3RSFA

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima in complex with p1,p4-di(adenosine-5') tetraphosphate
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
490
structure length
490
Chain Sequence
HMKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Putative uncharacterized protein
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 178
structure length 490
sequence length 490
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rsfA01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3rsfA02
3UMOA 2V78A 3B1PA 3N1CA 3RQXA 4E84A 1V1BA 2R3BA 1RKDA 3LKIA 1RFVA 3IKHA 4KADA 1JZTA 3UQEA 4K9IA 4K93A 2I6AA 5EYNA 3MBJA 4LC4A 3ROGA 3GO6A 5CGEA 4JKUA 3K9EA 3RTEA 3RSQA 2DDMA 3Q1YA 1WYEA 5C40A 2I6BA 4O1LA 1GQTA 5BYFA 1RFTA 2PKKA 5BYDA 3PZSA 4N08A 2NWHA 3RQ8A 1YGKA 3NBWA 1LIIA 5TRWA 3NL3A 3RTCA 3B1NA 3NCAA 4JKSA 2F02A 3IBQA 3W4SA 4C5JA 3ROZA 3RQ2A 1RKSA 5EY7A 2DCNA 4E69A 2A9ZA 1C3QA 2AWDA 3HYOA 3CQDA 3IN1A 3NC9A 3RT7A 3RRFA 4XF6A 3RQQA 4C5KA 2FV7A 3KZHA 3IH0A 3LOOA 3PL2A 4KAHA 2C4EA 4YL5A 2HW1A 3RTDA 3GBUA 5C3YA 1RFUA 1VM7A 3OTXA 5COJA 3RQHA 2A9YA 1EKKA 2VARA 4DU5A 3ROXA 2PKFA 3BGKA 3I3YA 1V19A 5BYCA 4LBGA 3ROEA 2AJRA 1YHJA 3UQ6A 3FHXA 4WJMA 4GM6A 3NL5A 2O8NA 4K8CA 3RQ6A 3RRJA 1V1SA 3UMPA 3RSGA 4S1IB 2JGVA 3RTBA 4YWRA 4E8ZA 1UA4A 3RS8A 2HQQA 3NM3A 3RY7A 4XCKA 5CGAA 1LIKA 1KYHA 3RM5A 1UB0A 1U2XA 1BX4A 4JJPA 3NM1A 5TQIA 3VASA 2ABQA 2AJPA 4DC3A 2DDOA 4K9CA 3LJSA 2I5BA 1RK2A 3RTAA 3JULA 3KD6A 4N09A 4E8WA 3B1RA 2RBCA 3DRWA 4XF7A 3RPHA 4EN4A 4E3AA 3RTGA 4LCAA 1LIOA 1YGJA 2ABSA 4KANA 3K5WA 1ESJA 3RPZA 4S1IA 2Q5RA 4XDAA 4EUMA 4U7XA 3ZS7A 3LHXA 3IE7A 3HICA 1TZ6A 4K8KA 1JXIA 2YXTA 3KTNA 2XTBA 3H74A 3KEUA 1TZ3A 3RNOA 3DZVA 5CM5A 4KALA 4KBEA 3UQDA 1LHRA 3B1OA 2AB8A 3D3KA 4X8FA 4B8RA 3MBHA 4E8YA 4B8SA 3RRBA 4EBUA 1JXHA 1VK4A 4UBEA 3H49A 4PVVA 3BF5A 5BYEA 2R3EA 2DG2A 2JG5A 2QHPA 3VAQA 5C3ZA 4S1MA 3RO4A 5B6AA 4K8PA 2PKMA 3RREA 1TD2A 2PKNA 5C41A 4K8TA 2QCVA 1GC5A 3EWMA 4EOHA 3RU3A 5F0ZA 4LBXA 3D3JA 2AX3A 1TYYA 3RT9A 2YXUA 5F11A 3NL6A 3RSFA 4C5LA 1VI9A 2AFBA 2JG1A 3HPDA 2DDWA 3GO7A 4S1HA 2AA0A 3FHYA 3UBOA 2HLZA 3RQ5A 1LIJA 3NL2A 3UQ9A 3RS9A 2C49A 3QA2A 3RO7A 3B1QA 3IQ0A 1L2LA 3NC2A 3B3LA 3Q92A 3QAIA 3RSSA 1EKQA 1ESQA 3RU2A 1DGMA 1RKAA 1LHPA 4O1GA 4C5NA 4C5MA 2F7KA 1V1AA 3NBVA
chains in the Genus database with same CATH superfamily
5LZ7A 1MAVA 3H0KA 4KODA 4MGHA 5ALPA 2CD7A 2O2CA 2YWCA 1LBEA 4Q9JA 1H8ED 4YMGA 1FJGB 4FEAA 5IYZB 1KI6A 1T3TA 4K9IA 1L4UA 5JNRA 5IH7A 1EQAA 5C7YA 4HHEA 5IJWA 3OZEA 4Q1EA 4ZQGA 3VTAA 4NXNB 3AJDA 2HOQA 4OHRA 1DCTA 4CI0B 2CXNA 5ALUA 5KHOC 1VPTA 4UBMA 4X45A 5TF4A 5JDCC 2GAAA 4KMSA 5ANRB 4OP2A 1C30B 5DF1A 5BN3A 1BN7A 4MJ7A 2GLTA 4OO3A 1G38A 2XUZA 2NTJA 5F9MA 2RARA 2UXBB 2G09A 2NNLD 1XB2A 2BM9A 3CLSD 3DLPX 5SY6A 2P78A 2RHLA 4PLVA 5G41A 1CBUA 1HYQA 1NNSA 3EUWA 4MW0A 1N6OA 3SS9X 2I99A 3W4KA 1XZDA 4PIMA 1IWBB 4YJHA 5F1KA 3GGPA 4LXHA 1PFKA 2D0PB 4Q01A 3KPVA 3B52X 2O05A 2BLLA 3B36A 3FETA 3BREA 2VJMB 4QT4A 4TYNA 3D8UA 2NU6A 4R3NA 4DZRA 1XZBA 1LTKA 4UARA 4XVRA 2ZSKA 1DAIA 3ZZ1A 3V42A 4HEA1 1LQUA 1Z5VA 3NBXX 3PA8A 4MWBA 3I9MA 5A02A 3NL5A 1DKUA 2WM2A 4YCCA 2YNMC 4R8KA 4PC6A 3O2JA 5EFZA 2VH5R 4M53A 2OOSA 4EKYA 3MGGA 4K0KB 2IHBA 2QY9A 3GMTA 4O1IA 1PZGA 5DW3A 3ZE1B 2AW3A 2Q9CA 4KE8A 4Q37A 5HS6A 3ZHUA 1JFLA 4ITVA 5C2JB 4HDMA 5K0NA 5K0GA 3A3KA 3D1JA 2CL0X 1KBOA 3IAS6 4S1PA 1QG0A 1ZRSA 3U37A 1JNXX 4JOBA 3OD1A 1RK2A 2DLDA 2ZVJA 3LFHA 5K7SA 3TLBA 2JIPA 2OAQ1 3PNOA 4IX1A 5IJAA 4RSMA 5E0KB 4EHJA 4BCDA 5IC4A 2XVYA 3KEOA 1WVMA 1EGHA 1XP5A 3L06A 1HRKA 5TT1A 4TLBA 2B2NA 3PUIA 3NHUA 1CRQA 1F3OA 1H2AS 2EGGA 1TYEB 2RB4A 3DGEC 2NZ8A 4UTZA 4XM2A 4BLTA 2B8TA 2CMGA 2IZ6A 4YUAA 1I1HA 3MBOA 4PBSA 3LG2A 4PLHA 1F0KA 2XTZA 1CUWA 3U1BA 5G3YA 1H2WA 1LS6A 1Q77A 4PPYA 2FSVA 2XCLA 3NALA 2BJWA 5AKHA 3SP1A 5EXDA 5EJ5A 5JZVA 4ZVPA 4W5QA 1E0DA 4MYUA 2BMDA 4RTQA 4QYIB 3U4GA 1ZHOA 4Z7OB 1U3DA 2SBTA 5B6AA 1O95D 1UXKA 2F8LA 4HWKA 3HVKA 2VOSA 3R0XA 2PXXA 3L02A 3PUHA 4K81B 2ZR7A 3LHKA 5FTNA 1GRCA 2R85A 2EX0A 3LOUA 3NTRA 5JG7A 5J4VA 4NHOA 3ZDEA 5F11A 3AB7A 4AY4A 3DR3A 1H3NA 2R0QC 5EAIA 4OHVA 3C87A 3MWDA 5H16A 2DHQA 2ZTHA 1XF1A 1W25A 3UQYS 4JLDA 1TQ4A 4YS6A 3STWA 1M2JA 3HJUA 3CPEA 1HTBA 4IUBS 4KAFA 2ZSAA 4BMCA 3P8ZA 1ES9A 3VNBA 3R3ZA 5AP9A 4BO5A 5KNDD 4CV1A 5JT1A 1X92A 2AN4A 4FOSA 4DTIA 2ONJA 2Z09A 1KK0A 1M6EX 4MYCA 2OXFA 1Q57A 1KQNA 5CDGA 3R8CA 1U7HA 5BSFA 3JTEA 1QCDA 5DGDA 3NETA 2ZT5A 3OJFA 4ER7A 3V7YA 4F4UA 1WW8A 1A9YA 3OKAA 1O5IA 1YZHA 4IKOA 1EP3B 1U9JA 1RXYA 2DX7A 4HXFB 4A2WA 3QLUC 3P9SA 1AGXA 4TGLA 4B2YA 3K8QA 3JYQA 1MZVA 2A0XA 4RQTA 4D9FA 3HP1A 5CW1A 1PDWA 1NXWA 4MPRA 5ICMA 1NIPA 4M4SA 5DX0A 4YCJA 4YJDA 4RFLA 3RSHA 4B6JA 2JGDB 3QVMA 3ED1A 4FIDA 4PZCA 4ZMRA 2H6EA 1OA0A 3SYLA 1SCKA 3ESCA 2EWVA 1HA3A 2GHQA 121PA 1A7KA 2N9UA 3A58B 3AZPA 4UHEA 3VHLB 4CI9A 4YRBA 1JFFB 2HA2A 3VOAA 4BX2A 5EE9A 3HC7A 3C15C 3TLYA 3CUSA 1WSBA 3KQKA 3ONNA 1NF3A 1P1KA 3I37X 2X0JA 1KEVA 3GBUA 1CR6A 4FXOA 9ABPA 1JGTA 5AVUA 1C1HA 2XT9A 1OH6A 2XIJA 2PKFA 1K4MA 3GZNB 1GILA 1T2VA 1SNYA 3DDWA 1Z2EA 2V3WA 4JR0A 4PZ9A 3TBFA 4NZ9A 3TNDA 1T2DA 4JL8A 1TUGA 4PFSA 2QN1A 4KGDA 1XVUA 2OB1A 1SXJB 1ZM4A 1OGYA 3JD2A 1NJ2A 5TY0A 2VYQA 5JCXA 4NCAA 4YWRA 3TL3A 4PZAA 3KB2A 4WXPA 2ZWOA 2DJ5A 3GLTA 3B89A 4CFSA 1ECBA 1UJMA 4ITRC 1QQ5A 3VPSA 2X9QA 3AEKA 3B8EA 4NPAA 4DMUB 1SOMA 1WX1A 1UMDA 3DBRB 2XZDA 5DASA 5ED0A 3PUZA 3ZWVA 3K8YA 1YA4A 2ZTMA 1GNTA 3AVQA 5BN4A 3J81A 3QRWA 1V6AA 2GEJA 1U31A 3F47A 3GIDA 1YR1A 2BHRA 1QYVA 3FPFA 2XUGA 3U5ZB 4JMPA 3R76A 2KBEA 1AVTA 1YS4A 1VBNA 1W85A 2P62A 1U0JA 4I3GA 4BLPA 3FY4A 4RK5A 3UMFA 5IK2D 3GT0A 1X42A 3MM4A 4KI7A 3I23A 2TMDA 4FYWA 4HOYA 4OM8A 4ENVA 5MFPA 3QSYA 2HWXA 5A4MS 4XWOA 4B6FA 2MCFA 2GZHA 3FVVA 3VH1A 3Q15C 3SEFA 5JEDA 3RYFB 4NYMR 4Z8XA 4M3NA 1NVTA 1OX4A 4IKPA 4XTCS 4CJXA 3A7EA 1R66A 5DGCA 1ACLA 1NBMA 1X6VA 5DEOA 3IRVA 5FPHA 4CQLA 3BF7A 4O2BA 1ISFA 5L6LB 4PLCA 3WMEA 4ASUA 2I78A 3AY7A 3DVAB 4C06A 5A9SA 1XKTA 3IBYA 4EPRA 4F5DA 2DWCA 2AJLI 2DQ4A 4ZHQB 3Q85A 1GZ4A 2GDZA 3QWIA 4BL5A 3D7KA 3RIHA 8ATCA 1IXRC 1ODKA 4GPBA 2PRSA 2FN7A 3DC7A 4UUAA 1EFUA 4AYTA 2DDWA 3FHYA 1LB1B 1J0EA 1GRNA 4PAOA 1BMFD 1YUMA 2VAMA 1KEKA 2XVAA 1J07A 4MO2A 1HMPA 5DDIP 2VDPB 5EEHA 4ZD6A 5JD3A 1SIUA 1J4AA 2CXPA 2WTZA 2ZB7A 3IB6A 4LI3X 3W5VA 1X7GA 1XCMA 2RG1A 5DYGA 1LLFA 3ZZNA 1HE5A 1ZP6A 2HD4A 4BJ1A 2F9FA 2AFIE 3PDJA 2WD8A 4ZZ0A 1X0VA 2L0XA 5CLIA 3MIZA 5B58T 4PZDA 3KEQA 4OHXA 2FW7A 5AKZA 2ZWPA 4TTTS 3KALA 4CIWA 3NTQA 2AZDA 2JFOA 3E2PA 4CMEC 4FW8A 3ZCTA 4Q16A 3HY6A 1JMYA 1D2NA 1LW6E 3GP3A 4HF7A 4RA6B 2ZK7A 1N0UA 4G8JA 5L8VA 1ATZA 5BYDA 5ALSA 4Z9FA 1D4AA 1KZ6A 1XHLA 2F1RA 4EG6A 5TLSA 4UBJA 4FGKA 2C7VA 3D2LA 1GM5A 4BXOA 3L79A 1QOZA 5CAEA 1EX7A 1VPLA 3V7NA 5DHTA 1IDOA 4AF6A 3FGZA 1OQAA 4GOLD 4C0JA 3UK0A 3GJ8A 1P61B 1HF3A 4GDMA 2AM1A 3DQPA 3RQQA 1UFQA 1XNRB 4HQLA 4EWLA 3O82A 2LD4A 2XQFA 3GBPA 4XFDA 3RFTA 4YV0A 3UV3A 2HW8A 4RFSB 4XVQA 4QULA 4CVLA 5JEEA 5LM3A 2AMFA 2ZVPX 3I9NA 1H6BA 3L46A 4QQKA 2M6LA 3W4JA 1PSWA 3E53A 3T5MA 5C1OA 3TZHA 3ZIUA 2I6GA 3C7KA 3MYRA 1TADA 4H3VA 4ZVMA 4AW9A 4FFLA 1P6XA 5EC8A 4KKXB 1F8FA 4D4GA 2N3ZA 2NZWA 4U0JA 1EWKA 1I2CA 3OWHA 2KYRA 4LDQA 4CQMA 3LWNA 4M1KA 1V11A 2VNKA 2VT3A 3R74A 3SLRA 1EZ4A 3RIXA 5B6PA 4JGGA 1OFTA 1UIMA 3KOMA 4N48A 2PD3A 4ZV9A 3WYCA 3IQDB 1NF2A 1CS4C 3RTAA 4W9NA 2G07A 4U2EA 1V6SA 2O0KA 4DLVA 3UGKA 4BYMA 1XZEA 5E6SB 3UUWA 2IJGX 3EBLA 3R8FA 2HT6A 3SXPA 1JQEA 2C0CA 3NUZA 1Y9EA 2XVXA 2RAVA 3AHIA 3PNQA 2Y71A 4TYQA 5K6RA 1E77A 2YC2C 4KPGA 2OFPA 4OHOA 1TJ3A 5EKDA 1G5PA 3R4CA 4UAUA 4AC9A 3GEIA 4ETIA 1XZFA 2B92A 5FTJA 2BZ1A 1BW9B 2C9YA 4WXYB 5LA6A 3D8RA 2JLAA 2NU7A 4WASA 1AV7A 2JCSA 3OZUA 2ZIEA 3LVRE 1JLMA 1CUFA 5KI6A 3V9PA 3R5JA 1GDDA 4ENUA 4RW0A 1AXRA 2ZDQA 2JG5A 4HYQA 4Q03A 4ZODA 1ZA1A 4KYUA 3LBIA 5KZMB 3EZ9A 2HJWA 2VWPA 2X9GA 4ZVUA 2DB3A 3ORYA 1QFJA 3V8QA 1DNPA 3DHEA 4ZFNA 3PQ4A 3G7UA 1CJMA 1N9KA 3THXB 2FEKA 4HYEA 3UYLA 3WKEA 3P4YA 1N2SA 2IELA 2Q5EA 2ZI4A 1CYEA 3QW4B 2G71A 1DDIA 1HDOA 3MFQA 4KK4A 5JASA 3BXOA 1WEKA 2J3EA 4ER6A 1XALA 2OHVA 3BD9A 4Q39A 4WOJA 1MW9X 4MINA 3CVWA 2RKOA 4WDRA 3SM3A 2MINA 1Z4NA 3AVXA 4QWMA 2ZBGA 4I36A 2XUKA 2SICE 5DCUA 2OCBA 2IYSA 4MW5A 2FAXA 3DA8A 4EITA 3CH7A 5LKAA 2FSVC 5T57A 2KLBA 3MUFA 3RBZA 2X7XA 1R6DA 4A8PA 4OPMA 4RJLA 4E5NA 3GWZA 4FDTA 4QGBA 4EW3A 3OX2A 3VYRB 2GEKA 5FIUA 3UG6A 4JI8B 1G5HA 1OBVA 1OUMA 2A5JA 2QUZA 2A4MA 4RZIA 5DBGA 3KEMA 1LA2A 1PR2A 2EAUA 3CYFA 5AVQA 2FI1A 3JCZA 1EIWA 3CZ5A 1AQYA 1QKIA 1Y8QA 2QX6A 4HDSA 4MTCA 4QX6A 4R2KA 5HDQA 4BNNA 3P9CA 1GQQA 3N53A 2WHPA 1J49A 1DBQA 4E1BA 1K8ZB 1SVKA 2K6GA 3QWFA 4DM7A 5LBIA 4MS1A 3SNHA 2EWWA 3WIEA 4CEJA 1A5ZA 1M2WA 3N2YA 5IJ0A 4UD6A 4QUEA 3BFVA 3H6GA 4MPJA 5EXTA 1WUIS 3FRJA 3THSA 2VDJA 1RJ9A 4GX0A 5F1OA 5K51A 1UMCA 2V0NA 1ID1A 4K9LA 4QVGA 4W82A 1ZI8A 3BORA 4DWWA 1ZHHA 1U2PA 1X1DA 1HDXA 3FSGA 2WWIA 1GGHA 2RHHA 2BC9A 2NZ2A 4HZIA 3PKIA 2O52A 3H5OA 5BV1A 5ALFA 4GEGA 3BUSA 2BTOA 3WV4A 1R9GA 1P4RA 4AKTA 4FE3A 3NVMB 4V0NA 5DM1A 1LD3A 1OAOA 2QAIA 2J0SA 2V6GA 3RVKA 2C8LA 5JSYA 2DH5A 3EGXA 1PAUA 3HBFA 4WCDA 2WT8A 4MNTA 4E2YA 1U1IA 4BX8A 3MRTA 1XTPA 2Q4DA 3G59A 4TTAA 2C9DA 4O2BF 5CK4A 4DKXA 1FRNA 1W19A 2GKOA 1ISJA 3CEAA 4X3OA 5KJFA 4WX2B 4TYPA 3I0ZA 4ZVRA 1USVA 2JNWA 4I4TA 3RASA 1HYBA 1ZVMA 3CSSA 2W6MA 4ZN6A 4B17A 2QPOA 2VRCD 3RSCA 4EY8A 4QXMA 4F91B 1A9QA 4YRIA 1WHSA 3OZTA 4B43A 4PXAA 1KJ9A 2IDKA 2ZSUA 4INOA 4D1YA 5EUCA 2JBHA 3KTNA 3NT4A 4HMOA 3CLTC 3F4LA 4QU9A 1KEPA 1OJ7A 3WJ1A 1KVUA 3RVDA 1XVIA 1ZUNB 4D79A 5I9SA 3O73A 2YMMA 3B12A 2Y66A 2HSZA 3U9SA 2FK7A 4BGEA 2RD2A 1UOPA 3KWJA 1RWOA 3JQ8A 2WMOB 5AKIA 2EZ4A 3Q3IA 5DGHA 3W78A 4AJ1A 1HKHA 4C6RA 4OL9A 1G291 3CR3C 4FQ7A 2OLKA 3WMXA 3AEUA 2ENWA 3W8NA 5D8DA 4AKSA 4Y2GA 1I33A 1VA4A 2OILA 2V7BA 2H9IA 1UR5A 3C8MA 5ULLA 3BXZA 4BFYA 5FBRB 1M34B 1PS8A 1NBME 2OGZA 1H42A 3NPAA 2VT2A 3HE3A 5IT0A 4MRSA 2J33A 1QQTA 3NATA 4NJOA 2V7XA 3KOUA 1X1CA 3JATA 4AP9A 4ZAZA 4F12A 2HI0A 2JB9A 2ZRHA 3K0CA 4GR4A 1JQDA 1CZNA 4MDHA 1PQWA 3ICWA 1FVFA 2CDCA 3DS8A 3L8YA 3L0BA 4EG7A 1RHUA 1WSWA 1AG9A 2H2AA 2P9TA 3OMLA 4PIVA 3WGJA 2ZQ5A 4GH5A 5FUBA 5UKDA 4D6XA 2ZBRA 3CXUA 1YHNA 2ICAA 4N40A 4FQ5A 5TEWA 3RVBA 3ZY6A 1C9NA 2PY6A 1M2KA 2IY7A 4E84A 2IL1A 5GJCA 3UAYA 3W6UA 1E3WB 1IZ7A 1L3CA 1RC8A 3LKIA 2HXYA 1MF7A 5AW1A 3D4IA 1XZJA 3ZK9A 2Z2JA 5K8UA 1ZU4A 1HT2E 2ILTA 8LDHA 3O90A 5KTTA 1LI5A 3SYRA 2P8JA 5MN6A 3MERA 3HBAA 3I1FA 1LJLA 1DQSA 3DC2A 4I08A 4TYYA 1CUUA 1OT5A 4KDFA 2ATCA 2ZJ8A 4RD6A 5AD1A 4CMIB 1YGKA 5K20A 1DCKA 1YQTA 2JHFA 3ZXXA 2C9BA 5B7PA 2ZW9A 3FDJA 4LF8B 2DECA 4PNHA 4EA6A 5E9AA 1NV9A 2EW2A 1UEXC 2H4JA 4QEKA 1G59A 1E2LA 4PSUA 2JPDA 4CCYA 3HM2A 4B7XA 4RIFA 1C8KA 2P75A 5CCEA 3OJLA 2FV7A 4Z8YA 2ZYAA 1E92A 2B3DA 3ANYB 4Q4LA 4KFTA 5C0OE 3ZNPA 2GCAA 1YB2A 4L16A 1E8CA 4WZAA 3RT1A 3W9UA 4UPDA 4XLZA 4DU5A 3V46A 2XTJA 4QXAA 4Y2UA 2VOEA 3RUHA 1VHTA 5KYYB 3G9XA 3OTGA 4GS5A 2QVGA 2FXVA 2X8LA 1W52X 3E9QA 5LA6F 1DIOB 1OI2A 2FPWA 1C7IA 1W93A 2C5HA 5I9BA 1E79A 3V4RA 1T1SA 1JF8A 3CRMA 4WKCA 1PV2A 4EI7A 5CIYA 2ZUEA 5DIZA 3F3SA 1EFPA 1KDZA 2HPHA 2JGMA 2QTGA 4M87A 5IXSA 2JFXA 1KPGA 1MX5A 2Q4BA 2C3MA 2L42A 3L1VA 3AUUA 1U63A 4KKVA 3SFTA 1M1YA 4KMRA 3UQZA 4Z7JA 9LDBA 2PTGA 2LBPA 3FF1A 3RF7A 3W5CA 1JPVA 1D8AA 3IMGA 4JNCA 1T8PA 5GQSA 1EK2A 1VC2A 4FMDF 4RA9B 5FRDA 1WY7A 4Q6BA 1S8FA 1DPFA 3GT3A 4DJTA 2SNIE 5JNSA 1T35A 2L18A 3HUFA 4J29A 3NG1A 3PE4A 5NULA 3IBFA 1JKJA 2C7RA 5E4FA 1JA1A 3SN6A 2HO5A 5B1SA 3B1WA 1O77A 3GO4A 3IUJA 1NU6A 4MWCA 1TFRA 4D4KA 1P4JA 5HGXA 1DWQA 4C7OA 1Y42X 1R27A 2UV8A 3DNFA 1NQOA 1AQ6A 2XE8A 2ZIWB 3D7SA 3HJGA 4XIJA 5AI8A 5EHZA 3JAKB 1U2TA 5TMBA 2AZ4A 3EF3A 4L5JA 3MIIA 1DU4A 3DBLA 3Q10A 4JB3A 1RADA 1IBCA 4W9NC 4X20A 2V9PA 3OJOA 4IJUA 4LBYA 1MD9A 4YC7A 3CJRA 3HXQA 2A1IA 1JYSA 1UPXA 2FWRA 3LI2A 3DPUA 4OQEA 4YDHB 1NQ5A 5KU7A 1UBRS 3LWDA 2PZEA 1NI4A 3BX1A 4CVNA 4YRKA 3GFFA 3KZVA 1NLZA 4XR4A 4DF3A 3OUTA 5DYIA 2VUTA 4OQXA 4D5EA 3H11B 2HBZA 2QQGA 1CF2O 3ETNA 1ESZA 2DQZA 3KOXA 3LQQA 4MKHA 4QEZA 3VGJA 4CL0A 3ASUA 3EXG2 4H6VA 3ZU3A 5L7TA 1LXCA 5AJWA 3NBVA 4OAPA 3MD9A 5JISA 1A98A 1P5ZB 3F6PA 2H2IA 4X44A 4A73A 2H07A 4JYCA 1R0KA 1P3DA 2REQA 5T4EA 1TRKA 1XE3A 1XTKA 4HY3A 4R9NA 3I8SA 3UTDA 2XOKA 5H9WA 5DNYB 4UOEA 5KTYA 2HPVA 2P7HA 2VDRB 2XCOA 4HEA6 4LYYA 4CT4B 5IKEA 1CRLA 2JEYA 2X8WA 3Q11A 1L5HA 3ZGNA 3DMTA 3I8OA 4D3DA 4KP7A 2DHDA 1PNQA 3QE2A 1TU4A 1EQUA 2JJ1A 1W35A 2QN9A 2ERYA 1N1MA 1NLUA 5JVDB 4F6CA 3A2KA 4S3MA 1Z7BA 3DFZA 4K2AA 5IARA 5TVGA 2GD2A 2YWXA 3G2LA 5JBQA 2O2GA 1Y6ZA 1JG1A 1D5CA 1G2QA 4I4TF 1U3CA 1VHQA 1IOLA 1SIBE 1XKXA 1NI5A 1CSEE 3FNHA 3KOOA 4CM4B 3PGJA 3L92A 3L5KA 1OVMA 3D4LA 3KAQA 1U2EA 2A1UB 1HYEA 4GM0A 1E1NA 4R31A 1EGMB 1VIVA 2PZBA 1JXAA 3K9BA 4A0SA 1CYDA 5GVSA 1JHVA 3A9UA 4LNHA 4O2LA 3ZKWA 2FPUA 5AICA 2QP3A 5GZ3A 4IY1A 3DULA 4GR5A 1W34A 2W4MA 1V1SA 4BWFB 4Y1EA 3L4KA 1ZXXA 2GXQA 3WO1A 4KSBA 1XTJA 3F49S 1K0FA 5CDYA 4XLTA 1XCOA 3NHFA 3T3NA 3AF5A 2D1RA 3GRVA 3E9ZA 3KXDA 4Y2XA 5EMMA 1XRSB 4BMXA 4TTQA 1EXMA 1ML4A 2RKBA 1AE1A 3EZ6A 3NAGA 2YRWA 3UMCA 1TZ2A 2ALJA 4KFSA 2C99A 3DWIA 3I62A 3BRWD 4UQOA 4B0PA 1VXRA 2DQSA 3M6MD 4EHBA 1L4BA 4ACBA 1DJOA 2J9FA 1T4DA 1OAOC 5BWLA 1TF7A 3B1VA 2IHKA 2WUFA 3PQ3A 3NASA 4QDUA 3WYFA 1NDHA 4Y6QA 5L4NA 3OPYB 5FXMA 5HTOA 2D5IA 3HGMA 1RWBA 3FI0A 3TAHA 1CF9A 1TK2A 3NBKA 3O3OB 4YNBA 5FL7A 3HG7A 2PS1A 5K8JB 1RJGA 3JARA 3CKKA 4B6OA 1QIMA 2O5RA 1OHHD 4BWVA 3ND9A 2VJKA 4PINA 5CPBA 5FUMA 2C3YA 4ZJZA 4H1VA 3KCQA 4GNRA 5F5NA 3DFFA 3VVCA 3FDXA 3FTQA 4R8VA 5CNJA 4GI2A 5AXAA 2XQIA 2CVPA 3DTNA 1MO3A 1RNLA 4GBMA 4G0OA 3SSNA 2GEBA 5AK4A 4RVHA 4K03A 2RHRA 1J25A 2H4WA 3LT5A 4V03A 1NMXA 2REOA 2OUIA 3OCZA 2OO5C 2NTNA 3FF4A 4XFJA 1B41A 1KL7A 2X6QA 5DHPA 3BWYA 4M9SA 1JDSA 2OBNA 2YZNA 3AV3A 3GPCA 3INGA 3COZA 3CX6A 5E8JA 3ZY4A 4WGGA 4FN5A 2HJRA 3C8DA 4F8YA 3UPUA 1OR8A 3I1IA 4ND3A 4XJVA 5E3JA 1NP3A 4W8GA 1KDOA 4IDEA 3DFIA 3W3AD 2H9YA 3EFOB 3AFNA 5IHXA 3TG8A 1M8PA 2XNCA 3MJEA 3OQBA 4YI5A 1N5RA 1K7XB 3EMDA 1K66A 4XLLA 4YRLA 2ZFUA 4YLYA 4LYDA 4TV8A 3TGWA 2JHGA 5A5FA 1NVWQ 3AKZA 1J2YA 1QGED 3KSUA 5L7WA 4GZLA 4F7WA 2DY0A 1G16A 1L5MA 2TMKA 3HB9A 1UKEA 1XEWX 1Y8RB 4CM9A 1OX6A 1RWMA 5DLQC 2I62A 4QVIA 1Z63A 3BHNA 5I6DA 3AFMA 4LDAA 1GZ5A 3WKCA 1QV6A 4B3SB 1KPHA 1A7JA 3OECA 2V4ZA 5JHGB 3KQTA 4REMA 4YWJA 2MSKA 4EY4A 2XB4A 3U61B 2JD2A 1L6IA 4Q66C 1FQOA 4U00A 1WKVA 4UZEA 4B3GA 1F4PA 3ZD9A 1NF9A 2C94A 5AUOB 3Q8XB 2R60A 1VL5A 2JJ2A 2ZSHA 1Y3DE 4HJXA 4YLEA 1S4MA 3QE9Y 2OFWA 4YMTA 2PGDA 4I0WB 3K6SA 2GBCA 2J0VA 3IT1A 1DXHA 4JFAA 4YIHA 5ADVA 1OWLA 4D26A 3PJRA 2PX8A 1JU3A 4IRMA 3SXJA 4A6PA 2YN0A 2BD0A 3CW9A 1DC3A 1SBCA 2XB8A 2ZIXB 3FE2A 2OXEA 3H18A 3QE4A 1C0IA 1ODLA 4PZZA 1Y4DE 4Q3KA 4WZAE 3IVMA 4G0VA 3PIDA 2GN8A 5AKGA 2B78A 2VAXA 4ARZA 3UXYA 2NT4A 5L3QA 3C3PA 5C32A 3K92A 4PCUA 3T5GA 1OX5A 3D1LA 5L9AA 2I87A 3O31A 4DTCA 3NAMA 3HZOA 5EOVA 4I50A 2QR5A 5JPIA 1EJBA 2IIVA 3ELWA 4NF2A 3QOFA 3OY7A 2WJYA 5SV2A 1DKOA 3NHLA 4U2FA 1W49A 4EG3A 5H3HA 3FLEA 1UXJA 1QIJA 2P2CA 4GXRA 3IP5A 2ZCVA 3LUGA 5HVNA 1JWLA 2I1WA 4KPFC 4BAZA 3CVYA 4K8KA 4TTJA 3HKBB 3I6YA 4TOIA 2IE8A 2QN6A 2YIJA 3PKZA 3T3IA 2Y1LA 4B44A 2V8BA 5J2UB 4P3KA 3TVTA 1NQVA 2V7UA 2WWRA 4G4IA 3EY9A 4LJ4A 5AI5A 4YUXA 3WS7A 1FVHA 3N2NA 4R54A 4OCZA 4DM4A 2UZ0A 1EWYA 2X5OA 4OHFA 1I2AA 5IULC 2GC5A 1GOTA 3WBJA 1RCTE 2NNWB 2G25A 2IP4A 2FSSA 4Q3CA 3U60B 2OXIA 3M5CA 3ZV7A 4C4PA 3SJ7A 3ITEA 2D1YA 3UV6A 4ZYYA 5K0TA 4N8DA 1M1NA 1TM3E 4B4DA 1NM5C 3TLAA 1IUPA 2O20A 3HY3A 4PXYA 1CUCA 4CEIB 1P80A 1JU4A 4HXYA 4PZ0A 4DJ5X 4PS1A 4YY3B 1RWNA 6YASA 3L05A 5BVHA 1TCBA 4LZJA 1QXSA 1JXOA 2V4UA 3PIRA 2ANCA 1ENYA 1O54A 2LR0A 4G5XA 3OZWA 4UXJA 2A67A 5IFLA 2VWHA 5EVCA 1GPWB 3AW8A 1FDWA 2D2EA 4FE7A 1TJ4A 1PR9A 4UASA 1Q0PA 1QHGA 1Z6XA 3M3HA 3HCPA 4MLDA 1Z82A 2WTNA 3CEPB 4N39A 3W8EA 4LJ8A 1NVBA 4WLVA 2BJVA 2I9PA 1MB0A 1PZXA 2AFRA 2F9MA 2ZIVB 3FWKA 4I9NA 2B82A 4TT3A 5GWXA 3BIXA 1JE0A 2OCLA 2JLWA 1DO0A 1X7ZA 3PL1A 4QBTA 1X80A 1JZTA 1NE7A 2VR1A 3GLKA 3K2IA 1W4LA 4HNAA 1UBNA 2C31A 2CDNA 2W37A 3E5RA 4HH1A 3S29A 5C1IA 5C4IA 4NVRA 3B6ZA 3OH8A 1LH0A 2NYVA 3TXYA 2NZJA 4HNVA 4Z0TA 4OHYA 4IIYA 4O1LA 3OFSA 5BURA 3ZGOA 5BNTA 3ET4A 3O94A 1RQLA 5I5EA 2PR7A 2NG1A 3A1NA 3LUKA 1XK6A 2XYHA 3LM8A 4C29A 5A71A 2YZKA 1RKXA 1A04A 4M54A 3EUEA 1IBKB 4C5JA 1OWNA 1GL3A 3AH8A 4UNQA 5ALNA 1WIWA 3TCXB 1U8TA 4I1YA 4HG2A 1TW2A 3EDMA 4MHTA 3OZ7A 2Q3DA 1F20A 4BQEA 3FUTA 3FYDA 2HA6A 2ODBA 2ZRFA 4DSOA 4LMAA 2NYAA 3EPRA 4BKQA 1M33A 4EH1A 2IEAA 1J8QA 1S2DA 4Q19A 3DO8A 5I9MA 4D4HA 5JS8A 2UUAB 1JKMA 3CE6A 3K05A 1J99A 4BFTA 5LZ9A 1CCWA 3EFBA 1XMQB 2C1ZA 5F77A 3QVGB 1SBHA 4MWDA 2HK9A 4UMFA 3L41A 4EHLA 3DMTC 2XXAB 3KXIA 3FSRA 1NVKA 2AZMA 1R0SA 3LDUA 2I3ZA 3CLHA 3EOAI 2ZGVA 4QHYA 5SZHB 3GH3A 1MN6A 2AJPA 1E1RD 3U4AA 1S89A 2IZ7A 4RHCA 4Q00A 1RQ2A 2ZYHA 4GLFA 4HYTA 4L5IA 3TRIA 3K0BA 3VSBA 1FUUA 2VCYA 2IUYA 4R98A 5FTWA 5IT9A 1RC1A 2PUCA 2HV8A 3BHJA 5FV7A 2PAAA 5H81A 1NA5A 2O0MA 2OGSA 4D25A 4KQCA 4FZJA 2BEWA 2LP4Y 2P9HA 4XUDA 1Q3HA 1DC5A 4K3UA 1EGVB 1FYEA 4KVZA 4QBGB 2WYIA 2X4DA 4C1BA 4F2WA 5LPNA 2IP2A 1KR2A 2FF5A 3LF1A 3TUJC 1C0LA 1J22A 1AO3A 4PGFA 3EGDB 1TQHA 1VZ3A 1SU6A 3AEQA 3QWBA 5DULA 2WIDA 1RBZA 2G36A 1ABEA 4YJ3B 1KAOA 2VDOB 1UM8A 3HA3A 5J58A 3GT7A 5H0IA 4Q3BA 1XTQA 2NZYA 1U98A 4TRMA 1B2RA 1IOZA 4NCJA 4OEHA 5LLTA 1XR3A 4QYXA 2FF7A 4QC2A 5DB4A 5EE1A 4CKEA 4X00A 2IXGA 4MVJD 4TV8F 2VTVA 1KFBB 4QBKA 1V9CA 1S02A 4TTPA 1B76A 5CT4A 3D8HA 3WSWA 1RLIA 2IYYA 4EKIA 1UDCA 5IUNC 4KNWA 4WD3A 4YYZA 2WB2A 5LZ5A 1JPUA 1UT5A 2QK4A 1A9OA 2NUTA 3TRDA 1GUDA 3CGGA 5BSUA 4JU8A 4EO4A 2CYCA 2C20A 1TD9A 5DTRA 2NTYC 3Q7PA 3V97A 3LOPA 2QM3A 3OI7A 1H9BA 4GOXA 2H85A 2L19A 2YV4A 1JHZA 1UBEA 2FEMA 3HM9A 5LUAA 3FWHA 4GYYA 2C2OA 3WJ2A 1KA9H 1K4YA 4XEHA 3UUFA 521PA 5LVAA 3IUYA 2E5LB 4KAJA 2FPGA 3CLUD 3OT1A 2ZUBA 3R2JA 2JAQA 4B1FA 4L8WB 3RBVA 5JY6A 3K0SA 1EEXB 1NT4A 2G76A 1FFAA 1UBHS 4RS4A 1J42A 4GPIB 1GNSA 4PC2A 4Q18A 3SWWA 1RFTA 1FTYA 2YXEA 3FWNA 2YUIA 1E1KA 2R1VA 4R01A 5SYNA 3IA7A 1ZBDA 3N2EA 3ZR4B 1WU7A 1B0PA 5TF0A 1V9SA 4EOGA 4HH0A 1UAAA 1FYVA 4I50F 5CA1A 2JJQA 3KQMA 4NARA 2Y1CA 3NJRA 2QM7A 3P45A 2O2DA 4Q05A 2C2ZA 3RRFA 3ZK8A 5BYKA 2AOTA 4K9NA 3GH1A 4ZTBA 5ABPA 1IEVA 2KI5A 4HNSA 4IL5A 3H5RA 4CTOA 4EF4A 1NRIA 2PJZA 2A5YB 3O4FA 4KTVE 4W7HA 2PUTA 3P9NA 4OLHA 5AIBA 4I4CA 1J7JA 3BKWA 1HNNA 3GLHA 4D2IA 3AESA 1VLHA 2XLCA 2XR1A 4C6HA 4OKSA 4EABA 1Q2XA 2LCFA 2Y2VA 3DSRA 1E9BA 4EJ6A 4QKQA 2W2LD 5AESA 5KWVA 3GXOA 2ZM6B 5AJTA 4WRRA 2C42A 4BO9A 2PUEA 1PEYA 2ID7A 3AL0C 2RI6A 4YP6A 4ABTA 2A9JA 5HZKA 1HG0A 2C5SA 4HWGA 4ZK2A 2PWYA 3EC2A 3MLAA 2AC4A 1DDOA 4IG9A 4BNKA 3DVLA 3IDAA 4ND7A 3G9ZA 4R9UC 3M82A 2EJCA 2VQEB 1EVLA 3OU7A 2W2PA 4H77A 4US0R 3NYIA 2BCGY 2F3SA 4GGMX 4AN4A 1HK7A 1LSSA 4N03A 1BVYF 3EA4A 3IO3A 5BUZA 3UYKA 2FZWA 4JC0A 4P4LA 1BDJA 1W73A 1ZOSA 3U7EB 4DFDA 2PVCA 3TH5A 4MUFA 2KQUA 2Q46A 1W1IA 3H74A 2DYKA 4V38A 1GL7A 4GM4A 1D6SA 2HMYB 3FHCB 4PPNA 4Z7QB 3OX4A 2O2YA 2VWGA 5K01A 3LFTA 1MIOB 2I76A 1Q92A 1XMPA 4S1VA 3T0GA 4KSCA 3ZD7A 2GAFA 4KBFA 1SCAA 1QGZA 4X9XA 1I9CA 2XE6A 1E3TA 1E3DA 3OOWA 1N6HA 1T43A 3TFWA 3BMOB 1FSFA 2FFQA 3DO6A 4QQFA 4URYR 3RUPA 2YJ4A 5C5IA 3I5YA 1TL7C 1LRLA 2VAPA 1E5DA 3AIIA 5K3AA 2QXTA 3OO0A 4NNJA 4ZJUA 4ZA2A 1GHTA 1U0RA 1Z8FA 4A16A 5BRAA 1QH8A 4KX5A 2OZEA 2ACWA 4QARA 1XJ0A 2ZYIA 4PVDA 2GCOA 1UXHA 1KTVA 5FHRA 4H3KB 4DQ0A 4YJ2A 2XCSB 4HTFB 5EFOA 3L93A 3TB6A 3C98A 2Y1WA 1QC5A 3CEJA 2I3BA 2O8EA 1TKBA 4QTUB 1H2EA 5K0LA 4FFWA 2VFAA 4A03A 3QAIA 1XZMA 2Y67A 2HFKA 2QD3A 2X3YA 4URZR 5JC1A 2JIOA 3O74A 1ISSA 3VZQA 2QBYB 3JQ6A 4H1WA 1EBFA 3V1YA 2VSOA 3H19A 4EJ0A 5KNDA 2R3BA 3NIGB 4C08A 2WNIA 3HI6A 3NJ8A 3RVLA 2FRXA 1OPRA 2WMNB 2R6HA 2ZU6A 2JHAA 1JHQA 2ZETA 1W30A 2HHCA 4X91A 2HJSA 3L8GA 4YP7A 5PNTA 4ZMBA 3DMPA 1YAJA 3S2IA 5IJZA 1VBKA 4NL4H 5LWQA 2KJQA 2W2MA 3IVAA 1T5BA 2LPMA 3S8EA 1LW7A 3EMBA 2ZIAA 1WCWA 4JLPA 3THYA 1K97A 1ZDMA 3A25A 2ZJ5A 5BYFA 3ETLA 3PNBA 3T61A 4BNVA 5HIAA 3E7DA 4WBXC 3JAMA 1W4RA 1G18A 2F3TA 2RAFA 3NB0A 1Y6RA 4I55B 4FEYA 3BZWA 1S2IA 1E66A 4JXXA 2RAUA 5AW2A 1H23A 2DCNA 3BGVA 5H3CA 3S8YA 1VJ5A 1WZNA 4UUPA 3TW0A 1U1CA 2FDRA 4YL5A 1QX3A 1QWSA 1XOIA 4H0NA 4HT3B 1GGKA 2PSJA 3M34A 4K9DA 1U0LA 3KUXA 4OHKA 4A0FA 3KP1A 4KOEC 1B1CA 1K9SA 3O2QB 4GI7A 4PAMA 4S0ZA 2YOGA 1NW8A 4W5HA 3RF6A 2WPNA 1MC8A 3JD1A 3GCDA 3VRHA 1IK4A 2E6KA 4HCJA 3CM0A 5E9JA 3FVQA 1SKYE 3A9RA 1YC5A 1W8IA 3GZTB 4GPEA 4KGXA 2HKIA 2QUIA 4QT0A 1KMMA 3N39C 1YR6A 4CDGA 1QPBA 3WLLA 1VLLA 2JCGA 3GCXA 4LSGA 3ZVNA 3P19A 3EK2A 4KOAA 2JLVA 1N2EA 3A2LA 3A27A 5KPDA 3FUCA 4LDPA 4XDGA 1PUIA 3S4YA 5JH7A 4MYHA 2GZRA 1Z83A 3N6XA 1SCNE 4W5WA 1BWRA 1Q7GA 1WL8A 4UCQA 2OWEA 3G2IA 4IDBA 3E1KA 4ZEOA 4P31A 3STXA 4LF6B 3SJCA 3DHVA 4RCZA 2J09A 1EU1A 4PYIA 1NJ6A 3ELYA 1G63A 3PR2B 5DT2A 2QU8A 3DE4X 1CR4A 4EJSC 4O3MA 3MB8A 5IK2A 5JCPA 1US8A 3M4XA 3UKJA 3AVTA 2VATA 1T3LA 1XA3A 3QVSA 5ENZA 3HKEB 2OYSA 3MZ0A 4QDZA 4WLFA 3BGOS 4W7IA 1CEEA 1I4LD 1FNSA 1E5LA 1RLMA 3F1LA 4GMXA 4YFVA 1G20A 4G1MB 2IOYA 3NHRA 2R96A 4G0UA 3DFKA 1X7DA 4IICA 5JQGB 3Q8WA 4FYKA 1M0SA 3QEMA 3CZCA 2C78A 1II8A 1EFLA 2JFHA 3I73A 1ORVA 4G5HA 5HG0A 5DTIA 1ZAKA 2IEIA 2QTVA 4P98A 2AF4C 3H9BA 2OBXA 4QDJA 2F3QA 2VDWA 3D0RA 4MP8A 1P9WA 5CA1F 1C3LA 5EUMA 4M1EA 2ECFA 1U2SA 1Z0UA 3JQBA 4LF4B 3TD6A 3N6RA 3GGOA 4C3UA 1BXRB 3CUUA 1BMFA 1P0CA 2E4AA 2MTBA 4Y1RB 3RODA 4EHHA 4F6RA 2J0QA 1UJBA 2G9UA 1WAMA 3UA3A 2JLCA 1X19A 1NN0A 2V7GA 3I01M 5EJ6A 4MCAA 4DUZB 1CDZA 2O3SA 3PRKE 3M6LA 1F6BA 2RGBA 4L95C 1F2TA 3B7GA 2BCEA 4RVDA 4X7RA 4B85A 4Q1DA 1X74A 2W8BB 4X6YA 2VBFA 4Y9DA 5AHOA 2VK8A 3CX7A 5DV9A 1K86A 2AI3A 1PGNA 2YMLA 1A2QA 3L6RA 4TN1A 2XB9A 3ENVA 1FP6A 3F71A 4N6GA 3D8NA 4BFLA 2VSFA 1J06A 3HDYA 5HQTA 4JLMA 4LX0A 3HVHA 3IIJA 5AMXA 5IBRA 4MV5A 1M2OB 1YZVA 1KMHA 2WMYA 1WF6A 3QVOA 2I4RA 2J3IA 3D5TA 3GJZA 5IZCA 3TEMA 2UXDB 1KEWA 1A7AA 3DD1A 3GJ7A 3QOYA 4I19A 3HU3A 3QBVA 4NZZA 3DXFA 4YALA 3W2IA 2VH1A 1COWD 3AVPA 3G49A 1LF5A 1D7AA 3L4SO 1NY6A 4CL2A 4NMLA 1PEKE 4IJQA 4QSMA 4B2IA 2GTPA 2I2DA 3ABQB 3GUYA 4FXPA 1M8GA 5BRJA 5HDBB 1N5JA 2VP2A 4RMGA 5DTJA 1HXHA 5F33A 5J2TA 5KX5A 3U3JA 2MWMA 1XSEA 1QGAA 1P75A 1QOPB 1TVKA 4JC5A 2NO1A 4TTVA 5FQNA 5BWBA 5JWHA 3H1PA 4KHZA 1E7RA 4E12A 1BYIA 2UZ4A 1EUCA 1AK2A 3GLHE 3M89A 4C0SA 1C0KA 3ZIAD 2F1HA 2OK8A 4YJ2F 1QHIA 4J1TA 5A04A 3B6EA 3CH6A 5EYPA 1BCRB 3HR8A 1XZCA 4MKGA 1BXZA 2HRZA 3FBWA 3QPWA 3T9DA 1LK5A 4OXRA 4RENA 1L4GA 5JZOA 5B4TA 2QGZA 2FWAA 3BZBA 2G70A 4MR8A 1OXXK 1TO1E 4HQOA 1VHDA 3IVCA 4PNEA 1UC5B 3WGQA 5CH5A 2JAWA 4HZGA 1RYBA 1P1CA 1R4AA 5ENVA 5B3JA 4UCWA 1UKCA 4AIIA 2CYBA 2AN1A 2FW9A 5AXDA 4CWAA 2WYVA 3IALA 1CIJA 3UXEA 1E6WA 2QD2A 4LV5B 5D01A 3O4RA 3ULKA 2UYYA 2VCEA 3H3JA 5KDLA 2J41A 5KYWB 2AMYA 1PUJA 1NF8A 2JEZA 4HX5A 1JSCA 2AFHA 2A88A 1G1MA 3DKIA 4BUCA 2GFIA 4DLNA 5FOUA 4OKIA 2J07A 3B9QA 2QRLA 5IPFA 1POXA 3BMCB 1ISMA 3HP7A 1QH9A 1YOVB 4KH1A 3OPNA 2X1HA 4KXQA 2DLCX 2W93A 5LD2B 4NEQA 3H4VA 2Q2QA 3H2GA 5DLYA 3KG2A 1VBMA 1JJVA 3PNVA 4HUJA 2QDKA 2YZMA 2NPIA 3H2KA 4HRVA 3QWHA 4KGZA 2BBTA 1Y1SA 4UTRA 1KJZA 1AO0A 4BQPA 3H2BA 1UP7A 3N8HA 2GO7A 3QNUA 1Z36A 4I1IA 1EKQA 1SWVA 1KQPA 2P9QA 1FFGA 5JSHA 5FHQA 3ZHTA 2M2IA 4UATA 3LJKA 1DQPA 2WU3A 1W75A 1QOQB 3O26A 4MWSA 3SR0A 1X7XB 2MOKA 5IANA 3VBCA 1IBSA 4Q3LA 3MT9A 3KNZA 3IKTA 2NMVA 3GJRA 3WHLA 2VAVA 5T8KA 1NUQA 2PA0A 3QGMA 1M9NA 4DVGA 1ADBA 2O2IA 4OLJA 1FDIA 1GQTA 1YHZA 4MUMA 2LCQA 2Z2IA 3GD5A 2G72A 3G3EA 3AP1A 3T5DA 3VUEA 2P0EA 3ZHXA 4M0FA 3ST7A 4E31A 2DPHA 4XX0A 4KRXA 4MA4A 4B3XA 4C7KA 2EOAA 3SYKA 4ZQBA 3ROZA 1J0CA 1CW2B 3TI7A 5LBUA 2P30A 1RM4A 5JH7F 3DTTA 1X39A 1KETA 3NVKI 1CY1A 1IVYA 1C4KA 1K6JA 2ROQA 2XGGA 3IOCA 4GZ3A 1V7ZA 3W79A 1KE2A 1NHGA 1ZUD1 3FRHA 1KMIY 1WCIA 2K5UA 3D8SA 3AUJB 3U9TA 2EX4A 5D87A 4EZIA 4DR3B 1KJWA 2QNIA 3H16A 3C97A 3CNEA 3EF0A 3JU3A 2EL9A 1D2MA 3DHWC 1SQFA 3MVEA 4Q15A 4J1NA 3HY4A 4MRRA 4V2IA 2I4MA 1DT3A 1P1JA 4UNIA 4EPXA 5DIFA 5CXSA 3M6FA 4Q7KA 3D6HA 5DXJA 2JBAA 2R86A 2E49A 1NR5A 1UP6A 2DFKB 3WLAA 2DUWA 4GZ6A 3AJ9A 1JI3A 3CNNA 2HF9A 3AUSA 4PSKA 4C22A 3IEMA 1GZ3A 1KEUA 4QWWA 3E70C 4TSFD 3ZE2B 4DRYA 1RPZA 4XGRA 2XGJA 3C7AA 5FEMA 3PYZA 3HBNA 1VYTA 1OE0A 2VCHA 2X8AA 3I9JA 5FT9A 4MLCA 3TL2A 5KHAA 4V24A 1NJ8A 4B8ZA 2YZ7A 4C7VA 2ZUTA 3FMGA 2WTAA 2AE1A 4NESA 4RPLA 5E7MA 1JEQA 4CZ2A 1UMBA 4PWZA 5J43A 1FPMA 4FHDA 1A69A 1IJFA 2RCNA 5KSPA 2VRCA 4IVNA 5DE3A 2V7QD 2JFPA 2YMPA 4G1CA 5E1OA 2PNJA 1CZHA 1U2DA 4WHMA 5FLEX 1B2LA 3FNIA 1DRKA 4KQ6A 1RQGA 2CUZA 4HYYA 2IK8A 2F62A 2VL7A 4HUQA 1KWKA 1L7XA 3VPXA 1NW4A 1U7UA 2FJ0A 4Y6OA 4WNCA 1HNWB 2OGUA 3OM1A 3OPQA 4URFA 4M8LA 5BYEA 4DADA 2Z95A 3OZIA 3K9HA 1ZW6A 3O1IC 2ODEA 1PJQA 2BISA 1X8KA 2ZB3A 1GQ2A 1ZAYA 3STTA 4EMBA 3IAXA 2WJGA 4DB2A 4E2ZA 3VH4A 4WFQA 1NYQA 2I4LA 2QQFA 4QYMA 4S24A 3P52A 5EJFA 1DC4A 2WVHA 3A6LA 3HPDA 4NG5A 3VPDA 3UOGA 3MAAC 1T4BA 3AFOA 5JRDS 2G5CA 1ZQ1A 4B33A 4RNDB 1P0MA 1HTWA 1L5LA 4EW1A 1GTRA 1QP7A 1G20E 3BL6A 4PC7A 3T9CA 3NL2A 3I1JA 4FHCA 3TSCA 1K5PA 3C0KA 4RDCA 3HGTA 4WKPA 3RO7A 2X0IA 3UWPA 1I5OA 1I14A 4MVJI 2BKUA 3D64A 2JI9A 2J59A 1ZFNA 5H7XA 2F43A 1IIBA 4NRDA 5A4AA 3DH0A 4YREA 3N1CA 3A10A 5K8LA 2DFVA 4FFSA 1VI5A 2QRHA 5KAMA 1I9GA 3F5MA 2OVFA 4RK0A 1DX6A 1MX1A 2XMBA 2WDPA 2XYQA 1VRWA 1A50B 1TF2A 2E3JA 1H4TA 2RC5A 3AWIA 3E9MA 4N8SA 4URWR 1NPYA 1NKVA 5ESRA 3QXXA 3T7JA 1PJCA 1WB4A 1VMDA 2AS0A 1UBKS 4B46A 2PKXA 4EZBA 3Q8MA 2UVPB 5J2TF 5KX5F 3HL0A 4QTZA 5DCYA 1ZL2A 4NFYA 2O1WA 1ZIOA 3AM3A 3NNDA 2Q9BA 4KR9A 4DV6B 4Z4GA 1ZIPA 4HQRA 4DQKA 2BHTA 1S1CA 1UEIA 5F1PA 1TO6A 2I7CA 4MS4B 3JQBC 1FTQA 5CNIA 1B3RA 1JEEA 4DT1B 4TWZA 3NJ4A 3S2UA 5AW5A 3OX3A 1N2JA 2NP7A 1OIWA 1UDRA 4EYOA 3U6KA 2DWPA 1S9DA 5C8XA 1GTL1 1N5OX 1EFVA 4C3VA 1FNDA 1JR3D 4D4IA 1RFUA 3WLPA 4YMUA 2C04A 3R24A 4ZCQA 4JS0A 4EP1A 2UYHA 1GXSA 2CXTA 4A8TA 4ANFA 5AW6A 3NWBA 4R1NA 3WLFA 3IO5A 3UQ6A 1M2GA 1QGUB 2QZPA 3MPOA 4UBOA 5IT4A 2Y1EA 5FR1A 1ZKDA 5C31A 3MJHA 3K5PA 5BQFA 4QO8A 4D41A 1DIGA 1I32A 3H3FA 2L2QA 3HNPA 4RZ2A 4BNGA 3P9KA 1RAGA 2G77B 3U19A 1R6VA 1FL9A 2PWZA 4WNYA 2II6A 2A5GA 4WY2A 1N33B 2NGRA 2ZSDA 5ALYA 1RACA 2D5CA 1Q0RA 4KQ1A 4DA7A 1CUBA 3MJSA 1P18A 2CV2A 5FBHA 5EN4A 5IZCC 3S81A 1H3EA 2PJUA 4BBPA 4R1PA 1ZWLA 2YX1A 4BECA 1XNJA 1PR5A 1KFJB 1KHTA 4HFJA 3U7FB 1TI7A 3PYMA 3V3TA 5KQSA 4EUMA 3EXFA 2DHRA 1RRKA 2R97A 3I04A 3Q88A 1OXKB 3NMUF 4JVMA 3Q1LA 4KE7A 1RRCA 2BBWA 4LV8B 2BUAA 3SX2A 1DBWA 1DTWA 2Z2ZA 2W6CX 4KBEA 4IOMA 2QPAA 4PSDA 4G4SP 2SKCA 3LC0A 1V16A 3NI2A 1BMDA 3P26A 1NKTA 2DBVO 4A3SA 2OHXA 2VSXA 3P0EA 1H4SA 1DFIA 3Q41A 5BSWA 5J5AA 4S1MA 2FX5A 4DXDA 4BDSA 5IM4A 3B7WA 1GKIA 3A3PA 4FHFA 1QANA 1G8SA 1YUBA 2FVYA 3G79A 4HEHA 4WLEA 3ZYCA 4BO8A 4QTYA 2GHRA 3SS7X 7REQB 2NUPA 2FW8A 2I67A 3C5CA 4J1TC 1I94B 3ZCSA 1ADJA 1QG6A 3IQIX 1KP3A 1DKLA 4BO1A 1FRFS 4N3CA 4ONEA 4KEAA 4LC9A 4TVKA 2IXAA 1FNCA 1T6BY 4JZYA 1SQ0A 2AFHE 2GBLA 1B43A 4XSHA 3CV3A 4B4VA 7AT1A 2O8FB 4QDIA 2YW2A 3EWAA 3WL7A 2AN5A 2DM6A 1E5TA 1QB7A 3L77A 3DW3X 3E82A 3OG9A 4II7A 4XB1A 4X95A 1PRYA 3RSSA 5B3JC 4WOPA 4L4YA 3HWSA 3EW7A 5TRTA 1HE4A 1EFKA 3SKVA 1G8JA 1T9HA 2KLHA 5BYAA 1C9DB 4C13A 3UH1A 1CNMA 2G1AA 1L5QA 1XAIA 2HLPA 4KPUA 3CUKA 2AH5A 3PNSA 4OUDA 4Q4HB 4NG4A 4TRNA 4WTOA 4PX3A 5TPWB 4KH0A 3ZWMA 3U56A 3ZX4A 1W581 1RFVA 3UQEA 4YRQA 2R44A 2BW0A 1T8YA 4B47A 1CP3A 1A72A 2FRDA 1QO9A 1DC8A 3RWBA 4F2PA 4RMIA 4DGQA 2I65A 5HKOA 3H8SA 1DFGA 3K70C 2XA1A 1WYEA 2CDBA 3L6BA 2PL9A 3PX2A 3FKJA 2YJZA 1PV4A 3P32A 4XJTA 1L4FA 3EEYA 5JSZA 2B1GA 1CY4A 2JD0A 1G0OA 3CF2A 3DLIA 1QE5A 3OQHA 2QZ4A 3TTUA 2C00A 4TS9A 1Q95A 2TECE 5DBFA 4CQNA 5DNEA 5F12A 1RQPA 2HQBA 3KXLA 3IEVA 5A0VA 4PHGA 3BF8A 1NQTA 3FA2A 4HC4A 3V1MA 1QFSA 3OQ1A 1UAGA 4ENWA 2P1RA 5EIEA 4ZTUB 2J7PD 1BCSB 3DMDA 4E94A 1UANA 3V6LA 1G3IA 3BHIA 2A3RA 8GPBA 4M9CA 1RRFA 4IH4A 2CJXA 1BX1A 2I54A 2IZ0A 3NHKA 2VORA 3O8OB 1RBMA 1TTPB 2EEZA 4LWZA 4RH1A 2A14A 4WNAA 2M6KA 4N76A 2Y05A 3IKVA 2NU9B 4C01A 5B7NA 5JCZA 2PKQO 5T8KC 3ZWKA 3WWCA 1QNFA 5DHSA 1R6AA 1A0OA 1DUVG 1X8JA 3MWGA 3F5DA 3NRJA 3TW8B 4E0BA 1WMBA 1Y8ZA 1AJEA 1ORDA 3OC0A 4R2MA 1CS0A 2DU8A 1X3SA 5HIMA 5TEVA 3D7LA 3QKRA 3CZQA 4OYLA 5DN6D 1D2CA 2EGUA 3UENA 2WJHA 1R6UA 1AUXA 2I3DA 3LH5A 4HRXA 1W1UA 2R8EA 5GZ1A 4ZAWA 1UC9A 1W7KA 1DINA 3V4OA 3GJXC 2EP8A 5E9QA 2ATEA 4DJEC 3IA2A 4Q24A 5CX1B 1JNYA 3Q12A 1Z7YA 3T38A 4C0KA 3WNCA 2HLDD 4FJ1A 3BDAA 5JC8A 2D4HA 2XRFA 4J1QA 3PC8A 4LCAA 4XX1A 2J31A 4RH3A 1YBHA 5DCLA 1NULA 3V2HA 1OZ0A 5BORA 3UZUA 4K93A 1T0HB 4OYHA 2CFTA 4UVHA 3JWJA 3UANA 3V80A 3ZXUB 4N7MA 4XD2A 3PXCX 4ILEA 4PNZA 1VE5A 2GSWA 2WB4A 3N3AC 3SD7A 4ENRA 3BRWA 3H9QA 4ZVOA 3ETJA 5ESWA 3FNQA 1D1SA 3R0IA 3IX7A 4GLJA 3ROMA 3IHKA 4F46A 2IPOA 4OMDA 4ZAFA 5JJBA 5IKMA 4EW6A 1E69A 4XW2A 3LGXA 3HDTA 1XTZA 3FVTA 2VNJA 4FIZA 4TKZA 2HWYA 1FUYB 2J7KA 1MRNA 3REQA 1U6KA 4J7XA 4OGFA 3ZHRA 5K45A 2WKPA 4B9EA 3S55A 4MDFA 2P41A 3VZCA 1T0BA 4MS3A 4BKMA 1YRBA 5EZSA 5C8DA 1A9XA 4KREA 1CQWA 3IP8A 3A7DA 5K3FA 4EUFA 4O5AA 1CEYA 3GGCA 3VTKA 3JR3A 2QRQA 4G09A 3B5IA 4R6XA 5FJJA 1U1DA 1XVTA 3FTEA 2HLZA 1LC0A 1H6CA 5IZ4A 2VF5X 2YHIB 3O93A 3QVVA 5FA5A 1MO4A 1U2DC 3G2MA 4D9EA 2ZSIA 4D9GA 3HQ4O 1YRWA 4QPJC 4CODB 4TWAA 4FD2A 2BM1A 1KYQA 1R0WA 3SZMA 3UWDA 5FBVB 1MORA 5FPTA 2HM7A 5JS6A 4O29A 2BHLA 2YV3A 1OWMA 3GLSA 3C6ZA 4FLMA 1OOEA 4R3UC 4D4MA 5D6NA 2FU5C 1VOTA 3FHLA 5AHRA 1V1MB 1TUBB 1YQXA 2GS9A 5KNDH 2WNHA 1HBJA 3OZDA 1E96A 3EVNA 4LXXA 4XQGA 2V6BA 4JB2A 4KQ9A 3U40A 1R0BA 3D3EA 2V97A 2I8AA 4BN4A 3D3NA 2W6JD 3GJ0A 4QYIA 4MDEA 2XJ9A 4ZIYA 2VQ3A 3ON5A 2VHUA 1XJCA 2ODNA 3R75A 1OLXB 2Q8QA 4D46A 2C7OA 3HDHA 2NXEA 1DZ3A 5CBKA 3N1UA 1DPGA 1ZIDA 5BW6B 2VBGA 1WTCA 2B25A 4CG0A 4PRLA 1CLUA 3PS9A 1GCIA 1KJIA 2OV6A 5BSHA 2ODPA 4HLUA 2O23A 4Q1VA 4FFBB 3WXBA 4DMRA 1W8DA 1OYOA 3GGJA 3N8IA 1GA1A 4QPZA 1KZ1A 2FP4A 2Q29A 3DP7A 4V1CI 2ZCJA 4L85A 4DCUA 1I0LA 1SQSA 4M98A 3TLGA 4MRPA 4KIUA 4RF5A 2W42A 2J6BA 3NAZA 1UDBA 2TMYA 4FD3A 4XVHA 2ZUWA 1GKLA 1PX0A 2E37A 3H5WA 1YA6A 4KJZA 2QM0A 3ZGYA 3JVVA 1R0RE 1PLLA 1Z0AA 3OQJA 1W4AA 4LBWA 5AIAA 3TJZA 2GXAA 2HQQA 3NNNA 1WZEA 4L15A 1EK0A 2OWDA 3DUFB 3LF2A 3OLZA 1LIKA 3SDZA 4UOQA 4E5DA 3KJGA 3OJWA 5IM4F 2OG2A 3FNEA 4QDOA 5KVCA 1PK7A 3KYDB 4JYPA 5T3UA 1N78A 1YDMA 1W4BA 1NAHA 2EYUA 1R00A 4PQEA 2JAOA 3R9KA 5M29A 3L82B 4MV0A 3LVBA 4A8JA 3KQQA 4EW2A 1NUPA 4L78A 5C34B 4AS2A 4E4YA 5HX7A 2BKLA 2JJYA 4K9OA 2OSBA 1XZIA 4MJXA 2ZSEA 3AVWA 1U4OA 3VXKA 1P7YA 1QAMA 4E6PA 1YKFA 1NRWA 3EY4A 4P5PA 5LP6A 4DCPA 1V4BA 1Z0ZA 3GLIA 2XWQA 4FLEA 3KYCA 5I45A 4WSOA 3TE6A 3GJ3A 4RSHA 2XTBA 3QPCA 3VO8A 3L01A 2A0KA 1UWCA 3PSHA 4KDCA 2DQKA 4OATA 2AHOA 1NNUA 3NEYA 5EE5B 1M6VB 3MWJA 2H5EA 1NW3A 2JI6A 1JG4A 3JALB 1UKAA 2EHJA 4IDFA 3ZCUA 3C3WA 3TSAA 3LOOA 3IEPA 4GVLA 4NLLA 3ZD8A 1T5IA 4II2A 2I4IA 4WNIA 2UYCA 4QAQA 5GGXA 3QCZA 4X3CA 2CLCX 3K7EA 4KDEA 4S12A 4EEZA 5HFAA 4BVGA 2VPTA 2IYNA 4IXDA 5EJ7A 3QP9A 1KIAA 3TX2A 5CFLA 3S2FA 3HACA 4F4CA 1ECJA 4DA9A 3HB7A 2HT1A 3WLTA 1Y1QA 7ADHA 3OOEA 3ELUA 4MW1A 4WN3A 1OBHA 4HVTA 2Q7OE 5M3BA 1L5WA 4W9RA 4URXR 2BFDA 1JKIA 2Y3IA 3L0DA 4PYJA 5KQRA 1RM5A 1YNSA 3B38A 3QEOA 4C2TA 4S1HA 3V4VB 2IT1A 2CB9A 1NAIA 1G5QA 4KL8S 1G60A 5DBOA 4J43A 1V8DA 3DKKA 4GLLA 3H2JA 3B85A 2IU4A 2AEMA 2M98A 4XXHA 4OIMA 2JH8A 3OIWA 3EARA 5DOZA 3RS3A 4FFRA 3F6SA 4NAUA 1NFRA 3K9NA 4I99A 2Q2VA 4AIRA 1JHXA 2W8ZA 1EDOA 4I5DA 4XB2A 3LHDA 3NBQA 1OXSC 3C8HA 5TSDA 1BEUB 3UT0A 1NNEA 4BOYA 1A5TA 4AXBA 1MJGM 3JQFA 3L0PA 5JO0A 2I6AA 5G0UA 3TRHA 4MGIR 2OBMA 3GPLA 1OPXA 5BT8A 5CGEA 2XSZD 4FLFA 3NHPA 1XQWA 3LP8A 4DLRA 1DRUA 1R9MA 1MA3A 2EW1A 2UZIR 4MGZR 4Q7MB 4WK2B 2CEKA 1JH9A 1ZK2A 2HY7A 3ENZA 3I30X 2GYWA 3SHTA 3EVEA 2GBLC 2M6RA 3U13A 1R0YA 4OXNA 2QJOA 1KE1A 1EUYA 3B2QA 1U5BA 2RGDA 1RE1A 5K4GA 1N8TA 4NV1A 4ZCPA 3A9SA 1T15A 5IX8A 1KJNA 3AXSA 1JDVA 4JXJA 1ZN7A 4IX9A 3SHWA 4TLLB 4AURA 4DSZA 4B7ZA 3T7DA 4WLUA 4CKCA 4IP0A 1N5IA 5B37A 6REQB 4X97A 5IVKA 1KKLA 3GVPA 3KAKA 4MUAA 1MJHA 2FRDC 1Y48E 2RGNA 4E5KA 2JFGA 3AW9A 3KPJA 2YWRA 4C0AC 1VYUA 4V1CB 1C1YA 3RQ6A 2WE8A 3R5TA 1DS6A 3PUYA 5FWYB 2XUDA 3RSGA 1EIZA 3ONFA 1ZXLA 1RPAA 3M70A 1PG0A 1FSPA 5CH3A 3RM5A 3IULA 4OBXA 4UEJA 4IVPA 1BU5A 2GX6A 1BX4A 2ABQA 2CUKA 2GYUA 1HE2A 1KZ9A 5FPQA 5HGJA 3FH0A 3U62A 4N18A 3GWGA 1NYRA 4RVNA 4DSAA 3COYA 2Y6UA 3U7JA 3H05A 1CRWG 3UMSA 2HU8A 2A9QA 1NBEA 1IPFA 3IJRA 4MGEA 2WJ4A 5F3DA 3TSYA 3EG9A 2VIIA 4HAOA 1L8QA 5BYBA 5DP2A 4FR5A 5IBCA 1P8JA 1ZI9A 4YRGA 2B4RO 3QLJA 1DX4A 3X43A 1ZD2P 1L5ZA 1GPLA 2P0AA 5A7GA 3RC1A 3F8SA 3HB5X 2R5FA 2XCRB 4N4AA 3RVJA 1PLJA 2M6SA 4L72A 4ER5A 2R7LA 2H48A 4YUZA 3I6MA 3IILA 5BMVB 1MO6A 3MCWA 3K4HA 1PW7A 2PXAA 3B5EA 4AKGA 3W3AH 3U16A 1UT8A 2EF0A 1CQZA 2ZSBA 2Q62A 3HEBA 2JLBA 3KJHA 4JKIA 4LJLA 4RADA 4R4JA 4X1KB 3AETB 1EFHA 1UF9A 3F4KA 1OI4A 3LT0A 2JHPA 4QAJA 4IYJA 3S70A 1DXYA 1NRJB 2ORIA 4RHTA 2AFBA 3HGQA 1Y81A 4N0EA 2X76A 3FCOA 2WF5A 3MW8A 2P4EA 2Q4RA 3P7MA 2B2CA 2WSMA 2WVAA 3BB1A 3VDMA 3DZVA 5REQA 4KXVA 1MQSA 3FX2A 1SUCA 4IVQA 4XM1A 2EJVA 3ONVA 3T4EA 1ST2A 3UCEA 4CQMB 2CFIA 3DEYX 1YQUA 4NOKA 4RDXA 3V1UA 1FW6A 2QG9A 1R4ZA 4ALKA 4YAWA 1JALA 1FQWA 1XMOB 1L7EA 1V41E 1Y5MA 3MJVA 1Z6GA 2J0EA 2IYPA 1S4QA 2FDXA 2B9VA 3C1AA 5A7HA 2QX8A 3BH7A 3PC6A 3RM3A 1HEYA 1RAFA 4IFIA 2C59A 1Q7CA 4DV1B 3K9EA 4BJ6A 4E5YA 1KZHA 3ZHVA 1FDUA 4LOLA 4GVPA 5EL0A 2OYRA 4YHBA 2RC6A 5LQSA 3ZN2A 5K09A 2V7WA 2VT7A 1HYGA 4Q7EA 3NHSA 4GMDA 2IYXA 1AKQA 3CB4A 5EWLB 1LZLA 1OCEA 2IY9A 1OTHA 2OFOA 1GIAA 4J0DA 2YASA 3ORHA 1CVRA 1F8GA 3H2IA 4MI1A 4AJIA 5DYTA 3RYHB 2JJ8A 2Q6OA 3OWOA 1V2GA 5C1BA 2ZYVX 2CZCA 2GB4A 3H5NA 4MROA 3WIOA 2PO5A 2A1TS 5LP6F 3KHTA 1JE1A 2VTKA 3DXZA 4CLRB 1JQ5A 4N3GA 4AZTA 2DKNA 4KU4A 3ICVA 2VARA 1ZITA 3HNRA 4WZ6A 3P0FA 1E60A 2R25B 3NEJA 1XCJA 3NWJA 3R5SA 1M5RA 3OIGA 1MIHA 3GGGA 4GKJB 2XMQA 4CLHA 3WBFA 1PL8A 1BMQA 1DOAA 1YBFA 2Q9UA 2BFAA 5G53C 8ADHA 4MRMA 3FGPA 5HUJA 1SH7A 4TQUS 1I7QB 4E8ZA 1U80A 1MMFB 3BIWA 3EZNA 5JZSA 1H6AA 1E4EB 1Z3CA 1HDEA 3M6IA 3SSOA 4B2PA 2PRZA 4RQUA 2PIDA 2IEGA 3ORFA 4OFBA 3UN1A 2W2LA 4UBKA 1QK3A 2IXEA 1G17A 2R48A 3GN2A 2BKXA 3LPMA 3LVQE 3NFYA 3OJXA 1ZVQA 5CB4A 4RGBA 5CVTA 4HLUC 4P36A 1OJLA 1KAHA 1OXTA 1U8CB 2Z6VA 1WKCA 1Z6ZA 4OQMA 1YGJA 4WA8A 1XVVA 2ACKA 2FPOA 5TQ2B 4KQ2A 4F4JA 2XHZA 3MWKA 4KPEC 1DQYA 1WMAA 1F4VA 2FKAA 2Q4TA 2JF0A 3D54D 5EMJA 5DSZA 5SYAA 3MGCA 3ZJTA 3C3KA 1Q16A 1Q74A 4BQIA 2X3UA 1GRQA 2GFQA 1QIDA 1JT2A 2V96A 1TVEA 2BJHA 1PYDA 4K0RA 4YLGA 2C2MA 3S27A 5KS2A 3GLIE 5HYVA 4MKZA 5CLJA 3E4CA 3THOA 1N5KA 4EUNA 2FXIA 3CPSA 2OKGA 5K03A 5LMCA 1E6CA 2D00A 1Z0IA 2Z4SA 4QFMA 2Y1DA 4EYSA 2BE9A 2JASA 2YNMD 4O8CA 1WUJS 4MEJA 4XSVA 2EL7A 2YXPX 4A8JC 1KIMA 2IOHA 1ENOA 2PA3A 2RKWA 4HQKA 3WGYA 2B4QA 1DAKA 3AR3A 5EJEA 3OOHA 2F6RA 3ZUPA 2CNKA 3GGSA 3JWGA 3REGA 5LP6C 1EE2A 3LV8A 4ZKDA 2AA0A 3T7KA 2J0UA 4KN9S 4F1KA 2BYTA 1W9MA 3HN7A 1N7HA 3BJRA 5L53A 2F3RA 5IABA 2W2KA 4Q21A 4B6EA 7GPBA 3EXEA 3K94A 5FOTA 1OFGA 3UT6A 1U8EA 4FSXA 3SNKA 1XN1A 3A1DA 2V78A 4US1R 4WBNA 4UAJA 1C7ZA 3UOAB 4R0MA 2CMFA 4HB2A 2FEPA 3EVDA 1YK1A 4X5OA 1HYHA 2IP1A 3DVRX 2XWSA 2AV6A 1EMDA 5CVVA 2IYUA 4CGZA 3GEMA 4TTRA 3VKGA 1PK8A 4W5NA 5BR7A 1SXJC 2JCXA 3PJEA 2W0SA 2QUJA 5IDYA 4M0MA 1TPZA 3FUUA 1VPEA 1O9GA 3A6PC 3LIIA 1DEOA 1YMVA 4RVSA 4X84A 2W6PA 3EBOA 4JWTA 4DQUA 1URPA 3FIUA 2A0WA 3F3MA 3AG6A 2OG1A 4G0NA 3IAM1 4KWEA 4A2QA 1SIOA 1U0OC 4CLOB 1AF7A 4LXQA 3ZJVA 4ZGGA 1QX4A 3VVMA 2GHTA 5KCMA 3AF0A 2NXCA 2REXB 1YU9A 3M1LA 4HN9A 5BSMA 2C4NA 1L7RA 1K7CA 3OM0A 3OOJA 4ZYLA 3MRVA 3N8KA 4PN7A 1Z6PA 4NPHA 1JZSA 3DYVA 5FA8A 1SUBA 3BTOA 2OZLA 3HMKA 3Q8KA 3GNTA 1CE8A 2ZRMA 1J24A 3ZHZA 1M0TA 2GF0A 2P67A 3KFXA 5CG2A 3ZHYA 4WH0A 3DTYA 4B3HA 3JQFC 2Z5VA 1XMSA 2GARA 4QDKA 4JROA 3PR1A 3RKUA 4HS9A 3PWTA 4L73A 2CEAA 3RK4A 2PEZA 1H2XA 1UZNA 1YDEA 3QVLA 4CMJA 4DLKA 4CF3A 1TECE 3CRVA 3W5AA 3IE1A 2JANA 2HHJA 4FR0A 1C7EA 1G8MA 3C39A 3EODA 4H59A 2J6IA 1B93A 1TEXA 4QFBA 5BYJA 3L4EA 2BR3A 1CJBA 3K0HA 1QS0B 1F1JA 5JBIA 3O8QB 4P4SA 5F78A 3FOEC 1JS1X 3NC4A 4J91A 1Z4KA 1QKJA 1RXWA 3EJWA 4UHBA 4J07A 4FMBB 5HE9A 4C43A 4HKTA 2QSYA 2W90A 2H63A 2XTMA 2BAGA 4IEFB 4MVJH 3UK7A 3WIBA 5B2FA 2QJFA 2FPLA 4FYJA 4R1TA 3WO0A 3VR4H 1H5UA 3IV6A 3H04A 1H85A 4P38A 1C4WA 2ZR0A 1TTTA 3EEQA 2I91A 2DPGA 3GNLA 4AZWA 4ZDKA 1PG2A 1UWKA 1ZGCA 5EXEA 5LOVB 2O8CB 4Z6KA 5HM6A 3KR9A 3E7FA 3KVOA 1QVZA 2RGNC 4FU0A 4CMIA 1L5NA 5HP4A 5F2NA 2VRNA 4RQBA 4YB8A 4DLYA 1DO8A 2AGVA 3ITKA 3MGBA 2QIPA 3FWPA 4GD3Q 1N9GA 4F1JA 4ZAVA 2Q4EA 1RJDA 4B8RA 3QG1A 4PHHA 1E0KA 2BONA 2NX2A 5CXUA 2H18A 1YS6A 2R4TA 4C88A 3EXAA 3VNQA 4FS3A 2A9RA 4JLJA 1YUNA 3LHFA 4BQQA 4DHWA 1G5FA 1W5SA 2CN1A 3MLEA 4Y2PA 4L5BA 2W6IA 3A14A 4GZ5A 4Q1FA 3WC4A 3L1JA 1RKUA 3ZDDA 3KZNA 4QEDA 1O5ZA 2PGJA 2GEUA 1GQFA 4R2WA 4E13A 1KK3A 1J6UA 1JQAA 2R7AA 2VQSA 4H31A 3SZRA 3OEHD 3DWEX 3W5IA 3BTSA 3GFPA 2MHCA 4DLUA 1IBLB 3DV2A 4M9UA 4CM8B 1MNQA 2RGXA 3DL7A 2FW0A 5DX8A 4EYEA 1XZGA 1EP2B 2CCGA 2EARA 3Q92A 3K72B 3K8ZA 3S68A 4L4UA 1XDSA 1T1JA 2P65A 4BNDB 5J47A 4YMLA 3FR8A 1P1HA 3ESYA 4U5XA 2H29A 2O5VA 4IW3B 3EG5A 4KYVA 1KVQA 4WUVA 3RSLA 1D6JA 2BI4A 3LQYA 2DWQA 3TZLA 3RVOA 4GHWA 1GKKA 3L5OA 1GSOA 3D6VA 4K6HA 3PFWO 1Z0JA 2HSWA 3FTDA 2ZIGA 4QFCA 4UAGA 1ZNZA 3WK5A 2QTLA 3C7DB 3ASZA 5FFMA 1L1FA 5FUQA 4K8RB 3AFGA 3DJFA 3LP5A 2IPNA 3HFRA 3INTA 2DDMA 1ZCAA 3ILYA 4IGAA 4BYGA 4RWEA 3BIFA 5CCDA 1HRDA 1TT5B 2WJ3A 1OFHA 2QT9A 1R8QA 3L6UA 3L7DA 3NKVA 4U2BA 2DUJA 3PENA 4BUBA 4DMGA 3N2AA 1J97A 2Z04A 3ACDA 3B82A 5JY1A 3C3CA 3I45A 1BSVA 1MH1A 2G0NA 5CB4F 3C8UA 5IEBA 3PZRA 4JKSA 2HK7A 2D5AA 2FUG1 1ZMRA 2W9XA 2EATA 4LHSA 5GV7A 1N34B 1A27A 2WUVA 2R62A 3M7IA 2IWHA 1VKJA 2H57A 3SF8A 5EKUA 4YAKA 2WHEA 3T99A 1RZRA 4PO3X 4HDOB 1MZPA 3PHCA 2P9JA 4AX4A 3P0IA 3B9BA 3I9V1 3QUSA 4PTLA 4S05A 2FHPA 2RI0A 2WWVD 1E3LA 4NONA 2C5AA 4JJEA 3FHXA 1LDMA 5C51B 3IUBA 4U6SA 1WDTA 2GN2A 2KB0A 3ZTTA 2HNBA 4LGCA 5C9ZA 1MFZA 1COWA 1NN1A 2QL9A 3C8ZA 3U44B 1Z45A 4OSEA 4HNTA 2DCUA 4I8DA 1WR8A 2Q5QA 3QF4B 5DWQA 2COKA 3N28A 3WJAA 3G2PA 3FTCA 2X58A 3JQ7A 3RROA 4C0WA 5JSUA 4X7PA 3JRWA 2Q3FA 2D5BA 4LX8A 2ET6A 4LOJA 4DB4A 2I6QA 2VP5A 1U2GA 4ZOAA 5EJGA 3T5PA 3NR2A 2Z6QA 2QJTA 4UD2A 2XCTB 3USZA 2NVOA 3H5LA 1E3MA 1U02A 3HDVA 3HFGA 3HEMA 4LRTB 5JCJA 4CMAA 5BQ3A 1WY5A 2BL4A 3IV7A 2Y1OA 3I05A 1I5RA 4ZVQA 2YMQA 1XCBA 1L8XA 3CF4G 3DWGA 2GASA 3K5WA 1B6TA 4GOND 4J3FA 2G5GX 3WOVA 1A3CA 4ID3A 2WRZA 2I7TA 2G5PA 3IE7A 3EXIA 1R64A 4K5QA 2I4NA 2MSDB 4BN5A 4PICA 5CJJA 3RLFA 4A10A 2XDQB 2XODA 4WOCA 3EIXA 5YASA 4B4UA 4RWZA 1JDBB 4D44A 2DULA 2AQHA 1JAHA 4WBNF 3WGUA 3F8WA 3KQNA 3BG5A 5LWHA 5AJYA 4CQJA 5DHQA 3UVEA 3IP6A 2A1UA 3P0HA 3WOHA 4O02B 1QDUA 1TGVA 2QQ5A 3ETCA 3VAQA 1YFLA 2WYWA 4UHFA 1VKNA 2AD5A 3KL4A 4KC0A 2HMVA 4LXUA 4IV5A 5IU6A 1AMUA 4MR7B 1A5BB 3QKSB 4IZOA 4HLCA 4LBXA 5LJLA 1CDEA 2CXXA 5AVKA 1J1UA 2FG6C 2EKZA 5LDDC 3TRFA 2KBFA 3DF9A 1IM8A 1C2YA 3DKPA 2C1EA 3IVGA 1FDSA 3BMNB 4FT4A 4LJSA 5CW2A 3KT0A 1JILA 1O5OA 4M0CA 1EFDN 3OPVA 1BXGA 2PZAA 5FA6A 2CJWB 4MAFA 1YJ8A 4ZYTA 3MQ4A 2BUCA 2ODAA 2QG4A 3HV2A 5IT5A 5AVXA 1H0SA 1GPAA 2ZM5A 2PSHA 3LKDA 3CVUA 4GRAA 1WPXA 4JU9A 2A84A 1I1OA 4TKUA 3WB1A 1QTQA 1GRVA 3A6ZA 4MV4A 4O6VA 3KPUA 4RXMA 1CWUA 3DMFA 4J0QA 3MHTA 1KK2A 2PH5A 4EK9A 2OC4A 1NDUA 1EWRA 2NAPA 3K2QA 2NUAB 3KHKA 4QU0A 2O8BA 4RIIA 2X0NA 2GR9A 3LUJA 1EUDB 4KACA 2DHCA 3TX6A 1W0KA 4HEJA 4IXNA 3PX7A 1J56A 5JMPA 2J30A 4LVCA 1Z16A 4L8LA 3TMKA 4DBVO 5AJZA 2PKKA 1C3XA 1VL6A 2JGIA 5IC6A 4M22A 5FBKA 4Z4HA 4N08A 2PBLA 1S3GA 1ZGZA 2IW1A 4JYBA 1B0UA 2VP6A 1UADA 1ZD4A 2E2WA 1VCNA 3FPHA 2P68A 4UNNA 2PZLA 4DMCA 5DCWA 3TBHA 3HXLA 2XBMA 3RC9A 4EKNB 1SJ9A 4LJ7A 2W6OA 4B7CA 2YUTA 4UNPA 3D6JA 4A5OA 1G3RA 5J5VA 4C4SA 5C3MA 3HV0A 4DA6A 1OAKA 5C5EA 1AK9A 1KEEB 1DI0A 2ONZA 3GA0A 3LBNA 5I7FA 3HCAA 3ROEA 2YZ2A 2P3QA 4QGHA 2JIMA 5TQ0B 5A5DA 4U5QA 2JH3A 2RBEA 2RJOA 1W36C 4DWVA 5COBA 4V0OA 5LYJB 3CRZA 4GR9A 3BGIA 2QJRA 2ARKA 5JYEA 2ADOA 4Y9UA 4C5BA 1XTRA 1D03A 4EJ2A 1T29A 2J4CA 5JYCA 1JVNA 3DZCA 1CVIA 1O4WA 3MG9A 5FUVA 2X9NA 3L7YA 5CRIA 5F5XA 3MCAA 5EIOA 4K9PA 1PWEA 3I9FA 1HTTA 3EUFA 2H0AA 4GL2A 1PL6A 2WILA 3RQIA 1A95A 1ZH8A 3ECAA 3INNA 1XDBA 1QP8A 2VPWA 1OLSA 4M1YA 5K3BA 5DNAA 1WKBA 2UUOA 4BTVA 1R5NA 2DBRA 3TFOA 1FLVA 2RGWA 3R0ZA 2BZ0A 2VTBB 3IIKA 4OQPA 3MILA 1GR1A 3OCVA 3VA7A 2BEUB 3PWKA 1BWPA 5E3HA 1ZD1A 2DPMA 1M2NA 2C95A 3IDSA 4KO2S 5BNWA 3GUHA 4LJ9A 2QX7A 1G7TA 4NE7A 4C87A 3PEWA 1ORIA 3PHHA 4HV4A 1QQ7A 2QRVB 1JEYB 2V7QA 1KYWA 4KMOA 4A91A 3R9WA 4L7VA 1KYVA 2DG2A 1DEKA 4D45A 4YMVA 4W4TA 2ZJYA 4DIUA 2VN8A 2INGX 1M74A 4OHPA 4L3VA 4PLFA 3FFBA 4D0RA 2CYAA 4O4JB 1TD2A 1GN8A 1HFKA 5DK6A 2XGMA 3TLXA 3MELA 5EXXA 5JFGA 1APBA 2G4VA 4YTEA 1T2FA 1ODFA 1W5BA 1T13A 2Y1KA 1RYHA 1LBQA 3QELA 4H17A 1SBTA 4ER0A 1RI5A 2UYQA 4PW0A 2WI8A 4B3MB 4CT0A 1VHLA 3PXBA 4XAQA 3QYAA 2O8DA 3EZFA 1NVAA 1NVUQ 2PH3A 2G7MC 2Q50A 4JH0A 2XT0A 1CQIB 1GFSA 3L43A 4MHSA 2GKGA 1V1AA 2PQMA 1RXUA 5D6OA 5I8ZA 1G3QA 3MPUA 4UDNA 2O50A 1U7ZA 3CLTD 4LHYA 3L4JA 4YPFA 3WL4A 1B8NA 1SXQA 4PGGA 2C54A 5AI0A 3E58A 1M67A 3FGOA 3LC7O