA 3BRWD 2RGUA 4KAXA 1PV4A 5IM4A 2D62A 3TAHA 3EA5A 5J2TA 1EG7A 3T4PA 3PJGA 3HSSA 3QAIA 4M9ZA 5I9NA 4KBGA 4P4LA 2VAVA 3NKFA 5ES3A 4H4EA 1T29A 1U31A 4BB6A 2PAFA 2VSQA 4XEHA 2ZB2A 5CYGA 4Q4DA 2BDTA 5AT1A 1W5EA 1EINA 2L19A 2PS0A 3PNMA 3LC7O 4UEKA 5HJ2A 3ZX5A 2FSUA 1WBJB 6YASA 1BU8A 1MOQA 3EIOA 4PGAA 1GU1A 4RNCA 1YI1A 2W4QA 3K8OE 1EVYA 4M49A 4OLHA 4W6QA 2J0QA 4AJNA 3KVRA 2O57A 2QN2A 4AJOA 1N2OA 1KJNA 5KTTA 3FUUA 1CUCA 4R9RA 2PZAA 4RUKA 3PNKA 4WXPA 1TU0A 5HG0A 2XKBA 1FOEB 1X1QA 4M9UA 4XB1A 4L2IA 3ZHXA 5CCXA 3WHKA 2MSKA 5JXHA 2XZPA 1Z34A 1YZUA 5JYCA 3H9UA 4IHKA 4JOCA 2F3TA 1AUVA 1ZUHA 2NAFA 3NM1A 3A27A 3I09A 5BUQA 4ND3A 1DEAA 4X7MA 2J9RA 1AVTA 1S7CA 4BV2A 1UFRA 3CJQA 4PPNA 4P93A 2I2WA 1Y37A 1Z7YA 4I3GA 4OKIA 2AX4A 2VXYA 2ADFA 3CUWA 3KLBA 4TQAA 4XQCA 4FD2A 2R4UA 4ZOCA 5K3CA 1W47A 3STYA 1M74A 2C4TA 4L0CA 2QX9A 5CB6A 4AJJA 1H85A 2UUBB 2HRQA 3KD3A 3HJBA 4CL3A 4UBMA 2CNBA 2PT6A 1E3JA 2W6OA 4OGLA 3USZA 3BGKA 1NF3A 5IZ4A 2HZ7A 2YC2C 5JNUA 1YUMA 1TYAE 1AKEA 3FWNA 3NALA 1TMOA 1A04A 3R4VA 3QEBZ 4AMUA 2F4NA 1OXKB 1NBWB 1K2VN 4PPFA 3LWNA 4FZ5A 4Q3AA 1T15A 1Y4SA 5C2JB 1K7YA 3LQ2A 1NR5A 1U9IC 1CETA 1F2UB 2AR9A 4C0BA 2AC2A 4A10A 5CG1A 5KMGB 2C7OA 3HYSA 2C3MA 1OLSB 3LP8A 3EMDA 5D6NA 1SKUA 1KFBB 4LWPA 2QV7A 3N2LA 4OYHA 4S2EA 3LIIA 3E5NA 4O1LA 2FAXA 2ZROA 4YALA 2ZG6A 1GADO 2EBHX 3ELUA 1YMUA 5KYVA 3OD5A 4FE7A 1PWEA 3LX4A 4DR6B 2XJ9A 1SCQA 1NOKA 2HNKA 2KJQA 3RFUA 3AVUA 5DCYA 4HYYA 1ZESA 4PLCA 1QFMA 2NXNA 5AXDA 1KAMA 2YTZA 1TF7A 3O93A 4QUAA 3CLSD 3V4LA 5I51A 5J2UF 1N2IA 2EZ9A 3L8MA 3BXEA 4OH7A 10MHA 1QNFA 5FDFA 4D57A 4BWGA 2AOXA 3AETA 2NMVA 1KA9H 1YGJA 1XZJA 3B6IA 3UJ6A 4Y18A 4RK0A 1GRQA 1EE2A 2HLHA 2AFVA 1TU4A 2PZ8A 2BE9A 2XTNA 4MGIR 3OQ6A 4WRRA 3SE0A 1TL7C 2OAQ1 4AY3A 4EGSA 4M76B 1S4QA 1JBKA 1EQ2A 1KZGB 3EZXA 3L8FA 1R8QA 3G8DA 3K1YA 1VE5A 3PGMA 1TU3A 4G67A 4PS0A 4V3CA 3M70A 2BMVA 3HDQA 4FWBA 3WWPA 1CYEA 2EJTA 4ID9A 4RANA 2AFHB 1GUAA 4YH1A 3GMDA 2TSYB 4NMMA 3P97A 4MUFA 1O8CA 1L4BA 1MMFB 1ZD9A 1SC4A 3KKZA 2F1IA 1AE1A 4O8ZA 3UAGA 4N39A 3R44A 3TBKA 2WUWE 2LNDA 5F33A 3TSCA 1HE2A 1M2KA 1IEWA 4KR3A 3BK1A 4DCSA 4ZVTA 4EG4A 3TEMA 1JR3E 4MROA 5LZ2A 1OW3B 2ISSD 1ZMBA 3CVVA 1JI0A 4OLBA 2NP7A 3OAAD 1AKTA 4ZT2A 2QAJA 4EPXA 4OXXA 1CB7A 1NXWA 2J3EA 3MT8A 2RAUA 3O7MA 3Q5DA 1PTJC 3C6YA 5CNJA 5K2MA 4L74A 4GL2A 5JMTA 3MWDB 3KE8A 4EBFA 5L3SB 5F5LA 1MVNA 1L5QA 2LDBA 3JZDA 2O1XA 3E1KA 1Z6YA 3EBOA 3N0VA 4GZ3A 4LXHA 4QPJC 1EM8A 3UMOA 1O97C 1K8RA 1OFGA 2ZIVB 4IOMA 3JD3A 5J4YA 1Z7EA 2IDZA 1XFAA 1E2QA 2AWOA 1ZH0A 4U2GA 2VQSA 1U0LA 1BWSA 2PRIA 1T10A 1QIJA 2XOXA 4C1BA 2QE7A 4XM1A 4DNFA 4JZKA 5D1HA 5JAZA 2P1ZA 4FNGA 3RS2A 4J0FA 1XNHA 1HG1A 2QRHA 2HN9A 1KQFA 1PJ2A 2AJLI 4H0FA 3KZXA 1TRKA 4AP6A 4N08A 1CZKA 2QTMA 3OPNA 2ZS8A 2FUKA 1YB7A 3PB3A 4BXOA 1ORHA 4IUDS 4OHOA 1EUYA 1TGYA 5CIQA 4AJ4A 1OBFO 1Y8ZA 3V7FA 4REQB 3V1MA 1A50B 1TUEA 3TGPA 5BYDA 3IESA 2WAMA 1FDVA 1VFPA 1F5SA 2UKDA 1Y81A 2JA1A 1NJ6A 2HQSA 3AHGA 5JISA 4C89A 1R0KA 2BKLA 2HHHB 4MVJM 4PYQA 4DCVA 3SEZA 5IBRA 1ULAA 2FMFA 4TYQA 3H5AA 4GKVA 3TTWA 2EWMA 2ISCA 5KIAA 2CZCA 4UU8A 2HSDA 4OBEA 2HQQA 4YDRA 1HZZC 1IL0A 3V7YA 5B6IA 5AW0A 4AU1A 3VISA 3L6UA 2Q1XA 1MHTA 2I3DA 1C0PA 2FP4A 2R8OA 4PSAA 4XCQA 4C5KA 2FRDA 1KF0A 4FS8A 1DOAA 1YACA 4EFNA 1WPRA 5BN4A 1D04A 2FR8A 4NJEA 2XMZA 4BVEA 2VR1A 5CXQA 5J58A 3DVQX 4F2WA 4IWYA 2ZT6A 1XVAA 2QZ4A 5ALLA 5TQ0A 3T5DA 4MEBA 2JF0A 4FFVA 2RI6A 2BGLA 1XMSA 2LE0A 1JU4A 5IARA 1PWZA 3DMHA 3HB4X 5IAKA 1AIPA 2GRJA 1CVRA 1UZLA 3KQWA 4I4TB 1Y6ZA 1WU8A 2YNMD 3U60B 3HCDA 4P0PB 2QVZX 4NNOA 4F4IA 5LBUA 5EEHA 4B3DA 4EJ6A 3VX4A 4RHYA 2A9QA 3GDOA 5HJEA 5FFFA 4D4LA 1XHFA 4HAOA 1L4FA 3A3KA 5J3JA 1CBUA 2JLAA 2ZUTA 3TAUA 3DZGA 3SSNA 2HK7A 1DBRA 2VDRB 1P2BA 3UWMA 2C61A 4ZQHA 4BX3A 1OZGA 1UIRA 5FPQA 4OIMA 4MWSA 1OZAA 2JAOA 1SMKA 4XQ0A 1V96A 5F35A 1VMAA 1NMXA 1MFZA 2QJTA 2WJWA 4K6CA 4HNGA 5FFMA 4C7MA 5A1JA 3CB2A 5CB4B 2FPUA 2RC5A 2QXYA 5ALJA 1YB5A 4Z54A 3PHJA 4UTRA 1ZONA 2QAGB 3ABOB 2QVCA 2V9PA 4JHXA 3EGVA 3P71T 2XVAA 2XOKA 3U9TA 4JT2A 4ZU6X 3ZLTA 5KYXB 2DEUA 3IIIA 3SICE 3UJAA 3WL7A 1OPRA 2RGBA 1DEOA 1SCNE 2MYUA 3VNVA 1IPEA 1AMUA 3RF7A 2Z2KA 3UWOA 1SIOA 1ZK1A 2IA5A 1DQNA 2IP1A 3DDCA 3NQ41 1TK9A 4XQGA 5GPBA 3I3YA 1HLFA 3VC7A 2MIIA 1LBTA 2IDJA 1XJQA 3IEXA 5BVGB 3KIPA 1XK7A 1XTPA 1LX7A 3GHHA 4YP7A 3T54A 5BNZA 3AVOA 1SC9A 3R9WA 1EHYA 4ID3A 1LBHA 1Y1SA 4QBHA 2O0KA 3KSDO 1LLCA 1YOVB 5CVUA 4ER6A 2YX1A 3EFEA 4ZO4A 1G3UA 1KTVA 1BD3A 1LVHA 2X0IA 2H2IA 2BF7A 2XKAA 2PX4A 2O2IA 2RGYA 3P0JA 2NO6A 3DAFA 3VOAA 2GD6A 3LHKA 2QZPA 2GEFA 1A9QA 1TXGA 4CGZA 5HOQA 1CR1A 1N4AA 1CX9B 2JAUA 3HZZA 1NG1A 4HPXB 4JODA 4LBZA 1UXIA 4NRDA 2OECA 4OUKX 4DR5B 1KZ7B 1BDHA 2OFPA 3OC0A 2BEJA 2R1ZA 3UOWA 4OHPA 3OWOA 1HYQA 2WIJA 4ZVVA 2FMXA 3D6JA 4Y2PA 1Z8FA 1Q6YA 3PR1A 4MV0A 3O4RA 2PD6A 4OFZA 4YB8A 1PBNA 3WGOA 3B1NA 3KUUA 3U39A 1OFHA 5H4GA 4EY4A 1OBVA 3S2GA 4B6SA 4PSDA 4QBFA 4KXXA 2OB2A 5DWQA 4JROA 4J43A 4PEVA 1XRRA 4NAHA 1KE2A 3TE6A 3CEPB 3GRPA 3O1IC 1VL0A 1FRFS 4UXHA 4ZCIA 2FPPB 1YONA 1ZH4A 3QVOA 2FPMA 1U9YA 5LCXA 2B4TO 1KH1A 4H1TA 5JBQA 2WIAA 2AE2A 2XWSA 2G6BA 3H5TA 3HU1A 1P3DA 4L8GA 4LXTA 3GCXA 3S68A 2ZSIA 4HBGA 1JKMA 1A5AB 4ETWA 4M0MA 4H1VA 1MV8A 4CM5A 1M1YA 1MLDA 4HDNB 4X1IB 3WGIA 1KU0A 5TQ2B 1FGSA 5FX2A 1L4YA 3B1VA 4IUBS 1PR1A 2Q3LA 4RYDA 2VOJA 3GRKA 3OIGA 3ZWWA 4WY8A 2Z4SA 1Y4UA 2Z2JA 4XIYA 4DRXA 5K8UA 3DFIA 3S2FA 3O1JC 3CE6A 1ZD4A 4ZOLA 4ASUA 4S1PA 4LKOA 4QNNA 1O54A 2Y4OA 1O6CA 2GKGA 1F8GA 4UU7A 3KKQA 4WJZA 1UAAA 5HOEA 4IMJB 5BSGA 2Y1XA 5H81A 4D3DA 3TPCA 3GDWA 3ZV6A 1DC3A 3DL7A 1G8MA 2CDAA 4QWMA 4AM8A 4EHDA 3L7OA 4Z3KA 5MDHA 3L4JA 4X94A 2AI2A 3V1UA 4CCWA 1BH2A 4EF4A 2PN1A 3TQOA 2W9XA 4FWIB 1XFDA 2FA9A 3I2FA 2CMHA 5A7FA 1AY0A 1ABBA 4BMNA 1IBMB 1XDBA 3CRVA 1KQNA 2OV1A 1CQJA 2GT1A 3D8BA 4UMVA 2RSLA 3HQ4O 3CX8A 4MS3B 1E77A 1NFRA 4FMPA 3UQEA 2F2TA 5ALEA 1AZTA 4MUXA 3EEQA 5BORA 2BFAA 3GEBA 4F4CA 1U1FA 4HTFB 4WZZA 1OJLA 4HDNA 1QGED 2W71A 1RTKA 4K5QA 4GOKA 2RJOA 3PR2B 4F6LA 1VHLA 2IOYA 2Z5GA 2XMDA 1T34A 2GJSA 3AW8A 3K0FA 2VLBA 4RSMA 3TLCA 3B3FA 4B3BA 4DAEA 5E6RB 3RHSA 2WP8J 4UHJA 4YCAA 2VDPB 2J4FA 3C98A 1EXMA 2HMVA 1N1GA 3H4IA 2C00A 2Z57A 5I7HA 4UE2A 3H7IA 4M9RA 4QE3A 2VUHB 2MT9A 2Y0CA 4F91B 2XCRB 1N9KA 1BROA 1ULUA 3MLBA 4GWGA 2A1UA 2NSJA 2OV4A 3C8HA 4EVQA 3AEUA 5JY6A 1QK4A 2AOWA 1CFZA 1JUDA 3CNOA 3FG9A 1T8WA 3K73O 4KX5A 1P1CA 1WPXA 2CGEA 2CFCA 1JHVA 2FZKA 2JK1A 3GOQA 1HUQA 4JC4A 4JJGA 5IK2A 2AFBA 3FOAA 5G0UA 1S3SA 2PZLA 4J29A 2BBWA 1TW2A 3CXUA 2ZRKA 4LDJA 4LXIA 4EI2A 2C0PA 5CEJA 2ZJ0A 2R44A 1JLMA 1XCBA 1XV5A 4HAZA 3ZJUA 5C4GB 4M1KA 1ZH6A 1U0NA 4JLSA 3IH0A 4I50B 4FFNA 4QUDA 5FKJA 3F6BX 1XCMA 3TNDA 1F6DA 1H2ZA 4ZCTA 2R97A 5AW7A 5KSZA 2IYYA 4PZPA 3EZ9A 1YI0A 2VDJA 4RVDA 3P0IA 4JS0A 1BC5A 4M7WA 4N7BA 3NNDA 2IODA 1SD1A 1Y6RA 3KYIB 5B3AA 5T57A 4D8YA 1WVGA 2H29A 4L22A 4FBLA 4ZKDA 1H4QA 4AO8A 3FJYA 4ZQBA 1XF1A 1DPFA 1NBAA 4FGJA 5DMXA 5TNXA 5TVKA 2OESA 2LD4A 4LF8B 2XNDA 5C7YA 5MHTA 1DAFA 3DO6A 2MR5A 2I2AA 2QN3A 3EN0A 1GEGA 3KJGA 3ICEA 1DX6A 5ECYA 1KO5A 1E6KA 1N2HA 3B1PA 4Z99A 1CUIA 2GPWA 2QMHA 3IMKA 3LECA 3OESA 5EMHA 2YY6A 2B5OA 4PE5B 4YI3A 4URFA 1ZVJA 4DYVA 2WKSA 2FQYA 4B46A 4DM7A 2RARA 4I9FA 1ENZA 2ZQ5A 4QL3A 4F5YA 5IT0A 2GAJA 4H31A 4F3YA 4B74A 5CD1A 1KJ9A 4IDCA 5HMLA 1I6MA 3H0EA 4EUSA 9LDTA 3IMCA 4FCCA 3KVNA 3NTQA 5KWVA 5K9ZA 1KKLA 3JPWA 4KJXA 2ACKA 1DB3A 4RKQA 5AW8A 5HKKD 1O6ZA 4PYOA 2VRWA 1CQXA 1O03A 4QOGA 2QXUA 2UZ1A 3DJFA 4GZ6A 1LV7A 3B20A 4GEGA 5CA0B 4S12A 1Y6QA 1XTKA 1YQQA 3HCOA 3KOWA 4R54A 5DOZA 3RTEA 1BSVA 2RHBA 1XF9A 2XTAA 4D3YA 1MJGA 3NHKA 2O8CA 3UT0A 3D0KA 3L41A 3MTIA 3ZPXA 1KJWA 2QJRA 3OX3A 2J45A 3K4QA 1I2CA 3QJ5A 3TIVA 5KNBA 4QF5A 3OFVA 1KDRA 1TFRA 4LHSA 4KR2A 1VRCA 4KXLA 1ZGCA 3PDWA 3RGGA 3UWDA 1RHRA 4C1NA 1DT3A 3OLWA 2C58A 1BVUA 3CJTA 1RE0A 3CR8A 4JVNA 2RFLA 4HAXA 4UAGA 2HDWA 4MCIA 3V8BA 3VKFA 3Q5GA 4E31A 4URVR 5KWEA 1HA3A 1YL7A 2GJKA 2V54A 4KR0A 2WPNA 3A6LA 2P90A 5G4KA 3U3KA 2GUWA 8LDHA 1J22A 1Y0BA 1V3VA 2R8PA 3AKDA 4LMBA 1LXCA 5IXJA 4O4LA 2X9VA 4WLUA 3FHLA 3DFMA 3O3NB 1ZGAA 3V8VA 3G3EA 3AHIA 5LZ7A 3JQPA 1PW7A 1OLUB 4BPRA 4EY5A 1QH8A 1Y9AA 4DWOA 2VPPA 4QHSA 5K0GA 3OQHA 5CA0A 1V37A 1WOMA 4ZI7B 2GPTA 2NO1A 3CIFA 3LP6A 3HKDA 1T5HX 2C07A 3ZHUA 1JT2A 3M7IA 3AU8A 3E03A 3O2SB 4YRLA 1L9XA 2D59A 3N7AA 4AX8A 3MFQA 3N2EA 3Q8KA 2ZRLA 2YJ4A 3LF2A 1G3RA 1TLLA 3KP1A 4KODA 2DHQA 4B2YA 2E2WA 3GT0A 1GPKA 2A5GA 1YZQA 3L1IA 1QH0A 3LI2A 1YXMA 3DZKA 2D5AA 4KUGA 1JR2A 4XGKA 4OK6A 4RXTA 1RRPA 2ZYIA 3LPAA 4MQEB 3VPGA 3R3ZA 1VIYA 4PX9A 1DDIA 1E1YA 2OHHA 2WHYA 5IF3A 1FLNA 5FOWA 5KTSA 3I0ZA 1DCMA 1PTKA 2Q9AA 4U6SA 5AW3A 3D3KA 4OQQA 3AIKA 4RPCA 1Z22A 1Y80A 3JYOA 2ENWA 1QWOA 2I71A 3LRTA 3ML1A 3OEYA 5DYIA 4DILA 4RA6B 4Q3LA 3RAEC 3I3SR 1XU9A 2ZBVA 2DFDA 3AEYA 3IKMB 3AY3A 4Q19A 3ENVA 3DONA 3LFUA 4YQYA 2GUGA 3RBZA 4FX2A 4D79A 1U2QA 5K8IA 2WKPA 2RG7A 4IJUA 1OLUA 3GXOA 5C8YA 1Q0PA 3WJ2A 1DRWA 4LC1A 1DI0A 1PS0A 4A15A 3BL6A 2C59A 2NT4A 5C8ZA 1SXIA 1JYSA 2OLJA 1MRZA 1Q16A 1NTRA 2ZE5A 1W85A 4Y6GB 2FFBA 4N12A 4QSHA 1RKVA 4FILA 1OCEA 1YZVA 2YDXA 3A10A 3SYTA 5LLSA 4B8YA 5SZKB 5EAIA 4EH1A 5KHOC 1QE0A 4JT4A 3IT1A 3TL6A 3AB8A 1VYUA 2JGDB 3WMEA 3UK2A 1Y7PA 3LSYA 5GMOA 1DKOA 1E59A 1GTVA 3B3QA 3E3LA 3SZUA 5ITZB 5KKNB 1SCJA 2YWHA 2GKOA 2F59A 3RROA 4D26A 3MBHA 1MENA 1XMIA 1B00A 3K9FC 1TMKA 2CFOA 4UDOA 2ZRBA 1XLTA 2V7WA 5DSXA 3ESDA 2E18A 3F7OA 3B13B 3GRVA 3CG0A 4HB0A 3QM1A 4YV0A 2G9QA 2BGWA 4BQSA 3RVRA 4EJ0A 4QC2A 5G3ZA 4ENSA 2Q9BA 3DBLB 3K6SA 5T4HA 4UPDA 3DMPA 1CUZA 2I54A 4C5BA 2HM7A 2ECPA 3FB4A 1KK3A 5F77A 4BVLA 3GLTA 1OT3A 3MJVA 5AJYA 1PHRA 3ET5A 3QUTA 1JHMA 4B6GA 3JAMA 1U4OA 2M1ZA 3B1JA 3JQ9C 3NDIA 3NC9A 3GV0A 1W4ZA 1WLSA 1ZYUA 3TYXA 3D8SA 3CN7A 2Q2OA 4NCJA 1PNOA 2BLLA 4TWJA 4EY7A 4ZYUA 4YDQA 2XCIA 1NXOA 3IBSA 4U9IS 2AXEA 2IZ5A 3GI1A 4JR0A 4NOMA 1CQPA 2WSYB 2B98A 2ZCUA 2G82A 2VF2A 4Q16A 5JI3E 3AF4A 3F5SA 3H97A 1O7JA 1ZRMA 3GFFA 2XAUA 4TRRA 5KOJA 4EEKA 1QLHA 4X64B 1EE9A 4ZCMA 3PIDA 4NNPA 3NL2A 3UB4A 2WSSA 3NM4A 3T7RA 3E61A 1EWTA 3FPGA 5KVAA 2IRWA 1BXRB 3SZGA 4YJDA 4TSFD 1RTTA 1YKSA 3QWHA 2NYAA 4P5DA 3C5VA 1XVTA 4RKRA 1YFLA 3V7NA 1RXVA 1KRWA 1ZK0A 2D1FA 4PHCA 3TLAA 4L5AA 1T6XA 3LRPA 1WXDA 4JYAB 2Q2QA 3KL4A 2VZEA 2AUNA 3ZTYA 1H22A 2H57A 3ZZ0A 1TCAA 4BP1A 5AK3A 3IQWA 1OGYA 1RWOA 2QN8A 3C3XA 2H1VA 3MK31 3PQCA 4ZVKA 5B57C 2HGZA 4BZZA 1J7JA 3L8GA 1HI9A 1K06A 1NMEA 5DYNA 1IN4A 1Y5LA 2I66A 2WEKA 3JQEA 5CDYA 3Q5EA 1DGMA 4JP1A 4ACBA 2FXVA 4D3FA 3OO0A 4TV8B 2OE2A 4WFJA 1RQ7A 1HEIA 2UXCB 4QUHA 1Q5PA 5EP2A 2WC1A 5CYOA 2F7SA 3K2IA 4BZWA 3U40A 2M6RA 1NZDA 3BD8A 2JANA 4XASA 2QYOA 3O8NA 3S27A 4MGEA 4PTYA 1AS2A 3TIGA 4D9MA 3AJEA 3SLGA 1BA2A 3PEEA 5DNWA 3C4JA 1R6XA 4MULA 1TTTA 3VASA 2C4HA 4ROTA 4Q9NA 1P8JA 2W6CX 1B73A 3R5TA 4G1FA 1JR3D 7REQA 4JYCA 4RX1A 4EX7A 1OBHA 3DVAB 1CUEA 2HXSA 4X7PA 4ER3A 4RK7A 5C1OA 2FQWA 2H2DA 4GKBA 3OPYB 2R7MA 3DL2A 5IW8A 3I6YA 5KWJA 1WEHA 1R0WA 2R79A 3DBLA 4MGHA 5DV9A 2FR8C 4EPRA 1JEYA 4R3NA 1C1YA 2QN1A 2W2LA 5IJ0A 1ZHFA 4L8FA 5E2AA 1YB2A 2FXIA 1WMFA 5H0IA 2X4GA 3CUUA 4II3A 5DKFA 7YASA 1XRMA 3DXFA 3CKKA 4BCDA 3IQDB 3O2JA 1E63A 1XMVA 5HBRA 4JSTA 4M86A 4IDBA 3KOXA 3PT9A 2GCEA 1Y9DA 4C06A 5AHRA 4FD3A 3PP8A 3WL6A 4Q9KA 4O2AF 1ZJ5A 1PDOA 3OHMA 4QUIA 4NAVA 2CZGA 4J3FA 4NULA 2RK6A 4Z5XA 2EFDB 3D64A 5KOJB 2PMKA 1L5MA 2B69A 1EK2A 3DKVA 3EF1A 3ONWA 4LMPA 4HH0A 1O1YA 3SMQA 1ZI8A 5DBFA 5ALNA 3RVPA 5JEDA 3IEKA 3QPVA 3TOCA 5HTOA 2O3RA 3FHCB 1Z12A 3TVTA 1KAEA 3KDSE 4X0EA 4HWGA 5HJ5A 4AG6A 4EZIA 1QR2A 5HJ7A 3VAAA 2W6MA 2XEXA 1P75A 1ZD2P 3PFBA 4EY8A 2KSQA 4BMOB 3CUYA 3ZQUA 3H0CA 3S8YA 2H2HA 4E5YA 1UM8A 1QGUB 2A9ZA 5IAGA 2QEQA 1LSJA 4JMLA 1O4VA 2C2XA 4KRGA 3A11A 1OPXA 2NPIA 1Y8AA 2ZFUA 3B82A 4L28A 4F0JA 4EHHA 3IHLA 2GCIA 5DBEX 4O4HB 1NVKA 4HQKA 3BJRA 3RRXA 2BI4A 4ZTUB 2QD3A 4MMYB 1BHQ1 3PGLA 2RK4A 4H17A 3VDRA 1A8IA 2OBYA 1BEZA 1QONA 4XPIA 4H6WA 4RGYA 4YMLA 1KPHA 2ZZKA 4MLPA 5JT1A 3K3PA 4DLYA 3SF8B 3B1QA 3P9KA 5B58C 2ZYGA 3EGXB 3QWBA 5C41A 1RABA 2XRYA 2XQGA 2HPAA 4AYTA 2P30A 3EPHA 2XUDA 3HJGA 3CLSC 2REBA 2R11A 5G0TA 1AGRA 1BMFA 4YHHB 3PUWA 2HRCA 4A6EA 5DGDA 4CCAA 3V4FA 2XMPA 2CYBA 4DUZB 1X8KA 3HCRA 4H7DA 3U49A 3IXMA 2WM9B 4WDQA 3WHIA 5JI2E 1H65A 1E9SA 1HGXA 2AMYA 2QXTA 3NHBA 2FOIA 2GCNA 3AY7A 1K63A 2K87A 4JN6B 4DA0A 5H82A 1KDOA 3FPSA 3VNSA 5A6SB 4V1CI 1RQXA 2HBZA 3BEOA 4Y2XA 2XYGA 1GZ4A 1XXHE 3ONDA