5C3ZA

Crystal structure of human ribokinase in complex with amppcp in c2 spacegroup
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
316
structure length
316
Chain Sequence
WQEEVAAVVVVGSCMTDLVSLTSRLPKTGETIHGHKFFIGFGGKGANQCVQAARLGAMTSMVCKVGKDSFGNDYIENLKQNDISTEFTYQTKDAATGTASIIVNNEGQNIIVIVAGANLLLNTEDLRAAANVISRAKVMVCQLEITPATSLEALTMARRSGVKTLFNPAPAIADLDPQFYTLSDVFCCNESEAEILTGLTVGSAADAGEAALVLLKRGCQVVIITLGAEGCVVLSQTEPEPKHIPTEKVKAVDTTGAGDSFVGALAFYLAYYPNLSLEDMLNRSNFIAAVSVQAAGTQSSYPYKKDLPLTLFLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human ribokinase in complex with AMPPCP in C2 spacegroup
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Ribokinase
total genus 112
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature ec 2.7.1.15: Ribokinase.
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 5c3zA00
2I6BA 4WJMA 5EYNA 3RPHA 2A9ZA 3IN1A 2PKKA 4K9IA 4XDAA 4KALA 3RSGA 3RTDA 2C49A 5TRWA 3RTCA 4C5JA 3LKIA 5C40A 4PVVA 2HQQA 4C5MA 1UB0A 4E8ZA 3NL3A 3QA2A 4N09A 3RSFA 3IE7A 3NCAA 1TZ3A 2AWDA 2A9YA 2YXUA 2XTBA 5B6AA 3RQ5A 4O1LA 5CGEA 1EKKA 3RPZA 3NC9A 2I5BA 3RT7A 2JG1A 3RREA 4EN4A 3W4SA 3RQQA 3BGKA 3H74A 3NL6A 5CM5A 3VASA 4DU5A 3DZVA 3RT9A 1UA4A 2YXTA 2AB8A 2JG5A 3RU3A 3RQ2A 3B3LA 5BYFA 3UQ6A 5C3YA 1V1SA 4E84A 2C4EA 1LHPA 1VI9A 1GQTA 3LJSA 1LIIA 3UQEA 4C5LA 1TYYA 3JULA 2R3BA 4K9CA 3RTBA 2I6AA 4LCAA 3B1PA 1V1AA 3HPDA 4E8YA 1RKSA 2R3EA 3H49A 5CGAA 2HLZA 3RRBA 4XF7A 1YGKA 4UBEA 4JKUA 3K5WA 3FHXA 1BX4A 1L2LA 2F02A 3NL5A 1RKDA 3BF5A 1VK4A 3KEUA 1TD2A 2ABQA 2F7KA 3GO6A 1V19A 3KZHA 4GM6A 4KBEA 3OTXA 3RM5A 3RQ6A 3DRWA 1WYEA 2DDMA 4K8TA 3NBWA 3HICA 3UQDA 4S1MA 3KTNA 3RTAA 3RS8A 2RBCA 2DDWA 4S1HA 3GBUA 2NWHA 1RFTA 1RKAA 3LOOA 4O1GA 1JXIA 4X8FA 4E69A 1EKQA 4B8RA 4C5NA 4EBUA 4KANA 1GC5A 5C41A 4U7XA 3NC2A 3Q92A 3FHYA 1C3QA 4KAHA 4EUMA 3UMOA 3B1QA 1YHJA 4YWRA 5BYCA 3RY7A 5F11A 1YGJA 2AJPA 3RSSA 1U2XA 2AA0A 2QHPA 3RTEA 3RQXA 3Q1YA 4YL5A 3PL2A 3PZSA 5EY7A 5TQIA 1ESQA 3NBVA 3NL2A 4KADA 4XF6A 1LIKA 4C5KA 5BYEA 4N08A 4LBGA 3ZS7A 1V1BA 1VM7A 2FV7A 4JJPA 4LBXA 4S1IB 3IH0A 4E3AA 4K93A 1LIOA 2PKNA 4K8KA 3RO4A 3IKHA 4XCKA 2DCNA 4K8PA 3VAQA 3B1OA 2AX3A 2VARA 3RTGA 4B8SA 4LC4A 3K9EA 3I3YA 3B1RA 3KD6A 5F0ZA 2DDOA 2QCVA 3RRFA 3UQ9A 1TZ6A 3CQDA 4S1IA 4DC3A 4EOHA 5COJA 1LHRA 2AJRA 5BYDA 5C3ZA 2V78A 3QAIA 3MBHA 3RS9A 4E8WA 3NM1A 3UBOA 3RQHA 3RRJA 2JGVA 3EWMA 3HYOA 1RFVA 3MBJA 4JKSA 3LHXA 3B1NA 3GO7A 3IQ0A 3N1CA 3RSQA 1RK2A 2AFBA 2PKFA 2Q5RA 4K8CA 1LIJA 3RQ8A 2HW1A 2PKMA 1RFUA 3NM3A 3UMPA 1ESJA 3IBQA 1JXHA 3RU2A 1DGMA 1KYHA 2ABSA
chains in the Genus database with same CATH superfamily
2I6BA 4WJMA 5EYNA 3RPHA 2A9ZA 2UUPA 2PKKA 3IN1A 2X5OA 3NRSA 4K9IA 4KALA 2C49A 1W7KA 4XDAA 5TRWA 3RSGA 3RTCA 3RTDA 3LKIA 5C40A 3EAGA 4PVVA 1E0DA 2GCBA 2HQQA 1UB0A 4C5MA 3NL3A 3QA2A 4N09A 3RSFA 4E8ZA 3IE7A 3NCAA 1TZ3A 1EEHA 2A9YA 2AWDA 2YXUA 2XTBA 4C13A 3RQ5A 5B6AA 4O1LA 5CGEA 1EKKA 2UAGA 3NC9A 3RPZA 3UQ6A 2I5BA 3RT7A 2JG1A 3RREA 3ZM5A 4EN4A 3W4SA 3RQQA 3BGKA 3H74A 3NL6A 5CM5A 3VASA 2VOSA 3DZVA 1W78A 3RT9A 1UA4A 2YXTA 3RRJA 4DU5A 4QDIA 2AB8A 2JG5A 3RU3A 3RQ2A 3B3LA 3QCZA 5BYFA 5C3YA 1V1SA 4E84A 2C4EA 1LHPA 1VI9A 1GQTA 2AM1A 1LIIA 3LJSA 3UQEA 4C5LA 1TYYA 3JULA 2R3BA 4K9CA 3RTBA 2Y68A 2I6AA 4LCAA 3B1PA 1V1AA 3HPDA 4E8YA 1RKSA 1JBWA 2R3EA 3H49A 5CGAA 3HJ6A 2HLZA 3RRBA 4XF7A 1YGKA 4UBEA 4CVLA 4JKUA 3K5WA 3FHXA 1BX4A 1L2LA 2F02A 3HN7A 3NL5A 4EOHA 1RKDA 3BF5A 1VK4A 3KEUA 1TD2A 2ABQA 2F7KA 2GC6A 3GO6A 1V19A 3KZHA 1O5ZA 4GM6A 1GQQA 3OTXA 2VORA 4KBEA 3PYZA 2GC5A 3RM5A 3RQ6A 4CVKA 2JFGA 3DRWA 5A5FA 1WYEA 2DDMA 4K8TA 3NBWA 1E8CA 3HICA 3UQDA 4S1MA 3KTNA 3RTAA 3RS8A 2RBCA 2DDWA 4S1HA 3GBUA 2NWHA 1RFTA 1RKAA 3LOOA 4O1GA 1JXIA 4X8FA 4ZIYA 4C5JA 4HV4A 4E69A 1EKQA 2Y66A 4B8RA 4C5NA 2Y1OA 1GG4A 4KANA 1GC5A 3ZM6A 4C12A 4U7XA 3NC2A 5C41A 3Q92A 3FHYA 1C3QA 1UAGA 4KAHA 2XPCA 4EUMA 3UMOA 3B1QA 1YHJA 4BUBA 2VTEA 4YWRA 5BYCA 3RY7A 5F11A 1YGJA 2AJPA 1J6UA 2VTDA 1U2XA 2AA0A 2QHPA 3RTEA 3RSSA 3RQXA 3Q1YA 4UAGA 4YL5A 3PL2A 3PZSA 5EY7A 5TQIA 1ESQA 3NBVA 3NL2A 4KADA 4XF6A 1LIKA 4C5KA 5BYEA 5C3ZA 4N08A 4LBGA 3ZS7A 1V1BA 1VM7A 2FV7A 4JJPA 4LBXA 4S1IB 3IH0A 3UAGA 4E3AA 4K93A 1LIOA 3ZL8A 2XJAA 2PKNA 4K8KA 3RO4A 1P31A 3IKHA 4BUCA 4CVMA 4XCKA 2DCNA 4K8PA 3VAQA 1P3DA 2AX3A 2VARA 2WJPA 3B1OA 3RTGA 4B8SA 2AM2A 2GCAA 2WTZA 4LC4A 3K9EA 3I3YA 1FGSA 3B1RA 3KD6A 5F0ZA 2DDOA 2QCVA 2F00A 3RRFA 1TZ6A 2JFFA 3CQDA 4S1IA 3UQ9A 5COJA 1LHRA 2AJRA 3LK7A 4DC3A 3N2AA 2V78A 5BYDA 3QAIA 3MBHA 2JFHA 3RS9A 4E8WA 3NM1A 3UBOA 3RQHA 4QF5A 2JGVA 2UUOA 3EWMA 1RFVA 3HYOA 3MBJA 3LHXA 3B1NA 3GO7A 3IQ0A 3N1CA 4JKSA 1RK2A 3RSQA 4EBUA 2AFBA 2PKFA 2Q5RA 4K8CA 1LIJA 3RQ8A 1GQYA 2HW1A 2PKMA 1RFUA 2Y67A 3NM3A 3UMPA 1ESJA 3IBQA 1JXHA 3RU2A 1DGMA 1KYHA 5A5EA 2ABSA 1JBVA
chains in the Genus database with same CATH topology
2I6BA 4WJMA 5EYNA 3RPHA 2A9ZA 3IN1A 2PKKA 4K9IA 4XDAA 4KALA 3RSGA 3RTDA 2C49A 5TRWA 3RTCA 4C5JA 3LKIA 5C40A 4PVVA 2HQQA 4C5MA 1UB0A 4E8ZA 3NL3A 3QA2A 4N09A 3RSFA 3IE7A 3NCAA 1TZ3A 2AWDA 2A9YA 2YXUA 2XTBA 5B6AA 3RQ5A 4O1LA 5CGEA 1EKKA 3RPZA 3NC9A 2I5BA 3RT7A 2JG1A 3RREA 4EN4A 3W4SA 3RQQA 3BGKA 3H74A 3NL6A 5CM5A 3VASA 4DU5A 3DZVA 3RT9A 1UA4A 2YXTA 2AB8A 2JG5A 3RU3A 3RQ2A 3B3LA 5BYFA 3UQ6A 5C3YA 1V1SA 4E84A 2C4EA 1LHPA 1VI9A 1GQTA 3LJSA 1LIIA 3UQEA 4C5LA 1TYYA 3JULA 2R3BA 4K9CA 3RTBA 2I6AA 4LCAA 3B1PA 1V1AA 3HPDA 4E8YA 1RKSA 2R3EA 3H49A 5CGAA 3HJ6A 2HLZA 3RRBA 4XF7A 1YGKA 4UBEA 4JKUA 3K5WA 3FHXA 1BX4A 1L2LA 2F02A 3NL5A 1RKDA 3BF5A 1VK4A 3KEUA 1TD2A 2ABQA 2F7KA 3GO6A 1V19A 3KZHA 4GM6A 4KBEA 3OTXA 3RM5A 3RQ6A 3DRWA 1WYEA 2DDMA 4K8TA 3NBWA 3HICA 3UQDA 4S1MA 3KTNA 3RTAA 3RS8A 2RBCA 2DDWA 4S1HA 3GBUA 2NWHA 1RFTA 1RKAA 3LOOA 4O1GA 1JXIA 4X8FA 4E69A 1EKQA 4B8RA 4C5NA 4EBUA 4KANA 1GC5A 5C41A 4U7XA 3NC2A 3Q92A 3FHYA 1C3QA 4KAHA 4EUMA 3UMOA 3B1QA 1YHJA 4YWRA 5BYCA 3RY7A 5F11A 1YGJA 2AJPA 3RSSA 1U2XA 2AA0A 2QHPA 3RTEA 3RQXA 3Q1YA 4YL5A 3PL2A 3PZSA 5EY7A 5TQIA 1ESQA 3NBVA 3NL2A 4KADA 4XF6A 1LIKA 4C5KA 5BYEA 4N08A 4LBGA 3ZS7A 1V1BA 1VM7A 2FV7A 4JJPA 4LBXA 4S1IB 3IH0A 4E3AA 4K93A 1LIOA 2PKNA 4K8KA 3RO4A 3IKHA 4XCKA 2DCNA 4K8PA 3VAQA 3B1OA 2AX3A 2VARA 3RTGA 4B8SA 4LC4A 3K9EA 3I3YA 3B1RA 3KD6A 5F0ZA 2DDOA 2QCVA 3RRFA 3UQ9A 1TZ6A 3CQDA 4S1IA 4DC3A 4EOHA 5COJA 1LHRA 2AJRA 5BYDA 5C3ZA 2V78A 3QAIA 3MBHA 3RS9A 4E8WA 3NM1A 3UBOA 3RQHA 3RRJA 2JGVA 3EWMA 3HYOA 1RFVA 3MBJA 4JKSA 3LHXA 3B1NA 3GO7A 3IQ0A 3N1CA 3RSQA 1RK2A 2AFBA 2PKFA 2Q5RA 4K8CA 1LIJA 3RQ8A 2HW1A 2PKMA 1RFUA 3NM3A 3UMPA 1ESJA 3IBQA 1JXHA 3RU2A 1DGMA 1KYHA 2ABSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I6B A;  4WJM A;  5EYN A;  3RPH A;  2A9Z A;  3IN1 A;  2PKK A;  4K9I A;  4XDA A;  4KAL A;  3RSG A;  3RTD A;  2C49 A;  5TRW A;  3RTC A;  4C5J A;  3LKI A;  5C40 A;  4PVV A;  2HQQ A;  4C5M A;  1UB0 A;  4E8Z A;  3NL3 A;  3QA2 A;  4N09 A;  3RSF A;  3IE7 A;  3NCA A;  1TZ3 A;  2AWD A;  2A9Y A;  2YXU A;  2XTB A;  5B6A A;  3RQ5 A;  4O1L A;  5CGE A;  1EKK A;  3RPZ A;  3NC9 A;  2I5B A;  3RT7 A;  2JG1 A;  3RRE A;  4EN4 A;  3W4S A;  3RQQ A;  3BGK A;  3H74 A;  3NL6 A;  5CM5 A;  3VAS A;  4DU5 A;  3DZV A;  3RT9 A;  1UA4 A;  2YXT A;  2AB8 A;  2JG5 A;  3RU3 A;  3RQ2 A;  3B3L A;  5BYF A;  3UQ6 A;  5C3Y A;  1V1S A;  4E84 A;  2C4E A;  1LHP A;  1VI9 A;  1GQT A;  3LJS A;  1LII A;  3UQE A;  4C5L A;  1TYY A;  3JUL A;  2R3B A;  4K9C A;  3RTB A;  2I6A A;  4LCA A;  3B1P A;  1V1A A;  3HPD A;  4E8Y A;  1RKS A;  2R3E A;  3H49 A;  5CGA A;  2HLZ A;  3RRB A;  4XF7 A;  1YGK A;  4UBE A;  4JKU A;  3K5W A;  3FHX A;  1BX4 A;  1L2L A;  2F02 A;  3NL5 A;  1RKD A;  3BF5 A;  1VK4 A;  3KEU A;  1TD2 A;  2ABQ A;  2F7K A;  3GO6 A;  1V19 A;  3KZH A;  4GM6 A;  4KBE A;  3OTX A;  3RM5 A;  3RQ6 A;  3DRW A;  1WYE A;  2DDM A;  4K8T A;  3NBW A;  3HIC A;  3UQD A;  4S1M A;  3KTN A;  3RTA A;  3RS8 A;  2RBC A;  2DDW A;  4S1H A;  3GBU A;  2NWH A;  1RFT A;  1RKA A;  3LOO A;  4O1G A;  1JXI A;  4X8F A;  4E69 A;  1EKQ A;  4B8R A;  4C5N A;  4EBU A;  4KAN A;  1GC5 A;  5C41 A;  4U7X A;  3NC2 A;  3Q92 A;  3FHY A;  1C3Q A;  4KAH A;  4EUM A;  3UMO A;  3B1Q A;  1YHJ A;  4YWR A;  5BYC A;  3RY7 A;  5F11 A;  1YGJ A;  2AJP A;  3RSS A;  1U2X A;  2AA0 A;  2QHP A;  3RTE A;  3RQX A;  3Q1Y A;  4YL5 A;  3PL2 A;  3PZS A;  5EY7 A;  5TQI A;  1ESQ A;  3NBV A;  3NL2 A;  4KAD A;  4XF6 A;  1LIK A;  4C5K A;  5BYE A;  4N08 A;  4LBG A;  3ZS7 A;  1V1B A;  1VM7 A;  2FV7 A;  4JJP A;  4LBX A;  4S1I B;  3IH0 A;  4E3A A;  4K93 A;  1LIO A;  2PKN A;  4K8K A;  3RO4 A;  3IKH A;  4XCK A;  2DCN A;  4K8P A;  3VAQ A;  3B1O A;  2AX3 A;  2VAR A;  3RTG A;  4B8S A;  4LC4 A;  3K9E A;  3I3Y A;  3B1R A;  3KD6 A;  5F0Z A;  2DDO A;  2QCV A;  3RRF A;  3UQ9 A;  1TZ6 A;  3CQD A;  4S1I A;  4DC3 A;  4EOH A;  5COJ A;  1LHR A;  2AJR A;  5BYD A;  5C3Z A;  2V78 A;  3QAI A;  3MBH A;  3RS9 A;  4E8W A;  3NM1 A;  3UBO A;  3RQH A;  3RRJ A;  2JGV A;  3EWM A;  3HYO A;  1RFV A;  3MBJ A;  4JKS A;  3LHX A;  3B1N A;  3GO7 A;  3IQ0 A;  3N1C A;  3RSQ A;  1RK2 A;  2AFB A;  2PKF A;  2Q5R A;  4K8C A;  1LIJ A;  3RQ8 A;  2HW1 A;  2PKM A;  1RFU A;  3NM3 A;  3UMP A;  1ESJ A;  3IBQ A;  1JXH A;  3RU2 A;  1DGM A;  1KYH A;  2ABS A; 
#chains in the Genus database with same CATH topology
 2I6B A;  4WJM A;  5EYN A;  3RPH A;  2A9Z A;  2UUP A;  2PKK A;  3IN1 A;  2X5O A;  3NRS A;  4K9I A;  4KAL A;  2C49 A;  1W7K A;  4XDA A;  5TRW A;  3RSG A;  3RTC A;  3RTD A;  3LKI A;  5C40 A;  3EAG A;  4PVV A;  1E0D A;  2GCB A;  2HQQ A;  1UB0 A;  4C5M A;  3NL3 A;  3QA2 A;  4N09 A;  3RSF A;  4E8Z A;  3IE7 A;  3NCA A;  1TZ3 A;  1EEH A;  2A9Y A;  2AWD A;  2YXU A;  2XTB A;  4C13 A;  3RQ5 A;  5B6A A;  4O1L A;  5CGE A;  1EKK A;  2UAG A;  3NC9 A;  3RPZ A;  3UQ6 A;  2I5B A;  3RT7 A;  2JG1 A;  3RRE A;  3ZM5 A;  4EN4 A;  3W4S A;  3RQQ A;  3BGK A;  3H74 A;  3NL6 A;  5CM5 A;  3VAS A;  2VOS A;  3DZV A;  1W78 A;  3RT9 A;  1UA4 A;  2YXT A;  3RRJ A;  4DU5 A;  4QDI A;  2AB8 A;  2JG5 A;  3RU3 A;  3RQ2 A;  3B3L A;  3QCZ A;  5BYF A;  5C3Y A;  1V1S A;  4E84 A;  2C4E A;  1LHP A;  1VI9 A;  1GQT A;  2AM1 A;  1LII A;  3LJS A;  3UQE A;  4C5L A;  1TYY A;  3JUL A;  2R3B A;  4K9C A;  3RTB A;  2Y68 A;  2I6A A;  4LCA A;  3B1P A;  1V1A A;  3HPD A;  4E8Y A;  1RKS A;  1JBW A;  2R3E A;  3H49 A;  5CGA A;  3HJ6 A;  2HLZ A;  3RRB A;  4XF7 A;  1YGK A;  4UBE A;  4CVL A;  4JKU A;  3K5W A;  3FHX A;  1BX4 A;  1L2L A;  2F02 A;  3HN7 A;  3NL5 A;  4EOH A;  1RKD A;  3BF5 A;  1VK4 A;  3KEU A;  1TD2 A;  2ABQ A;  2F7K A;  2GC6 A;  3GO6 A;  1V19 A;  3KZH A;  1O5Z A;  4GM6 A;  1GQQ A;  3OTX A;  2VOR A;  4KBE A;  3PYZ A;  2GC5 A;  3RM5 A;  3RQ6 A;  4CVK A;  2JFG A;  3DRW A;  5A5F A;  1WYE A;  2DDM A;  4K8T A;  3NBW A;  1E8C A;  3HIC A;  3UQD A;  4S1M A;  3KTN A;  3RTA A;  3RS8 A;  2RBC A;  2DDW A;  4S1H A;  3GBU A;  2NWH A;  1RFT A;  1RKA A;  3LOO A;  4O1G A;  1JXI A;  4X8F A;  4ZIY A;  4C5J A;  4HV4 A;  4E69 A;  1EKQ A;  2Y66 A;  4B8R A;  4C5N A;  2Y1O A;  1GG4 A;  4KAN A;  1GC5 A;  3ZM6 A;  4C12 A;  4U7X A;  3NC2 A;  5C41 A;  3Q92 A;  3FHY A;  1C3Q A;  1UAG A;  4KAH A;  2XPC A;  4EUM A;  3UMO A;  3B1Q A;  1YHJ A;  4BUB A;  2VTE A;  4YWR A;  5BYC A;  3RY7 A;  5F11 A;  1YGJ A;  2AJP A;  1J6U A;  2VTD A;  1U2X A;  2AA0 A;  2QHP A;  3RTE A;  3RSS A;  3RQX A;  3Q1Y A;  4UAG A;  4YL5 A;  3PL2 A;  3PZS A;  5EY7 A;  5TQI A;  1ESQ A;  3NBV A;  3NL2 A;  4KAD A;  4XF6 A;  1LIK A;  4C5K A;  5BYE A;  5C3Z A;  4N08 A;  4LBG A;  3ZS7 A;  1V1B A;  1VM7 A;  2FV7 A;  4JJP A;  4LBX A;  4S1I B;  3IH0 A;  3UAG A;  4E3A A;  4K93 A;  1LIO A;  3ZL8 A;  2XJA A;  2PKN A;  4K8K A;  3RO4 A;  1P31 A;  3IKH A;  4BUC A;  4CVM A;  4XCK A;  2DCN A;  4K8P A;  3VAQ A;  1P3D A;  2AX3 A;  2VAR A;  2WJP A;  3B1O A;  3RTG A;  4B8S A;  2AM2 A;  2GCA A;  2WTZ A;  4LC4 A;  3K9E A;  3I3Y A;  1FGS A;  3B1R A;  3KD6 A;  5F0Z A;  2DDO A;  2QCV A;  2F00 A;  3RRF A;  1TZ6 A;  2JFF A;  3CQD A;  4S1I A;  3UQ9 A;  5COJ A;  1LHR A;  2AJR A;  3LK7 A;  4DC3 A;  3N2A A;  2V78 A;  5BYD A;  3QAI A;  3MBH A;  2JFH A;  3RS9 A;  4E8W A;  3NM1 A;  3UBO A;  3RQH A;  4QF5 A;  2JGV A;  2UUO A;  3EWM A;  1RFV A;  3HYO A;  3MBJ A;  3LHX A;  3B1N A;  3GO7 A;  3IQ0 A;  3N1C A;  4JKS A;  1RK2 A;  3RSQ A;  4EBU A;  2AFB A;  2PKF A;  2Q5R A;  4K8C A;  1LIJ A;  3RQ8 A;  1GQY A;  2HW1 A;  2PKM A;  1RFU A;  2Y67 A;  3NM3 A;  3UMP A;  1ESJ A;  3IBQ A;  1JXH A;  3RU2 A;  1DGM A;  1KYH A;  5A5E A;  2ABS A;  1JBV A; 
#chains in the Genus database with same CATH homology
 2I6B A;  4WJM A;  5EYN A;  3RPH A;  2A9Z A;  3IN1 A;  2PKK A;  4K9I A;  4XDA A;  4KAL A;  3RSG A;  3RTD A;  2C49 A;  5TRW A;  3RTC A;  4C5J A;  3LKI A;  5C40 A;  4PVV A;  2HQQ A;  4C5M A;  1UB0 A;  4E8Z A;  3NL3 A;  3QA2 A;  4N09 A;  3RSF A;  3IE7 A;  3NCA A;  1TZ3 A;  2AWD A;  2A9Y A;  2YXU A;  2XTB A;  5B6A A;  3RQ5 A;  4O1L A;  5CGE A;  1EKK A;  3RPZ A;  3NC9 A;  2I5B A;  3RT7 A;  2JG1 A;  3RRE A;  4EN4 A;  3W4S A;  3RQQ A;  3BGK A;  3H74 A;  3NL6 A;  5CM5 A;  3VAS A;  4DU5 A;  3DZV A;  3RT9 A;  1UA4 A;  2YXT A;  2AB8 A;  2JG5 A;  3RU3 A;  3RQ2 A;  3B3L A;  5BYF A;  3UQ6 A;  5C3Y A;  1V1S A;  4E84 A;  2C4E A;  1LHP A;  1VI9 A;  1GQT A;  3LJS A;  1LII A;  3UQE A;  4C5L A;  1TYY A;  3JUL A;  2R3B A;  4K9C A;  3RTB A;  2I6A A;  4LCA A;  3B1P A;  1V1A A;  3HPD A;  4E8Y A;  1RKS A;  2R3E A;  3H49 A;  5CGA A;  3HJ6 A;  2HLZ A;  3RRB A;  4XF7 A;  1YGK A;  4UBE A;  4JKU A;  3K5W A;  3FHX A;  1BX4 A;  1L2L A;  2F02 A;  3NL5 A;  1RKD A;  3BF5 A;  1VK4 A;  3KEU A;  1TD2 A;  2ABQ A;  2F7K A;  3GO6 A;  1V19 A;  3KZH A;  4GM6 A;  4KBE A;  3OTX A;  3RM5 A;  3RQ6 A;  3DRW A;  1WYE A;  2DDM A;  4K8T A;  3NBW A;  3HIC A;  3UQD A;  4S1M A;  3KTN A;  3RTA A;  3RS8 A;  2RBC A;  2DDW A;  4S1H A;  3GBU A;  2NWH A;  1RFT A;  1RKA A;  3LOO A;  4O1G A;  1JXI A;  4X8F A;  4E69 A;  1EKQ A;  4B8R A;  4C5N A;  4EBU A;  4KAN A;  1GC5 A;  5C41 A;  4U7X A;  3NC2 A;  3Q92 A;  3FHY A;  1C3Q A;  4KAH A;  4EUM A;  3UMO A;  3B1Q A;  1YHJ A;  4YWR A;  5BYC A;  3RY7 A;  5F11 A;  1YGJ A;  2AJP A;  3RSS A;  1U2X A;  2AA0 A;  2QHP A;  3RTE A;  3RQX A;  3Q1Y A;  4YL5 A;  3PL2 A;  3PZS A;  5EY7 A;  5TQI A;  1ESQ A;  3NBV A;  3NL2 A;  4KAD A;  4XF6 A;  1LIK A;  4C5K A;  5BYE A;  4N08 A;  4LBG A;  3ZS7 A;  1V1B A;  1VM7 A;  2FV7 A;  4JJP A;  4LBX A;  4S1I B;  3IH0 A;  4E3A A;  4K93 A;  1LIO A;  2PKN A;  4K8K A;  3RO4 A;  3IKH A;  4XCK A;  2DCN A;  4K8P A;  3VAQ A;  3B1O A;  2AX3 A;  2VAR A;  3RTG A;  4B8S A;  4LC4 A;  3K9E A;  3I3Y A;  3B1R A;  3KD6 A;  5F0Z A;  2DDO A;  2QCV A;  3RRF A;  3UQ9 A;  1TZ6 A;  3CQD A;  4S1I A;  4DC3 A;  4EOH A;  5COJ A;  1LHR A;  2AJR A;  5BYD A;  5C3Z A;  2V78 A;  3QAI A;  3MBH A;  3RS9 A;  4E8W A;  3NM1 A;  3UBO A;  3RQH A;  3RRJ A;  2JGV A;  3EWM A;  3HYO A;  1RFV A;  3MBJ A;  4JKS A;  3LHX A;  3B1N A;  3GO7 A;  3IQ0 A;  3N1C A;  3RSQ A;  1RK2 A;  2AFB A;  2PKF A;  2Q5R A;  4K8C A;  1LIJ A;  3RQ8 A;  2HW1 A;  2PKM A;  1RFU A;  3NM3 A;  3UMP A;  1ESJ A;  3IBQ A;  1JXH A;  3RU2 A;  1DGM A;  1KYH A;  2ABS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...