3Q1YA

Allosteric regulation by lysine residue: a novel anion-hole formation in the ribokinase family
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
310
structure length
310
Chain Sequence
SLIYTITLNPAIDRLLFIRGELEKRKTNRVIKTEFDCGGKGLHVSGVLSKFGIKNEALGIAGSDNLDKLYAILKEKHINHDFLVEAGTSTRECFVVLSDDTNGSTMIPEAGFTVSQTNKDNLLKQIAKKVKKEDMVVIAGSPPPHYTLSDFKELLRTVKATGAFLGCDNSGEYLNLAVEMGVDFIKPNEDEVIAILDEKTNSLEENIRTLAEKIPYLVVSLGAKGSICAHNGKLYQVIPPKVQERNDTGAGDVFVGAFIAGLAMNMPITETLKVATGCSASAVMQQDSSSFDLEAAGKLKNQVSIIQLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric regulation by Lysine residue: A novel anion-hole formation in the ribokinase family
rcsb
source organism Listeria innocua
molecule tags Transferase
molecule keywords Lin2199 protein
total genus 100
structure length 310
sequence length 310
ec nomenclature ec 2.7.1.144: Tagatose-6-phosphate kinase.
pdb deposition date 2010-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3q1yA00
4JJPA 2JG5A 2PKFA 1RK2A 1V1BA 3JULA 4K8PA 3RRJA 1YGKA 3OTXA 2DDWA 3RPZA 3RS9A 3EWMA 3IQ0A 1YHJA 3GO7A 3LOOA 1UA4A 3IE7A 3UMOA 5B6AA 1TZ3A 4E8WA 3UQEA 1LIIA 3NC9A 5COJA 1V1SA 3RS8A 3UBOA 2AWDA 2FV7A 4YL5A 3RSGA 3LHXA 4K9CA 2NWHA 1KYHA 5BYDA 1TD2A 3NL2A 4GM6A 3Q1YA 2PKNA 4XF6A 2A9YA 4LC4A 3RREA 3MBHA 1L2LA 3HPDA 4S1MA 4YWRA 3NM1A 4O1LA 3HICA 1LIKA 1RFVA 4B8RA 3Q92A 2I5BA 4LBXA 3B1RA 4E69A 4E8YA 5BYEA 1JXHA 4KAHA 4S1HA 1LHRA 3RO4A 3BF5A 3RY7A 1GQTA 4DC3A 3ZS7A 5CM5A 3GBUA 2DDMA 3RTEA 4C5KA 3IN1A 3KEUA 4PVVA 1JXIA 2YXUA 1WYEA 4LCAA 3RRFA 2C4EA 4E3AA 4EBUA 2XTBA 5EY7A 1DGMA 3IKHA 3NL6A 3I3YA 3H74A 4E8ZA 2I6AA 4XDAA 3B1NA 2F7KA 3PL2A 3RU2A 2ABSA 1RFUA 2PKMA 3N1CA 3W4SA 4S1IB 5C3ZA 3RQXA 3NL5A 4K8TA 2HLZA 2YXTA 3FHYA 1C3QA 2RBCA 1VI9A 3NBVA 2AJRA 4DU5A 3RT7A 2VARA 5BYCA 4JKSA 3UMPA 2JGVA 1LIJA 4K9IA 2AB8A 1LHPA 4LBGA 4XF7A 3RTAA 4C5JA 1EKKA 4K8KA 1LIOA 1RKAA 3RPHA 3RTBA 1BX4A 1U2XA 2PKKA 3LJSA 3RQ2A 1RKSA 4K93A 2AJPA 3RSFA 3KTNA 3B1OA 3BGKA 4U7XA 3NL3A 3HYOA 1V1AA 3B3LA 3NBWA 5F11A 2QHPA 4KALA 4KANA 3LKIA 3KZHA 3RT9A 4EN4A 4XCKA 4S1IA 2DDOA 4E84A 1YGJA 2QCVA 3NCAA 3CQDA 3DZVA 1ESQA 3RQ6A 4K8CA 3RQ5A 3RQQA 3QA2A 2JG1A 3RTGA 5F0ZA 1GC5A 4X8FA 3B1PA 5CGAA 4WJMA 4N09A 3IBQA 3VAQA 3RQ8A 3FHXA 1VM7A 3RU3A 2C49A 5TQIA 1TYYA 4JKUA 3RRBA 3NC2A 4C5LA 3UQ9A 1VK4A 5C41A 2Q5RA 3KD6A 5BYFA 3RTDA 1UB0A 1V19A 2AFBA 2R3BA 4C5MA 4EOHA 2ABQA 2R3EA 3MBJA 3QAIA 4KBEA 5TRWA 3RM5A 3RSSA 5C3YA 3H49A 2HW1A 3UQDA 5EYNA 4N08A 3UQ6A 3IH0A 2A9ZA 3VASA 4C5NA 3RTCA 3DRWA 2HQQA 3PZSA 3K5WA 4UBEA 5CGEA 5C40A 3B1QA 1RFTA 2AA0A 3RQHA 1RKDA 2F02A 1ESJA 3RSQA 4B8SA 1TZ6A 3NM3A 1EKQA 2I6BA 2V78A 3GO6A 4EUMA 3K9EA 2AX3A 4KADA 2DCNA 4O1GA
chains in the Genus database with same CATH superfamily
4JJPA 4CVLA 2JG5A 2PKFA 1RK2A 1V1BA 3JULA 4K8PA 2VORA 3RRJA 5A5EA 1YGKA 4UAGA 1E0DA 3OTXA 2DDWA 3RPZA 3RS9A 3EWMA 3IQ0A 1YHJA 2Y67A 3GO7A 3LOOA 1UA4A 3IE7A 3UMOA 2GC6A 5B6AA 1TZ3A 4E8WA 3UQEA 1LIIA 3NC9A 5COJA 2AM1A 1V1SA 3RS8A 3UBOA 2AWDA 2FV7A 4YL5A 3RSGA 3LHXA 3ZM6A 3LK7A 4K9CA 2X5OA 5A5FA 2NWHA 1KYHA 1GG4A 1TD2A 3HN7A 3NL2A 5BYDA 4GM6A 3Q1YA 2PKNA 4XF6A 2Y1OA 2A9YA 4LC4A 3RREA 3MBHA 1L2LA 3HPDA 4S1MA 4YWRA 3N2AA 2JFHA 3NM1A 4O1LA 3HICA 2JFGA 1LIKA 1GQQA 2AM2A 1RFVA 4B8RA 3Q92A 3ZL8A 2I5BA 4LBXA 3B1RA 4C5MA 4E69A 4E8YA 5BYEA 1JXHA 4KAHA 4S1HA 1LHRA 3RO4A 3BF5A 3RY7A 1GQTA 4BUBA 4DC3A 2VTEA 1FGSA 5CM5A 3ZS7A 3GBUA 2DDMA 1JBWA 3HJ6A 3RTEA 3IN1A 4C5KA 3KEUA 4PVVA 1JXIA 2YXUA 1WYEA 2GCBA 4LCAA 2C4EA 1EEHA 3RRFA 4E3AA 4HV4A 4EBUA 2XTBA 5EY7A 1DGMA 3IKHA 3NL6A 3I3YA 3H74A 4E8ZA 2I6AA 4XDAA 3B1NA 2F7KA 3PL2A 3RU2A 2ABSA 2VOSA 1RFUA 2PKMA 3N1CA 4ZIYA 4C13A 3W4SA 4S1IB 5C3ZA 3RQXA 3NL5A 4K8TA 2JFFA 2HLZA 2YXTA 3FHYA 1C3QA 2RBCA 1VI9A 3NBVA 2AJRA 3ZM5A 3RT7A 2VARA 2GC5A 4DU5A 4JKSA 5BYCA 3UMPA 2JGVA 2Y66A 1LIJA 4K9IA 2AB8A 1LHPA 4LBGA 4XF7A 3RTAA 3UAGA 4C5JA 1EKKA 4K8KA 1LIOA 1RKAA 2VTDA 3RPHA 3RTBA 1BX4A 1U2XA 2PKKA 4C12A 1JBVA 3LJSA 3RQ2A 1RKSA 4K93A 2AJPA 2XPCA 1UAGA 4QF5A 3RSFA 3KTNA 3B1OA 3BGKA 1J6UA 2GCAA 4U7XA 3NL3A 3HYOA 4CVMA 1V1AA 1E8CA 3B3LA 3NBWA 2QHPA 4KALA 4KANA 3LKIA 4EOHA 1GQYA 3KZHA 3RT9A 4EN4A 2XJAA 4XCKA 4S1IA 1W7KA 2DDOA 4E84A 4BUCA 1P3DA 1YGJA 2QCVA 3NCAA 3CQDA 3DZVA 1ESQA 3RQ6A 4K8CA 3RQ5A 3RQQA 3QA2A 2JG1A 2UAGA 3RTGA 5F0ZA 1GC5A 2Y68A 3B1PA 4X8FA 4WJMA 4N09A 3IBQA 1P31A 3VAQA 5CGAA 3RQ8A 3FHXA 3PYZA 5F11A 1VM7A 3EAGA 2C49A 5TQIA 1TYYA 3RU3A 4JKUA 3RRBA 3NC2A 4C5LA 3UQ9A 1VK4A 5C41A 3QCZA 2Q5RA 3KD6A 5BYFA 3RTDA 1UB0A 1V19A 1W78A 2AFBA 2R3BA 2UUPA 1O5ZA 2ABQA 2R3EA 3MBJA 3QAIA 4KBEA 5TRWA 3RM5A 3RSSA 3H49A 2F00A 2HW1A 5C3YA 3UQDA 5EYNA 4N08A 2WJPA 3UQ6A 4CVKA 3IH0A 2A9ZA 3VASA 4C5NA 3RTCA 2UUOA 2HQQA 3DRWA 3PZSA 3K5WA 3NRSA 4UBEA 5C40A 3B1QA 5CGEA 1RFTA 2AA0A 3RQHA 1RKDA 2F02A 1ESJA 3RSQA 4B8SA 1TZ6A 3NM3A 1EKQA 2I6BA 2V78A 3GO6A 2WTZA 4QDIA 3K9EA 2AX3A 4EUMA 4KADA 2DCNA 4O1GA
chains in the Genus database with same CATH topology
4JJPA 2JG5A 2PKFA 1RK2A 1V1BA 3JULA 4K8PA 3RRJA 1YGKA 3OTXA 2DDWA 3RPZA 3RS9A 3EWMA 3IQ0A 1YHJA 3GO7A 3LOOA 1UA4A 3IE7A 3UMOA 5B6AA 1TZ3A 4E8WA 3UQEA 1LIIA 3NC9A 5COJA 1V1SA 3RS8A 3UBOA 2AWDA 2FV7A 4YL5A 3RSGA 3LHXA 4K9CA 2NWHA 1KYHA 5BYDA 1TD2A 3NL2A 4GM6A 3Q1YA 2PKNA 4XF6A 2A9YA 4LC4A 3RREA 3MBHA 1L2LA 3HPDA 4S1MA 4YWRA 3NM1A 4O1LA 3HICA 1LIKA 1RFVA 4B8RA 3Q92A 2I5BA 4LBXA 3B1RA 4E69A 4E8YA 5BYEA 1JXHA 4KAHA 4S1HA 1LHRA 3RO4A 3BF5A 3RY7A 1GQTA 4DC3A 3ZS7A 5CM5A 3GBUA 2DDMA 3HJ6A 3RTEA 4C5KA 3IN1A 3KEUA 4PVVA 1JXIA 2YXUA 1WYEA 4LCAA 3RRFA 2C4EA 4E3AA 4EBUA 2XTBA 5EY7A 1DGMA 3IKHA 3NL6A 3I3YA 3H74A 4E8ZA 2I6AA 4XDAA 3B1NA 2F7KA 3PL2A 3RU2A 2ABSA 1RFUA 2PKMA 3N1CA 3W4SA 4S1IB 5C3ZA 3RQXA 3NL5A 4K8TA 2HLZA 2YXTA 3FHYA 1C3QA 2RBCA 1VI9A 3NBVA 2AJRA 4DU5A 3RT7A 2VARA 5BYCA 4JKSA 3UMPA 2JGVA 1LIJA 4K9IA 2AB8A 1LHPA 4LBGA 4XF7A 3RTAA 4C5JA 1EKKA 4K8KA 1LIOA 1RKAA 3RPHA 3RTBA 1BX4A 1U2XA 2PKKA 3LJSA 3RQ2A 1RKSA 4K93A 2AJPA 3RSFA 3KTNA 3B1OA 3BGKA 4U7XA 3NL3A 3HYOA 1V1AA 3B3LA 3NBWA 5F11A 2QHPA 4KALA 4KANA 3LKIA 3KZHA 3RT9A 4EN4A 4XCKA 4S1IA 2DDOA 4E84A 1YGJA 2QCVA 3NCAA 3CQDA 3DZVA 1ESQA 3RQ6A 4K8CA 3RQ5A 3RQQA 3QA2A 2JG1A 3RTGA 5F0ZA 1GC5A 4X8FA 3B1PA 5CGAA 4WJMA 4N09A 3IBQA 3VAQA 3RQ8A 3FHXA 1VM7A 3RU3A 2C49A 5TQIA 1TYYA 4JKUA 3RRBA 3NC2A 4C5LA 3UQ9A 1VK4A 5C41A 2Q5RA 3KD6A 5BYFA 3RTDA 1UB0A 1V19A 2AFBA 2R3BA 4C5MA 4EOHA 2ABQA 2R3EA 3MBJA 3QAIA 4KBEA 5TRWA 3RM5A 3RSSA 5C3YA 3H49A 2HW1A 3UQDA 5EYNA 4N08A 3UQ6A 3IH0A 2A9ZA 3VASA 4C5NA 3RTCA 3DRWA 2HQQA 3PZSA 3K5WA 4UBEA 5CGEA 5C40A 3B1QA 1RFTA 2AA0A 3RQHA 1RKDA 2F02A 1ESJA 3RSQA 4B8SA 1TZ6A 3NM3A 1EKQA 2I6BA 2V78A 3GO6A 4EUMA 3K9EA 2AX3A 4KADA 2DCNA 4O1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JJP A;  2JG5 A;  2PKF A;  1RK2 A;  1V1B A;  3JUL A;  4K8P A;  3RRJ A;  1YGK A;  3OTX A;  2DDW A;  3RPZ A;  3RS9 A;  3EWM A;  3IQ0 A;  1YHJ A;  3GO7 A;  3LOO A;  1UA4 A;  3IE7 A;  3UMO A;  5B6A A;  1TZ3 A;  4E8W A;  3UQE A;  1LII A;  3NC9 A;  5COJ A;  1V1S A;  3RS8 A;  3UBO A;  2AWD A;  2FV7 A;  4YL5 A;  3RSG A;  3LHX A;  4K9C A;  2NWH A;  1KYH A;  5BYD A;  1TD2 A;  3NL2 A;  4GM6 A;  3Q1Y A;  2PKN A;  4XF6 A;  2A9Y A;  4LC4 A;  3RRE A;  3MBH A;  1L2L A;  3HPD A;  4S1M A;  4YWR A;  3NM1 A;  4O1L A;  3HIC A;  1LIK A;  1RFV A;  4B8R A;  3Q92 A;  2I5B A;  4LBX A;  3B1R A;  4E69 A;  4E8Y A;  5BYE A;  1JXH A;  4KAH A;  4S1H A;  1LHR A;  3RO4 A;  3BF5 A;  3RY7 A;  1GQT A;  4DC3 A;  3ZS7 A;  5CM5 A;  3GBU A;  2DDM A;  3RTE A;  4C5K A;  3IN1 A;  3KEU A;  4PVV A;  1JXI A;  2YXU A;  1WYE A;  4LCA A;  3RRF A;  2C4E A;  4E3A A;  4EBU A;  2XTB A;  5EY7 A;  1DGM A;  3IKH A;  3NL6 A;  3I3Y A;  3H74 A;  4E8Z A;  2I6A A;  4XDA A;  3B1N A;  2F7K A;  3PL2 A;  3RU2 A;  2ABS A;  1RFU A;  2PKM A;  3N1C A;  3W4S A;  4S1I B;  5C3Z A;  3RQX A;  3NL5 A;  4K8T A;  2HLZ A;  2YXT A;  3FHY A;  1C3Q A;  2RBC A;  1VI9 A;  3NBV A;  2AJR A;  4DU5 A;  3RT7 A;  2VAR A;  5BYC A;  4JKS A;  3UMP A;  2JGV A;  1LIJ A;  4K9I A;  2AB8 A;  1LHP A;  4LBG A;  4XF7 A;  3RTA A;  4C5J A;  1EKK A;  4K8K A;  1LIO A;  1RKA A;  3RPH A;  3RTB A;  1BX4 A;  1U2X A;  2PKK A;  3LJS A;  3RQ2 A;  1RKS A;  4K93 A;  2AJP A;  3RSF A;  3KTN A;  3B1O A;  3BGK A;  4U7X A;  3NL3 A;  3HYO A;  1V1A A;  3B3L A;  3NBW A;  5F11 A;  2QHP A;  4KAL A;  4KAN A;  3LKI A;  3KZH A;  3RT9 A;  4EN4 A;  4XCK A;  4S1I A;  2DDO A;  4E84 A;  1YGJ A;  2QCV A;  3NCA A;  3CQD A;  3DZV A;  1ESQ A;  3RQ6 A;  4K8C A;  3RQ5 A;  3RQQ A;  3QA2 A;  2JG1 A;  3RTG A;  5F0Z A;  1GC5 A;  4X8F A;  3B1P A;  5CGA A;  4WJM A;  4N09 A;  3IBQ A;  3VAQ A;  3RQ8 A;  3FHX A;  1VM7 A;  3RU3 A;  2C49 A;  5TQI A;  1TYY A;  4JKU A;  3RRB A;  3NC2 A;  4C5L A;  3UQ9 A;  1VK4 A;  5C41 A;  2Q5R A;  3KD6 A;  5BYF A;  3RTD A;  1UB0 A;  1V19 A;  2AFB A;  2R3B A;  4C5M A;  4EOH A;  2ABQ A;  2R3E A;  3MBJ A;  3QAI A;  4KBE A;  5TRW A;  3RM5 A;  3RSS A;  5C3Y A;  3H49 A;  2HW1 A;  3UQD A;  5EYN A;  4N08 A;  3UQ6 A;  3IH0 A;  2A9Z A;  3VAS A;  4C5N A;  3RTC A;  3DRW A;  2HQQ A;  3PZS A;  3K5W A;  4UBE A;  5CGE A;  5C40 A;  3B1Q A;  1RFT A;  2AA0 A;  3RQH A;  1RKD A;  2F02 A;  1ESJ A;  3RSQ A;  4B8S A;  1TZ6 A;  3NM3 A;  1EKQ A;  2I6B A;  2V78 A;  3GO6 A;  4EUM A;  3K9E A;  2AX3 A;  4KAD A;  2DCN A;  4O1G A; 
#chains in the Genus database with same CATH topology
 4JJP A;  4CVL A;  2JG5 A;  2PKF A;  1RK2 A;  1V1B A;  3JUL A;  4K8P A;  2VOR A;  3RRJ A;  5A5E A;  1YGK A;  4UAG A;  1E0D A;  3OTX A;  2DDW A;  3RPZ A;  3RS9 A;  3EWM A;  3IQ0 A;  1YHJ A;  2Y67 A;  3GO7 A;  3LOO A;  1UA4 A;  3IE7 A;  3UMO A;  2GC6 A;  5B6A A;  1TZ3 A;  4E8W A;  3UQE A;  1LII A;  3NC9 A;  5COJ A;  2AM1 A;  1V1S A;  3RS8 A;  3UBO A;  2AWD A;  2FV7 A;  4YL5 A;  3RSG A;  3LHX A;  3ZM6 A;  3LK7 A;  4K9C A;  2X5O A;  5A5F A;  2NWH A;  1KYH A;  1GG4 A;  1TD2 A;  3HN7 A;  3NL2 A;  5BYD A;  4GM6 A;  3Q1Y A;  2PKN A;  4XF6 A;  2Y1O A;  2A9Y A;  4LC4 A;  3RRE A;  3MBH A;  1L2L A;  3HPD A;  4S1M A;  4YWR A;  3N2A A;  2JFH A;  3NM1 A;  4O1L A;  3HIC A;  2JFG A;  1LIK A;  1GQQ A;  2AM2 A;  1RFV A;  4B8R A;  3Q92 A;  3ZL8 A;  2I5B A;  4LBX A;  3B1R A;  4C5M A;  4E69 A;  4E8Y A;  5BYE A;  1JXH A;  4KAH A;  4S1H A;  1LHR A;  3RO4 A;  3BF5 A;  3RY7 A;  1GQT A;  4BUB A;  4DC3 A;  2VTE A;  1FGS A;  5CM5 A;  3ZS7 A;  3GBU A;  2DDM A;  1JBW A;  3HJ6 A;  3RTE A;  3IN1 A;  4C5K A;  3KEU A;  4PVV A;  1JXI A;  2YXU A;  1WYE A;  2GCB A;  4LCA A;  2C4E A;  1EEH A;  3RRF A;  4E3A A;  4HV4 A;  4EBU A;  2XTB A;  5EY7 A;  1DGM A;  3IKH A;  3NL6 A;  3I3Y A;  3H74 A;  4E8Z A;  2I6A A;  4XDA A;  3B1N A;  2F7K A;  3PL2 A;  3RU2 A;  2ABS A;  2VOS A;  1RFU A;  2PKM A;  3N1C A;  4ZIY A;  4C13 A;  3W4S A;  4S1I B;  5C3Z A;  3RQX A;  3NL5 A;  4K8T A;  2JFF A;  2HLZ A;  2YXT A;  3FHY A;  1C3Q A;  2RBC A;  1VI9 A;  3NBV A;  2AJR A;  3ZM5 A;  3RT7 A;  2VAR A;  2GC5 A;  4DU5 A;  4JKS A;  5BYC A;  3UMP A;  2JGV A;  2Y66 A;  1LIJ A;  4K9I A;  2AB8 A;  1LHP A;  4LBG A;  4XF7 A;  3RTA A;  3UAG A;  4C5J A;  1EKK A;  4K8K A;  1LIO A;  1RKA A;  2VTD A;  3RPH A;  3RTB A;  1BX4 A;  1U2X A;  2PKK A;  4C12 A;  1JBV A;  3LJS A;  3RQ2 A;  1RKS A;  4K93 A;  2AJP A;  2XPC A;  1UAG A;  4QF5 A;  3RSF A;  3KTN A;  3B1O A;  3BGK A;  1J6U A;  2GCA A;  4U7X A;  3NL3 A;  3HYO A;  4CVM A;  1V1A A;  1E8C A;  3B3L A;  3NBW A;  2QHP A;  4KAL A;  4KAN A;  3LKI A;  4EOH A;  1GQY A;  3KZH A;  3RT9 A;  4EN4 A;  2XJA A;  4XCK A;  4S1I A;  1W7K A;  2DDO A;  4E84 A;  4BUC A;  1P3D A;  1YGJ A;  2QCV A;  3NCA A;  3CQD A;  3DZV A;  1ESQ A;  3RQ6 A;  4K8C A;  3RQ5 A;  3RQQ A;  3QA2 A;  2JG1 A;  2UAG A;  3RTG A;  5F0Z A;  1GC5 A;  2Y68 A;  3B1P A;  4X8F A;  4WJM A;  4N09 A;  3IBQ A;  1P31 A;  3VAQ A;  5CGA A;  3RQ8 A;  3FHX A;  3PYZ A;  5F11 A;  1VM7 A;  3EAG A;  2C49 A;  5TQI A;  1TYY A;  3RU3 A;  4JKU A;  3RRB A;  3NC2 A;  4C5L A;  3UQ9 A;  1VK4 A;  5C41 A;  3QCZ A;  2Q5R A;  3KD6 A;  5BYF A;  3RTD A;  1UB0 A;  1V19 A;  1W78 A;  2AFB A;  2R3B A;  2UUP A;  1O5Z A;  2ABQ A;  2R3E A;  3MBJ A;  3QAI A;  4KBE A;  5TRW A;  3RM5 A;  3RSS A;  3H49 A;  2F00 A;  2HW1 A;  5C3Y A;  3UQD A;  5EYN A;  4N08 A;  2WJP A;  3UQ6 A;  4CVK A;  3IH0 A;  2A9Z A;  3VAS A;  4C5N A;  3RTC A;  2UUO A;  2HQQ A;  3DRW A;  3PZS A;  3K5W A;  3NRS A;  4UBE A;  5C40 A;  3B1Q A;  5CGE A;  1RFT A;  2AA0 A;  3RQH A;  1RKD A;  2F02 A;  1ESJ A;  3RSQ A;  4B8S A;  1TZ6 A;  3NM3 A;  1EKQ A;  2I6B A;  2V78 A;  3GO6 A;  2WTZ A;  4QDI A;  3K9E A;  2AX3 A;  4EUM A;  4KAD A;  2DCN A;  4O1G A; 
#chains in the Genus database with same CATH homology
 4JJP A;  2JG5 A;  2PKF A;  1RK2 A;  1V1B A;  3JUL A;  4K8P A;  3RRJ A;  1YGK A;  3OTX A;  2DDW A;  3RPZ A;  3RS9 A;  3EWM A;  3IQ0 A;  1YHJ A;  3GO7 A;  3LOO A;  1UA4 A;  3IE7 A;  3UMO A;  5B6A A;  1TZ3 A;  4E8W A;  3UQE A;  1LII A;  3NC9 A;  5COJ A;  1V1S A;  3RS8 A;  3UBO A;  2AWD A;  2FV7 A;  4YL5 A;  3RSG A;  3LHX A;  4K9C A;  2NWH A;  1KYH A;  5BYD A;  1TD2 A;  3NL2 A;  4GM6 A;  3Q1Y A;  2PKN A;  4XF6 A;  2A9Y A;  4LC4 A;  3RRE A;  3MBH A;  1L2L A;  3HPD A;  4S1M A;  4YWR A;  3NM1 A;  4O1L A;  3HIC A;  1LIK A;  1RFV A;  4B8R A;  3Q92 A;  2I5B A;  4LBX A;  3B1R A;  4E69 A;  4E8Y A;  5BYE A;  1JXH A;  4KAH A;  4S1H A;  1LHR A;  3RO4 A;  3BF5 A;  3RY7 A;  1GQT A;  4DC3 A;  3ZS7 A;  5CM5 A;  3GBU A;  2DDM A;  3HJ6 A;  3RTE A;  4C5K A;  3IN1 A;  3KEU A;  4PVV A;  1JXI A;  2YXU A;  1WYE A;  4LCA A;  3RRF A;  2C4E A;  4E3A A;  4EBU A;  2XTB A;  5EY7 A;  1DGM A;  3IKH A;  3NL6 A;  3I3Y A;  3H74 A;  4E8Z A;  2I6A A;  4XDA A;  3B1N A;  2F7K A;  3PL2 A;  3RU2 A;  2ABS A;  1RFU A;  2PKM A;  3N1C A;  3W4S A;  4S1I B;  5C3Z A;  3RQX A;  3NL5 A;  4K8T A;  2HLZ A;  2YXT A;  3FHY A;  1C3Q A;  2RBC A;  1VI9 A;  3NBV A;  2AJR A;  4DU5 A;  3RT7 A;  2VAR A;  5BYC A;  4JKS A;  3UMP A;  2JGV A;  1LIJ A;  4K9I A;  2AB8 A;  1LHP A;  4LBG A;  4XF7 A;  3RTA A;  4C5J A;  1EKK A;  4K8K A;  1LIO A;  1RKA A;  3RPH A;  3RTB A;  1BX4 A;  1U2X A;  2PKK A;  3LJS A;  3RQ2 A;  1RKS A;  4K93 A;  2AJP A;  3RSF A;  3KTN A;  3B1O A;  3BGK A;  4U7X A;  3NL3 A;  3HYO A;  1V1A A;  3B3L A;  3NBW A;  5F11 A;  2QHP A;  4KAL A;  4KAN A;  3LKI A;  3KZH A;  3RT9 A;  4EN4 A;  4XCK A;  4S1I A;  2DDO A;  4E84 A;  1YGJ A;  2QCV A;  3NCA A;  3CQD A;  3DZV A;  1ESQ A;  3RQ6 A;  4K8C A;  3RQ5 A;  3RQQ A;  3QA2 A;  2JG1 A;  3RTG A;  5F0Z A;  1GC5 A;  4X8F A;  3B1P A;  5CGA A;  4WJM A;  4N09 A;  3IBQ A;  3VAQ A;  3RQ8 A;  3FHX A;  1VM7 A;  3RU3 A;  2C49 A;  5TQI A;  1TYY A;  4JKU A;  3RRB A;  3NC2 A;  4C5L A;  3UQ9 A;  1VK4 A;  5C41 A;  2Q5R A;  3KD6 A;  5BYF A;  3RTD A;  1UB0 A;  1V19 A;  2AFB A;  2R3B A;  4C5M A;  4EOH A;  2ABQ A;  2R3E A;  3MBJ A;  3QAI A;  4KBE A;  5TRW A;  3RM5 A;  3RSS A;  5C3Y A;  3H49 A;  2HW1 A;  3UQD A;  5EYN A;  4N08 A;  3UQ6 A;  3IH0 A;  2A9Z A;  3VAS A;  4C5N A;  3RTC A;  3DRW A;  2HQQ A;  3PZS A;  3K5W A;  4UBE A;  5CGE A;  5C40 A;  3B1Q A;  1RFT A;  2AA0 A;  3RQH A;  1RKD A;  2F02 A;  1ESJ A;  3RSQ A;  4B8S A;  1TZ6 A;  3NM3 A;  1EKQ A;  2I6B A;  2V78 A;  3GO6 A;  4EUM A;  3K9E A;  2AX3 A;  4KAD A;  2DCN A;  4O1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...