5C3ZA

Crystal structure of human ribokinase in complex with amppcp in c2 spacegroup
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
316
structure length
316
Chain Sequence
WQEEVAAVVVVGSCMTDLVSLTSRLPKTGETIHGHKFFIGFGGKGANQCVQAARLGAMTSMVCKVGKDSFGNDYIENLKQNDISTEFTYQTKDAATGTASIIVNNEGQNIIVIVAGANLLLNTEDLRAAANVISRAKVMVCQLEITPATSLEALTMARRSGVKTLFNPAPAIADLDPQFYTLSDVFCCNESEAEILTGLTVGSAADAGEAALVLLKRGCQVVIITLGAEGCVVLSQTEPEPKHIPTEKVKAVDTTGAGDSFVGALAFYLAYYPNLSLEDMLNRSNFIAAVSVQAAGTQSSYPYKKDLPLTLFLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human ribokinase in complex with AMPPCP in C2 spacegroup
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Ribokinase
total genus 112
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature ec 2.7.1.15: Ribokinase.
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 5c3zA00
5TRWA 2HLZA 3B1QA 4LBGA 3EWMA 3RT7A 1EKQA 3NL6A 4K8PA 3Q1YA 4LC4A 4X8FA 3IN1A 3IE7A 5TQIA 3B1OA 1GC5A 3RRFA 1V1SA 4E8ZA 3PZSA 4JKSA 1RFTA 1TZ3A 2YXTA 3ZS7A 5C41A 3RPZA 2FV7A 2ABQA 2DDWA 3HICA 1V19A 4KADA 2A9YA 3RRJA 2DDOA 3RQXA 3NC9A 3UQ9A 3RO4A 1RFUA 1VM7A 3DRWA 4KALA 4S1HA 1VI9A 4JKUA 4S1IB 2AWDA 2HW1A 2XTBA 4K8TA 3RS8A 5BYCA 3UMPA 4N09A 2JG1A 3JULA 3RRBA 3NC2A 1YGKA 1YGJA 3NM1A 1L2LA 3NCAA 5F11A 1LIJA 3DZVA 3Q92A 2AA0A 3RQ2A 3H74A 3QAIA 3GO6A 4K8KA 1RKDA 3KTNA 4KANA 3VAQA 4E84A 2JG5A 1UB0A 3LHXA 3RS9A 3RTCA 1VK4A 2AJRA 3B1NA 1V1BA 4O1GA 2I6AA 3OTXA 3B3LA 3B1RA 1ESJA 1LHPA 2DDMA 3RREA 4O1LA 2C4EA 4JJPA 3MBJA 3NL5A 2I6BA 4KAHA 3NL3A 5EY7A 3LKIA 3KD6A 3RSFA 3IQ0A 3RQQA 3RTDA 3HPDA 1UA4A 2VARA 4DC3A 3RT9A 5BYFA 3I3YA 2R3EA 4B8SA 4DU5A 3RM5A 4E69A 3NBWA 3RQHA 5C3ZA 3LOOA 3NBVA 3IBQA 4YWRA 4PVVA 1ESQA 1EKKA 3UQDA 2NWHA 2PKNA 3UBOA 5BYEA 4K8CA 5EYNA 2R3BA 3FHXA 1YHJA 4WJMA 3MBHA 4EUMA 1U2XA 1C3QA 1JXHA 3RTEA 2C49A 3UMOA 2AB8A 5B6AA 4KBEA 4K9IA 2AJPA 3RQ5A 3IKHA 4E8YA 3PL2A 1RKAA 3RU3A 4K9CA 3RQ6A 5BYDA 1RKSA 3QA2A 2QCVA 3K9EA 4N08A 1TD2A 3RQ8A 4UBEA 3RU2A 4EOHA 4E8WA 1V1AA 2V78A 3UQEA 3N1CA 3RTAA 1LIIA 3NM3A 4S1MA 4U7XA 3RTBA 3LJSA 4EN4A 3GO7A 3IH0A 1BX4A 3RSSA 4C5JA 5C3YA 5CM5A 3H49A 2ABSA 3W4SA 4C5NA 1GQTA 3BGKA 1RFVA 2AX3A 2PKMA 4LCAA 2HQQA 4C5LA 4XF7A 2QHPA 2RBCA 4YL5A 5F0ZA 2F02A 1LIKA 3FHYA 5COJA 5CGAA 4C5MA 3B1PA 3KZHA 3HYOA 2AFBA 3BF5A 3KEUA 4B8RA 3RSGA 3RY7A 4S1IA 1TYYA 2A9ZA 5CGEA 2Q5RA 2I5BA 4LBXA 4XF6A 3RPHA 3UQ6A 1JXIA 1WYEA 2JGVA 4C5KA 4EBUA 5C40A 2F7KA 3K5WA 3RTGA 1LHRA 4K93A 4XCKA 1RK2A 1LIOA 4XDAA 1KYHA 2YXUA 2PKKA 3RSQA 2DCNA 3CQDA 3VASA 2PKFA 1TZ6A 4E3AA 3NL2A 3GBUA 1DGMA 4GM6A
chains in the Genus database with same CATH superfamily
5TRWA 2HLZA 3B1QA 4LBGA 3EWMA 1JBVA 2WTZA 3RT7A 1EKQA 3NL6A 4K8PA 3Q1YA 4LC4A 5A5EA 4X8FA 3IN1A 3IE7A 2GCBA 5TQIA 3B1OA 1GC5A 3RRFA 1V1SA 4E8ZA 3PZSA 4JKSA 1RFTA 1TZ3A 2YXTA 1GQQA 3ZS7A 5A5FA 3RPZA 5C41A 2FV7A 2DDWA 2ABQA 2Y67A 3HICA 1V19A 2UUPA 2A9YA 4KADA 3RRJA 2DDOA 3RQXA 3NC9A 3UQ9A 3RO4A 2AM1A 1RFUA 3HJ6A 3QCZA 2VTEA 2VTDA 1VM7A 4CVLA 3DRWA 4KALA 4S1HA 1VI9A 4JKUA 4S1IB 2AWDA 1J6UA 2HW1A 2XTBA 4K8TA 3RS8A 5BYCA 3UMPA 4N09A 2JFFA 2JFGA 2JG1A 3JULA 3HN7A 3RRBA 3NC2A 1YGKA 1YGJA 1FGSA 1L2LA 2Y1OA 3NCAA 3NM1A 5F11A 1LIJA 1W7KA 2JFHA 3DZVA 3Q92A 2AA0A 3ZM5A 3RQ2A 3H74A 2AM2A 3QAIA 3GO6A 4K8KA 1RKDA 3KTNA 4KANA 3VAQA 4E84A 1UB0A 2JG5A 3LHXA 3RS9A 3RTCA 1VK4A 2AJRA 3B1NA 1V1BA 4O1GA 4ZIYA 2I6AA 3OTXA 3B3LA 3B1RA 1ESJA 1LHPA 2DDMA 3LK7A 3RREA 1P3DA 2GCAA 4O1LA 2C4EA 4JJPA 3MBJA 3NL5A 2I6BA 4BUBA 4KAHA 1EEHA 3NL3A 5EY7A 3LKIA 3KD6A 3RSFA 3IQ0A 3EAGA 3RQQA 3RTDA 2X5OA 3HPDA 1UA4A 2VARA 4DC3A 3RT9A 5BYFA 2F00A 3I3YA 2R3EA 2VORA 4B8SA 3RM5A 4DU5A 4E69A 3NBWA 4EOHA 3RQHA 5C3ZA 3LOOA 1UAGA 3NRSA 3NBVA 3IBQA 4YWRA 4PVVA 1ESQA 1EKKA 4HV4A 3UQDA 2NWHA 2PKNA 3UBOA 2UUOA 5BYEA 1GQYA 2UAGA 2R3BA 2XJAA 3FHXA 4K8CA 1YHJA 4WJMA 3MBHA 5EYNA 1U2XA 4C13A 4EUMA 1C3QA 3UAGA 1JXHA 3RTEA 2C49A 3UMOA 2AB8A 5B6AA 4KBEA 2VOSA 4K9IA 2AJPA 3RQ5A 3IKHA 4E8YA 3PL2A 4UAGA 1RKAA 3PYZA 3RU3A 1P31A 3ZL8A 4K9CA 3RQ6A 5BYDA 1RKSA 4CVMA 3N2AA 2QCVA 3K9EA 3QA2A 1TD2A 4N08A 2WJPA 4UBEA 2GC5A 4QDIA 3RQ8A 1V1AA 2V78A 3RU2A 3UQEA 4E8WA 3N1CA 3RTAA 1LIIA 3NM3A 4S1MA 4U7XA 3RTBA 3LJSA 4EN4A 3GO7A 3IH0A 1BX4A 3RSSA 4CVKA 4C5JA 5C3YA 1E8CA 3H49A 2ABSA 5CM5A 3W4SA 4C5NA 1GQTA 3BGKA 1RFVA 2AX3A 2PKMA 4LCAA 2HQQA 4C5LA 4XF7A 2QHPA 2RBCA 4YL5A 1E0DA 5F0ZA 2F02A 1LIKA 3FHYA 2Y68A 5COJA 4C5MA 1W78A 5CGAA 3B1PA 1O5ZA 3HYOA 3KZHA 2AFBA 3BF5A 3KEUA 4QF5A 3RSGA 3RY7A 4S1IA 1TYYA 2A9ZA 4B8RA 5CGEA 2Q5RA 2I5BA 4LBXA 4XF6A 3RPHA 3UQ6A 1JXIA 1WYEA 2JGVA 4C5KA 4EBUA 5C40A 2F7KA 3K5WA 3RTGA 1LHRA 1JBWA 2XPCA 4K93A 4XCKA 1RK2A 1LIOA 4XDAA 2GC6A 1KYHA 2YXUA 4BUCA 2PKKA 3RSQA 2DCNA 1GG4A 3CQDA 3VASA 2PKFA 1TZ6A 2Y66A 3NL2A 3GBUA 3ZM6A 4C12A 4E3AA 1DGMA 4GM6A
chains in the Genus database with same CATH topology
5TRWA 2HLZA 3B1QA 4LBGA 3EWMA 3RT7A 1EKQA 3NL6A 4K8PA 3Q1YA 4LC4A 4X8FA 3IN1A 3IE7A 5TQIA 3B1OA 1GC5A 3RRFA 1V1SA 4E8ZA 3PZSA 4JKSA 1RFTA 1TZ3A 2YXTA 3ZS7A 5C41A 3RPZA 2FV7A 2ABQA 2DDWA 3HICA 1V19A 4KADA 2A9YA 3RRJA 2DDOA 3RQXA 3NC9A 3UQ9A 3RO4A 1RFUA 3HJ6A 1VM7A 3DRWA 4KALA 4S1HA 1VI9A 4JKUA 4S1IB 2AWDA 2HW1A 2XTBA 4K8TA 3RS8A 5BYCA 3UMPA 4N09A 2JG1A 3JULA 3RRBA 3NC2A 1YGKA 1YGJA 3NM1A 1L2LA 3NCAA 5F11A 1LIJA 3DZVA 3Q92A 2AA0A 3RQ2A 3H74A 3QAIA 3GO6A 4K8KA 1RKDA 3KTNA 4KANA 3VAQA 4E84A 2JG5A 1UB0A 3LHXA 3RS9A 3RTCA 1VK4A 2AJRA 3B1NA 1V1BA 4O1GA 2I6AA 3OTXA 3B3LA 3B1RA 1ESJA 1LHPA 2DDMA 3RREA 4O1LA 2C4EA 4JJPA 3MBJA 3NL5A 2I6BA 4KAHA 3NL3A 5EY7A 3LKIA 3KD6A 3RSFA 3IQ0A 3RQQA 3RTDA 3HPDA 1UA4A 2VARA 4DC3A 3RT9A 5BYFA 3I3YA 2R3EA 4B8SA 4DU5A 3RM5A 4E69A 3NBWA 3RQHA 5C3ZA 3LOOA 3NBVA 3IBQA 4YWRA 4PVVA 1ESQA 1EKKA 3UQDA 2NWHA 2PKNA 3UBOA 5BYEA 4K8CA 5EYNA 2R3BA 3FHXA 1YHJA 4WJMA 3MBHA 4EUMA 1U2XA 1C3QA 1JXHA 3RTEA 2C49A 3UMOA 2AB8A 5B6AA 4KBEA 4K9IA 2AJPA 3RQ5A 3IKHA 4E8YA 3PL2A 1RKAA 3RU3A 4K9CA 3RQ6A 5BYDA 1RKSA 3QA2A 2QCVA 3K9EA 4N08A 1TD2A 3RQ8A 4UBEA 3RU2A 4EOHA 4E8WA 1V1AA 2V78A 3UQEA 3N1CA 3RTAA 1LIIA 3NM3A 4S1MA 4U7XA 3RTBA 3LJSA 4EN4A 3GO7A 3IH0A 1BX4A 3RSSA 4C5JA 5C3YA 5CM5A 3H49A 2ABSA 3W4SA 4C5NA 1GQTA 3BGKA 1RFVA 2AX3A 2PKMA 4LCAA 2HQQA 4C5LA 4XF7A 2QHPA 2RBCA 4YL5A 5F0ZA 2F02A 1LIKA 3FHYA 5COJA 5CGAA 4C5MA 3B1PA 3KZHA 3HYOA 2AFBA 3BF5A 3KEUA 4B8RA 3RSGA 3RY7A 4S1IA 1TYYA 2A9ZA 5CGEA 2Q5RA 2I5BA 4LBXA 4XF6A 3RPHA 3UQ6A 1JXIA 1WYEA 2JGVA 4C5KA 4EBUA 5C40A 2F7KA 3K5WA 3RTGA 1LHRA 4K93A 4XCKA 1RK2A 1LIOA 4XDAA 1KYHA 2YXUA 2PKKA 3RSQA 2DCNA 3CQDA 3VASA 2PKFA 1TZ6A 4E3AA 3NL2A 3GBUA 1DGMA 4GM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TRW A;  2HLZ A;  3B1Q A;  4LBG A;  3EWM A;  3RT7 A;  1EKQ A;  3NL6 A;  4K8P A;  3Q1Y A;  4LC4 A;  4X8F A;  3IN1 A;  3IE7 A;  5TQI A;  3B1O A;  1GC5 A;  3RRF A;  1V1S A;  4E8Z A;  3PZS A;  4JKS A;  1RFT A;  1TZ3 A;  2YXT A;  3ZS7 A;  5C41 A;  3RPZ A;  2FV7 A;  2ABQ A;  2DDW A;  3HIC A;  1V19 A;  4KAD A;  2A9Y A;  3RRJ A;  2DDO A;  3RQX A;  3NC9 A;  3UQ9 A;  3RO4 A;  1RFU A;  1VM7 A;  3DRW A;  4KAL A;  4S1H A;  1VI9 A;  4JKU A;  4S1I B;  2AWD A;  2HW1 A;  2XTB A;  4K8T A;  3RS8 A;  5BYC A;  3UMP A;  4N09 A;  2JG1 A;  3JUL A;  3RRB A;  3NC2 A;  1YGK A;  1YGJ A;  3NM1 A;  1L2L A;  3NCA A;  5F11 A;  1LIJ A;  3DZV A;  3Q92 A;  2AA0 A;  3RQ2 A;  3H74 A;  3QAI A;  3GO6 A;  4K8K A;  1RKD A;  3KTN A;  4KAN A;  3VAQ A;  4E84 A;  2JG5 A;  1UB0 A;  3LHX A;  3RS9 A;  3RTC A;  1VK4 A;  2AJR A;  3B1N A;  1V1B A;  4O1G A;  2I6A A;  3OTX A;  3B3L A;  3B1R A;  1ESJ A;  1LHP A;  2DDM A;  3RRE A;  4O1L A;  2C4E A;  4JJP A;  3MBJ A;  3NL5 A;  2I6B A;  4KAH A;  3NL3 A;  5EY7 A;  3LKI A;  3KD6 A;  3RSF A;  3IQ0 A;  3RQQ A;  3RTD A;  3HPD A;  1UA4 A;  2VAR A;  4DC3 A;  3RT9 A;  5BYF A;  3I3Y A;  2R3E A;  4B8S A;  4DU5 A;  3RM5 A;  4E69 A;  3NBW A;  3RQH A;  5C3Z A;  3LOO A;  3NBV A;  3IBQ A;  4YWR A;  4PVV A;  1ESQ A;  1EKK A;  3UQD A;  2NWH A;  2PKN A;  3UBO A;  5BYE A;  4K8C A;  5EYN A;  2R3B A;  3FHX A;  1YHJ A;  4WJM A;  3MBH A;  4EUM A;  1U2X A;  1C3Q A;  1JXH A;  3RTE A;  2C49 A;  3UMO A;  2AB8 A;  5B6A A;  4KBE A;  4K9I A;  2AJP A;  3RQ5 A;  3IKH A;  4E8Y A;  3PL2 A;  1RKA A;  3RU3 A;  4K9C A;  3RQ6 A;  5BYD A;  1RKS A;  3QA2 A;  2QCV A;  3K9E A;  4N08 A;  1TD2 A;  3RQ8 A;  4UBE A;  3RU2 A;  4EOH A;  4E8W A;  1V1A A;  2V78 A;  3UQE A;  3N1C A;  3RTA A;  1LII A;  3NM3 A;  4S1M A;  4U7X A;  3RTB A;  3LJS A;  4EN4 A;  3GO7 A;  3IH0 A;  1BX4 A;  3RSS A;  4C5J A;  5C3Y A;  5CM5 A;  3H49 A;  2ABS A;  3W4S A;  4C5N A;  1GQT A;  3BGK A;  1RFV A;  2AX3 A;  2PKM A;  4LCA A;  2HQQ A;  4C5L A;  4XF7 A;  2QHP A;  2RBC A;  4YL5 A;  5F0Z A;  2F02 A;  1LIK A;  3FHY A;  5COJ A;  5CGA A;  4C5M A;  3B1P A;  3KZH A;  3HYO A;  2AFB A;  3BF5 A;  3KEU A;  4B8R A;  3RSG A;  3RY7 A;  4S1I A;  1TYY A;  2A9Z A;  5CGE A;  2Q5R A;  2I5B A;  4LBX A;  4XF6 A;  3RPH A;  3UQ6 A;  1JXI A;  1WYE A;  2JGV A;  4C5K A;  4EBU A;  5C40 A;  2F7K A;  3K5W A;  3RTG A;  1LHR A;  4K93 A;  4XCK A;  1RK2 A;  1LIO A;  4XDA A;  1KYH A;  2YXU A;  2PKK A;  3RSQ A;  2DCN A;  3CQD A;  3VAS A;  2PKF A;  1TZ6 A;  4E3A A;  3NL2 A;  3GBU A;  1DGM A;  4GM6 A; 
#chains in the Genus database with same CATH topology
 5TRW A;  2HLZ A;  3B1Q A;  4LBG A;  3EWM A;  1JBV A;  2WTZ A;  3RT7 A;  1EKQ A;  3NL6 A;  4K8P A;  3Q1Y A;  4LC4 A;  5A5E A;  4X8F A;  3IN1 A;  3IE7 A;  2GCB A;  5TQI A;  3B1O A;  1GC5 A;  3RRF A;  1V1S A;  4E8Z A;  3PZS A;  4JKS A;  1RFT A;  1TZ3 A;  2YXT A;  1GQQ A;  3ZS7 A;  5A5F A;  3RPZ A;  5C41 A;  2FV7 A;  2DDW A;  2ABQ A;  2Y67 A;  3HIC A;  1V19 A;  2UUP A;  2A9Y A;  4KAD A;  3RRJ A;  2DDO A;  3RQX A;  3NC9 A;  3UQ9 A;  3RO4 A;  2AM1 A;  1RFU A;  3HJ6 A;  3QCZ A;  2VTE A;  2VTD A;  1VM7 A;  4CVL A;  3DRW A;  4KAL A;  4S1H A;  1VI9 A;  4JKU A;  4S1I B;  2AWD A;  1J6U A;  2HW1 A;  2XTB A;  4K8T A;  3RS8 A;  5BYC A;  3UMP A;  4N09 A;  2JFF A;  2JFG A;  2JG1 A;  3JUL A;  3HN7 A;  3RRB A;  3NC2 A;  1YGK A;  1YGJ A;  1FGS A;  1L2L A;  2Y1O A;  3NCA A;  3NM1 A;  5F11 A;  1LIJ A;  1W7K A;  2JFH A;  3DZV A;  3Q92 A;  2AA0 A;  3ZM5 A;  3RQ2 A;  3H74 A;  2AM2 A;  3QAI A;  3GO6 A;  4K8K A;  1RKD A;  3KTN A;  4KAN A;  3VAQ A;  4E84 A;  1UB0 A;  2JG5 A;  3LHX A;  3RS9 A;  3RTC A;  1VK4 A;  2AJR A;  3B1N A;  1V1B A;  4O1G A;  4ZIY A;  2I6A A;  3OTX A;  3B3L A;  3B1R A;  1ESJ A;  1LHP A;  2DDM A;  3LK7 A;  3RRE A;  1P3D A;  2GCA A;  4O1L A;  2C4E A;  4JJP A;  3MBJ A;  3NL5 A;  2I6B A;  4BUB A;  4KAH A;  1EEH A;  3NL3 A;  5EY7 A;  3LKI A;  3KD6 A;  3RSF A;  3IQ0 A;  3EAG A;  3RQQ A;  3RTD A;  2X5O A;  3HPD A;  1UA4 A;  2VAR A;  4DC3 A;  3RT9 A;  5BYF A;  2F00 A;  3I3Y A;  2R3E A;  2VOR A;  4B8S A;  3RM5 A;  4DU5 A;  4E69 A;  3NBW A;  4EOH A;  3RQH A;  5C3Z A;  3LOO A;  1UAG A;  3NRS A;  3NBV A;  3IBQ A;  4YWR A;  4PVV A;  1ESQ A;  1EKK A;  4HV4 A;  3UQD A;  2NWH A;  2PKN A;  3UBO A;  2UUO A;  5BYE A;  1GQY A;  2UAG A;  2R3B A;  2XJA A;  3FHX A;  4K8C A;  1YHJ A;  4WJM A;  3MBH A;  5EYN A;  1U2X A;  4C13 A;  4EUM A;  1C3Q A;  3UAG A;  1JXH A;  3RTE A;  2C49 A;  3UMO A;  2AB8 A;  5B6A A;  4KBE A;  2VOS A;  4K9I A;  2AJP A;  3RQ5 A;  3IKH A;  4E8Y A;  3PL2 A;  4UAG A;  1RKA A;  3PYZ A;  3RU3 A;  1P31 A;  3ZL8 A;  4K9C A;  3RQ6 A;  5BYD A;  1RKS A;  4CVM A;  3N2A A;  2QCV A;  3K9E A;  3QA2 A;  1TD2 A;  4N08 A;  2WJP A;  4UBE A;  2GC5 A;  4QDI A;  3RQ8 A;  1V1A A;  2V78 A;  3RU2 A;  3UQE A;  4E8W A;  3N1C A;  3RTA A;  1LII A;  3NM3 A;  4S1M A;  4U7X A;  3RTB A;  3LJS A;  4EN4 A;  3GO7 A;  3IH0 A;  1BX4 A;  3RSS A;  4CVK A;  4C5J A;  5C3Y A;  1E8C A;  3H49 A;  2ABS A;  5CM5 A;  3W4S A;  4C5N A;  1GQT A;  3BGK A;  1RFV A;  2AX3 A;  2PKM A;  4LCA A;  2HQQ A;  4C5L A;  4XF7 A;  2QHP A;  2RBC A;  4YL5 A;  1E0D A;  5F0Z A;  2F02 A;  1LIK A;  3FHY A;  2Y68 A;  5COJ A;  4C5M A;  1W78 A;  5CGA A;  3B1P A;  1O5Z A;  3HYO A;  3KZH A;  2AFB A;  3BF5 A;  3KEU A;  4QF5 A;  3RSG A;  3RY7 A;  4S1I A;  1TYY A;  2A9Z A;  4B8R A;  5CGE A;  2Q5R A;  2I5B A;  4LBX A;  4XF6 A;  3RPH A;  3UQ6 A;  1JXI A;  1WYE A;  2JGV A;  4C5K A;  4EBU A;  5C40 A;  2F7K A;  3K5W A;  3RTG A;  1LHR A;  1JBW A;  2XPC A;  4K93 A;  4XCK A;  1RK2 A;  1LIO A;  4XDA A;  2GC6 A;  1KYH A;  2YXU A;  4BUC A;  2PKK A;  3RSQ A;  2DCN A;  1GG4 A;  3CQD A;  3VAS A;  2PKF A;  1TZ6 A;  2Y66 A;  3NL2 A;  3GBU A;  3ZM6 A;  4C12 A;  4E3A A;  1DGM A;  4GM6 A; 
#chains in the Genus database with same CATH homology
 5TRW A;  2HLZ A;  3B1Q A;  4LBG A;  3EWM A;  3RT7 A;  1EKQ A;  3NL6 A;  4K8P A;  3Q1Y A;  4LC4 A;  4X8F A;  3IN1 A;  3IE7 A;  5TQI A;  3B1O A;  1GC5 A;  3RRF A;  1V1S A;  4E8Z A;  3PZS A;  4JKS A;  1RFT A;  1TZ3 A;  2YXT A;  3ZS7 A;  5C41 A;  3RPZ A;  2FV7 A;  2ABQ A;  2DDW A;  3HIC A;  1V19 A;  4KAD A;  2A9Y A;  3RRJ A;  2DDO A;  3RQX A;  3NC9 A;  3UQ9 A;  3RO4 A;  1RFU A;  3HJ6 A;  1VM7 A;  3DRW A;  4KAL A;  4S1H A;  1VI9 A;  4JKU A;  4S1I B;  2AWD A;  2HW1 A;  2XTB A;  4K8T A;  3RS8 A;  5BYC A;  3UMP A;  4N09 A;  2JG1 A;  3JUL A;  3RRB A;  3NC2 A;  1YGK A;  1YGJ A;  3NM1 A;  1L2L A;  3NCA A;  5F11 A;  1LIJ A;  3DZV A;  3Q92 A;  2AA0 A;  3RQ2 A;  3H74 A;  3QAI A;  3GO6 A;  4K8K A;  1RKD A;  3KTN A;  4KAN A;  3VAQ A;  4E84 A;  2JG5 A;  1UB0 A;  3LHX A;  3RS9 A;  3RTC A;  1VK4 A;  2AJR A;  3B1N A;  1V1B A;  4O1G A;  2I6A A;  3OTX A;  3B3L A;  3B1R A;  1ESJ A;  1LHP A;  2DDM A;  3RRE A;  4O1L A;  2C4E A;  4JJP A;  3MBJ A;  3NL5 A;  2I6B A;  4KAH A;  3NL3 A;  5EY7 A;  3LKI A;  3KD6 A;  3RSF A;  3IQ0 A;  3RQQ A;  3RTD A;  3HPD A;  1UA4 A;  2VAR A;  4DC3 A;  3RT9 A;  5BYF A;  3I3Y A;  2R3E A;  4B8S A;  4DU5 A;  3RM5 A;  4E69 A;  3NBW A;  3RQH A;  5C3Z A;  3LOO A;  3NBV A;  3IBQ A;  4YWR A;  4PVV A;  1ESQ A;  1EKK A;  3UQD A;  2NWH A;  2PKN A;  3UBO A;  5BYE A;  4K8C A;  5EYN A;  2R3B A;  3FHX A;  1YHJ A;  4WJM A;  3MBH A;  4EUM A;  1U2X A;  1C3Q A;  1JXH A;  3RTE A;  2C49 A;  3UMO A;  2AB8 A;  5B6A A;  4KBE A;  4K9I A;  2AJP A;  3RQ5 A;  3IKH A;  4E8Y A;  3PL2 A;  1RKA A;  3RU3 A;  4K9C A;  3RQ6 A;  5BYD A;  1RKS A;  3QA2 A;  2QCV A;  3K9E A;  4N08 A;  1TD2 A;  3RQ8 A;  4UBE A;  3RU2 A;  4EOH A;  4E8W A;  1V1A A;  2V78 A;  3UQE A;  3N1C A;  3RTA A;  1LII A;  3NM3 A;  4S1M A;  4U7X A;  3RTB A;  3LJS A;  4EN4 A;  3GO7 A;  3IH0 A;  1BX4 A;  3RSS A;  4C5J A;  5C3Y A;  5CM5 A;  3H49 A;  2ABS A;  3W4S A;  4C5N A;  1GQT A;  3BGK A;  1RFV A;  2AX3 A;  2PKM A;  4LCA A;  2HQQ A;  4C5L A;  4XF7 A;  2QHP A;  2RBC A;  4YL5 A;  5F0Z A;  2F02 A;  1LIK A;  3FHY A;  5COJ A;  5CGA A;  4C5M A;  3B1P A;  3KZH A;  3HYO A;  2AFB A;  3BF5 A;  3KEU A;  4B8R A;  3RSG A;  3RY7 A;  4S1I A;  1TYY A;  2A9Z A;  5CGE A;  2Q5R A;  2I5B A;  4LBX A;  4XF6 A;  3RPH A;  3UQ6 A;  1JXI A;  1WYE A;  2JGV A;  4C5K A;  4EBU A;  5C40 A;  2F7K A;  3K5W A;  3RTG A;  1LHR A;  4K93 A;  4XCK A;  1RK2 A;  1LIO A;  4XDA A;  1KYH A;  2YXU A;  2PKK A;  3RSQ A;  2DCN A;  3CQD A;  3VAS A;  2PKF A;  1TZ6 A;  4E3A A;  3NL2 A;  3GBU A;  1DGM A;  4GM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...