1YGJA

Crystal structure of pyridoxal kinase in complex with roscovitine and derivatives
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
309
structure length
309
Chain Sequence
ECRVLSIQSHVVRGYVGNRAATFPLQVLGFEVDAVNSVQFSNHTGYSHWKGQVLNSDELQELYDGLKLNHVNQYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVMGDQRNGEGAMYVPDDLLPVYREKVVPVADIITPNQFEAELLTGRKIHSQEEALEVMDMLHSMGPDTVVITSSNLLSPRGSDYLMALGSQRTRAPDGSVVTQRIRMEMHKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSAMHHVLQRTIKCAKAKSGEGVKPSPAQLELRMVQSKKDIESPEIVVQATVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of pyridoxal kinase in complex with roscovitine and derivatives
pubmed doi rcsb
molecule tags Transferase
molecule keywords Pyridoxal kinase
total genus 88
structure length 309
sequence length 309
ec nomenclature ec 2.7.1.35: Pyridoxal kinase.
pdb deposition date 2005-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08543 Phos_pyr_kin Phosphomethylpyrimidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 1ygjA00
3NC9A 3RM5A 1GQTA 3NL3A 2ABQA 3LJSA 3N1CA 1TZ3A 3IBQA 4K93A 1RFTA 4XCKA 1KYHA 2DDWA 3DRWA 3B1NA 3NM3A 5TQIA 4EN4A 3B1PA 4KAHA 1LIJA 3RTGA 2R3EA 4LCAA 4K9IA 4S1IB 2PKKA 2C4EA 2JGVA 3BF5A 3ZS7A 4GM6A 2C49A 3KZHA 1V1BA 1YGKA 2AJPA 1VK4A 5COJA 3NBVA 2AFBA 3IE7A 3VAQA 2DCNA 2HW1A 2V78A 3IQ0A 4YWRA 4DC3A 3GBUA 4LC4A 1YHJA 2AJRA 3HPDA 4E3AA 4E8WA 3UMPA 5EYNA 3RQHA 3Q92A 2AA0A 3RQQA 3RREA 3W4SA 5BYDA 1LIOA 3HICA 1WYEA 2XTBA 3QAIA 4S1IA 3RQ8A 4LBGA 3RTAA 4EOHA 1BX4A 3B1QA 4N08A 3KEUA 3RQ5A 1JXHA 3KTNA 2A9ZA 3RO4A 3KD6A 1ESJA 4DU5A 3RSQA 5C41A 3IH0A 2QCVA 2RBCA 3RS8A 3LKIA 4E69A 4C5JA 1GC5A 3PZSA 2F7KA 3RTEA 3NC2A 3B1OA 3NL6A 4B8RA 2I6AA 2ABSA 4K8PA 5B6AA 4UBEA 4K8TA 4KANA 5C3ZA 3LOOA 1UA4A 3DZVA 1VI9A 4E8ZA 5CGEA 1RKDA 1V1AA 4K8CA 4XDAA 3QA2A 3BGKA 4PVVA 3RU3A 3MBJA 3UQ6A 4B8SA 3IN1A 4C5NA 4E84A 3Q1YA 1JXIA 5F0ZA 4EBUA 1TYYA 2VARA 5BYFA 5CM5A 4C5MA 2HQQA 4N09A 4EUMA 4JJPA 1V1SA 3RT9A 1EKKA 4O1GA 1LIKA 3H49A 3NL5A 3RSSA 5CGAA 2PKNA 3NM1A 4WJMA 3OTXA 2A9YA 4KALA 3RPHA 3MBHA 3RTBA 5BYEA 2I5BA 3B1RA 1VM7A 2HLZA 2PKMA 1TZ6A 2YXTA 1LHPA 2YXUA 3UMOA 3H74A 4K8KA 2AB8A 1RFVA 1RKSA 3RSFA 4U7XA 4JKSA 4KADA 2FV7A 4O1LA 4E8YA 3RY7A 5BYCA 2F02A 3UQEA 2I6BA 1RKAA 1U2XA 3HYOA 1EKQA 3B3LA 3K9EA 1YGJA 3IKHA 3RQXA 2DDMA 2Q5RA 4X8FA 5TRWA 1ESQA 3RTDA 3EWMA 3K5WA 4K9CA 3RSGA 5F11A 3RQ2A 3FHYA 3I3YA 3RQ6A 4XF7A 4C5KA 1TD2A 3JULA 3NCAA 3RRFA 4XF6A 3UBOA 1LIIA 3LHXA 3RTCA 3RT7A 2R3BA 3CQDA 4KBEA 3NL2A 4C5LA 2QHPA 3VASA 2NWHA 5C40A 1LHRA 2JG5A 2DDOA 3GO7A 1V19A 4LBXA 1C3QA 1DGMA 4S1MA 5EY7A 3GO6A 2AX3A 3RRBA 2JG1A 4YL5A 1UB0A 3NBWA 4S1HA 3RPZA 3RU2A 2AWDA 3RS9A 3PL2A 5C3YA 1RFUA 3RRJA 1L2LA 3FHXA 3UQDA 1RK2A 2PKFA 4JKUA 3UQ9A
chains in the Genus database with same CATH superfamily
3NC9A 3RM5A 1GQTA 3NL3A 2ABQA 3LJSA 3N1CA 1TZ3A 3IBQA 4K93A 1RFTA 4XCKA 1KYHA 2DDWA 3DRWA 3B1NA 3NM3A 5TQIA 4EN4A 3B1PA 2JFFA 4KAHA 1LIJA 3RTGA 3ZM6A 2R3EA 4BUBA 4LCAA 4K9IA 4S1IB 2GC5A 2PKKA 3N2AA 2C4EA 2GC6A 2JGVA 3BF5A 3ZS7A 4GM6A 2C49A 1E0DA 1V1BA 1YGKA 2AJPA 1VK4A 3KZHA 3NBVA 3NRSA 5COJA 1J6UA 3ZM5A 1P3DA 1EEHA 2AFBA 3IE7A 2DCNA 2HW1A 2V78A 3IQ0A 4YWRA 3VAQA 3PYZA 4DC3A 3GBUA 2UUPA 1YHJA 4LC4A 1JBVA 2AJRA 2Y68A 5A5FA 3HPDA 4E3AA 4E8WA 1JBWA 3UMPA 5EYNA 3RQHA 3Q92A 2AA0A 3RQQA 3RREA 3W4SA 3HN7A 5BYDA 2WJPA 1LIOA 3HICA 1WYEA 2XTBA 3QAIA 4S1IA 3RQ8A 4LBGA 3RTAA 4EOHA 1BX4A 3B1QA 4N08A 3KEUA 3RQ5A 3LK7A 1JXHA 2X5OA 2A9ZA 3KTNA 3RO4A 3KD6A 1ESJA 4DU5A 1GQQA 3RSQA 1P31A 2QCVA 3IH0A 1O5ZA 2RBCA 3RS8A 3LKIA 5C41A 4E69A 4C5JA 1GC5A 3PZSA 2F7KA 3RTEA 4C12A 3NC2A 3B1OA 3NL6A 4B8RA 2I6AA 2ABSA 4K8PA 5B6AA 4UBEA 4K8TA 4KANA 5C3ZA 3LOOA 1UA4A 2GCBA 3DZVA 1VI9A 2WTZA 4CVKA 4E8ZA 5CGEA 1RKDA 1V1AA 4K8CA 4XDAA 3QA2A 1W7KA 3BGKA 4PVVA 3RU3A 3MBJA 3UQ6A 4B8SA 3HJ6A 3IN1A 4C5NA 4E84A 3Q1YA 1JXIA 4C13A 5F0ZA 4EBUA 1TYYA 2VARA 3UAGA 5CM5A 4C5MA 4UAGA 2AM2A 5BYFA 1W78A 2HQQA 4N09A 4EUMA 4JJPA 1V1SA 3ZL8A 3RT9A 1EKKA 4O1GA 1LIKA 3H49A 3NL5A 3RSSA 5CGAA 2PKNA 3NM1A 4WJMA 1UAGA 2XPCA 3OTXA 2GCAA 2A9YA 4KALA 3RPHA 3MBHA 3RTBA 5BYEA 2I5BA 3B1RA 3EAGA 1VM7A 2HLZA 2JFHA 1TZ6A 2PKMA 1LHPA 2YXTA 2YXUA 3UMOA 2Y67A 2Y1OA 3H74A 1GG4A 4K8KA 2AB8A 2VOSA 1RFVA 1RKSA 3RSFA 4U7XA 4JKSA 3QCZA 4KADA 2FV7A 4O1LA 4ZIYA 4HV4A 4BUCA 4E8YA 3RY7A 4CVLA 5BYCA 2F02A 3UQEA 2I6BA 1RKAA 2AM1A 2Y66A 1U2XA 2XJAA 3HYOA 1EKQA 2UUOA 3B3LA 1YGJA 3IKHA 3K9EA 3RQXA 2DDMA 1E8CA 2Q5RA 4X8FA 1ESQA 5TRWA 2VTEA 3RTDA 3EWMA 2JFGA 2VORA 3K5WA 4K9CA 3RSGA 3RQ2A 4QF5A 5F11A 3FHYA 3I3YA 3RQ6A 4XF7A 4C5KA 1TD2A 3JULA 3NCAA 3RRFA 4XF6A 3UBOA 1LIIA 2UAGA 4QDIA 3LHXA 3RTCA 3RT7A 2R3BA 3CQDA 4KBEA 3NL2A 4C5LA 2QHPA 4CVMA 3VASA 2NWHA 5C40A 1LHRA 2JG5A 2DDOA 3GO7A 1V19A 4LBXA 1C3QA 1DGMA 4S1MA 5EY7A 3GO6A 2AX3A 3RRBA 1GQYA 2JG1A 4YL5A 1UB0A 3NBWA 4S1HA 3RPZA 3RU2A 2F00A 2AWDA 3RS9A 3PL2A 5C3YA 1RFUA 3RRJA 1FGSA 1L2LA 2VTDA 3FHXA 3UQDA 5A5EA 1RK2A 2PKFA 4JKUA 3UQ9A
chains in the Genus database with same CATH topology
3NC9A 3RM5A 1GQTA 3NL3A 2ABQA 3LJSA 3N1CA 1TZ3A 3IBQA 4K93A 1RFTA 4XCKA 1KYHA 2DDWA 3DRWA 3B1NA 3NM3A 5TQIA 4EN4A 3B1PA 4KAHA 1LIJA 3RTGA 2R3EA 4LCAA 4K9IA 4S1IB 2PKKA 2C4EA 2JGVA 3BF5A 3ZS7A 4GM6A 2C49A 3KZHA 1V1BA 1YGKA 2AJPA 1VK4A 5COJA 3NBVA 2AFBA 3IE7A 3VAQA 2DCNA 2HW1A 2V78A 3IQ0A 4YWRA 4DC3A 3GBUA 4LC4A 1YHJA 2AJRA 3HPDA 4E3AA 4E8WA 3UMPA 5EYNA 3RQHA 3Q92A 2AA0A 3RQQA 3RREA 3W4SA 5BYDA 1LIOA 3HICA 1WYEA 2XTBA 3QAIA 4S1IA 3RQ8A 4LBGA 3RTAA 4EOHA 1BX4A 3B1QA 4N08A 3KEUA 3RQ5A 1JXHA 3KTNA 2A9ZA 3RO4A 3KD6A 1ESJA 4DU5A 3RSQA 5C41A 3IH0A 2QCVA 2RBCA 3RS8A 3LKIA 4E69A 4C5JA 1GC5A 3PZSA 2F7KA 3RTEA 3NC2A 3B1OA 3NL6A 4B8RA 2I6AA 2ABSA 4K8PA 5B6AA 4UBEA 4K8TA 4KANA 5C3ZA 3LOOA 1UA4A 3DZVA 1VI9A 4E8ZA 5CGEA 1RKDA 1V1AA 4K8CA 4XDAA 3QA2A 3BGKA 4PVVA 3RU3A 3MBJA 3UQ6A 4B8SA 3HJ6A 3IN1A 4C5NA 4E84A 3Q1YA 1JXIA 5F0ZA 4EBUA 1TYYA 2VARA 5BYFA 5CM5A 4C5MA 2HQQA 4N09A 4EUMA 4JJPA 1V1SA 3RT9A 1EKKA 4O1GA 1LIKA 3H49A 3NL5A 3RSSA 5CGAA 2PKNA 3NM1A 4WJMA 3OTXA 2A9YA 4KALA 3RPHA 3MBHA 3RTBA 5BYEA 2I5BA 3B1RA 1VM7A 2HLZA 2PKMA 1TZ6A 2YXTA 1LHPA 2YXUA 3UMOA 3H74A 4K8KA 2AB8A 1RFVA 1RKSA 3RSFA 4U7XA 4JKSA 4KADA 2FV7A 4O1LA 4E8YA 3RY7A 5BYCA 2F02A 3UQEA 2I6BA 1RKAA 1U2XA 3HYOA 1EKQA 3B3LA 3K9EA 1YGJA 3IKHA 3RQXA 2DDMA 2Q5RA 4X8FA 5TRWA 1ESQA 3RTDA 3EWMA 3K5WA 4K9CA 3RSGA 5F11A 3RQ2A 3FHYA 3I3YA 3RQ6A 4XF7A 4C5KA 1TD2A 3JULA 3NCAA 3RRFA 4XF6A 3UBOA 1LIIA 3LHXA 3RTCA 3RT7A 2R3BA 3CQDA 4KBEA 3NL2A 4C5LA 2QHPA 3VASA 2NWHA 5C40A 1LHRA 2JG5A 2DDOA 3GO7A 1V19A 4LBXA 1C3QA 1DGMA 4S1MA 5EY7A 3GO6A 2AX3A 3RRBA 2JG1A 4YL5A 1UB0A 3NBWA 4S1HA 3RPZA 3RU2A 2AWDA 3RS9A 3PL2A 5C3YA 1RFUA 3RRJA 1L2LA 3FHXA 3UQDA 1RK2A 2PKFA 4JKUA 3UQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NC9 A;  3RM5 A;  1GQT A;  3NL3 A;  2ABQ A;  3LJS A;  3N1C A;  1TZ3 A;  3IBQ A;  4K93 A;  1RFT A;  4XCK A;  1KYH A;  2DDW A;  3DRW A;  3B1N A;  3NM3 A;  5TQI A;  4EN4 A;  3B1P A;  4KAH A;  1LIJ A;  3RTG A;  2R3E A;  4LCA A;  4K9I A;  4S1I B;  2PKK A;  2C4E A;  2JGV A;  3BF5 A;  3ZS7 A;  4GM6 A;  2C49 A;  3KZH A;  1V1B A;  1YGK A;  2AJP A;  1VK4 A;  5COJ A;  3NBV A;  2AFB A;  3IE7 A;  3VAQ A;  2DCN A;  2HW1 A;  2V78 A;  3IQ0 A;  4YWR A;  4DC3 A;  3GBU A;  4LC4 A;  1YHJ A;  2AJR A;  3HPD A;  4E3A A;  4E8W A;  3UMP A;  5EYN A;  3RQH A;  3Q92 A;  2AA0 A;  3RQQ A;  3RRE A;  3W4S A;  5BYD A;  1LIO A;  3HIC A;  1WYE A;  2XTB A;  3QAI A;  4S1I A;  3RQ8 A;  4LBG A;  3RTA A;  4EOH A;  1BX4 A;  3B1Q A;  4N08 A;  3KEU A;  3RQ5 A;  1JXH A;  3KTN A;  2A9Z A;  3RO4 A;  3KD6 A;  1ESJ A;  4DU5 A;  3RSQ A;  5C41 A;  3IH0 A;  2QCV A;  2RBC A;  3RS8 A;  3LKI A;  4E69 A;  4C5J A;  1GC5 A;  3PZS A;  2F7K A;  3RTE A;  3NC2 A;  3B1O A;  3NL6 A;  4B8R A;  2I6A A;  2ABS A;  4K8P A;  5B6A A;  4UBE A;  4K8T A;  4KAN A;  5C3Z A;  3LOO A;  1UA4 A;  3DZV A;  1VI9 A;  4E8Z A;  5CGE A;  1RKD A;  1V1A A;  4K8C A;  4XDA A;  3QA2 A;  3BGK A;  4PVV A;  3RU3 A;  3MBJ A;  3UQ6 A;  4B8S A;  3IN1 A;  4C5N A;  4E84 A;  3Q1Y A;  1JXI A;  5F0Z A;  4EBU A;  1TYY A;  2VAR A;  5BYF A;  5CM5 A;  4C5M A;  2HQQ A;  4N09 A;  4EUM A;  4JJP A;  1V1S A;  3RT9 A;  1EKK A;  4O1G A;  1LIK A;  3H49 A;  3NL5 A;  3RSS A;  5CGA A;  2PKN A;  3NM1 A;  4WJM A;  3OTX A;  2A9Y A;  4KAL A;  3RPH A;  3MBH A;  3RTB A;  5BYE A;  2I5B A;  3B1R A;  1VM7 A;  2HLZ A;  2PKM A;  1TZ6 A;  2YXT A;  1LHP A;  2YXU A;  3UMO A;  3H74 A;  4K8K A;  2AB8 A;  1RFV A;  1RKS A;  3RSF A;  4U7X A;  4JKS A;  4KAD A;  2FV7 A;  4O1L A;  4E8Y A;  3RY7 A;  5BYC A;  2F02 A;  3UQE A;  2I6B A;  1RKA A;  1U2X A;  3HYO A;  1EKQ A;  3B3L A;  3K9E A;  1YGJ A;  3IKH A;  3RQX A;  2DDM A;  2Q5R A;  4X8F A;  5TRW A;  1ESQ A;  3RTD A;  3EWM A;  3K5W A;  4K9C A;  3RSG A;  5F11 A;  3RQ2 A;  3FHY A;  3I3Y A;  3RQ6 A;  4XF7 A;  4C5K A;  1TD2 A;  3JUL A;  3NCA A;  3RRF A;  4XF6 A;  3UBO A;  1LII A;  3LHX A;  3RTC A;  3RT7 A;  2R3B A;  3CQD A;  4KBE A;  3NL2 A;  4C5L A;  2QHP A;  3VAS A;  2NWH A;  5C40 A;  1LHR A;  2JG5 A;  2DDO A;  3GO7 A;  1V19 A;  4LBX A;  1C3Q A;  1DGM A;  4S1M A;  5EY7 A;  3GO6 A;  2AX3 A;  3RRB A;  2JG1 A;  4YL5 A;  1UB0 A;  3NBW A;  4S1H A;  3RPZ A;  3RU2 A;  2AWD A;  3RS9 A;  3PL2 A;  5C3Y A;  1RFU A;  3RRJ A;  1L2L A;  3FHX A;  3UQD A;  1RK2 A;  2PKF A;  4JKU A;  3UQ9 A; 
#chains in the Genus database with same CATH topology
 3NC9 A;  3RM5 A;  1GQT A;  3NL3 A;  2ABQ A;  3LJS A;  3N1C A;  1TZ3 A;  3IBQ A;  4K93 A;  1RFT A;  4XCK A;  1KYH A;  2DDW A;  3DRW A;  3B1N A;  3NM3 A;  5TQI A;  4EN4 A;  3B1P A;  2JFF A;  4KAH A;  1LIJ A;  3RTG A;  3ZM6 A;  2R3E A;  4BUB A;  4LCA A;  4K9I A;  4S1I B;  2GC5 A;  2PKK A;  3N2A A;  2C4E A;  2GC6 A;  2JGV A;  3BF5 A;  3ZS7 A;  4GM6 A;  2C49 A;  1E0D A;  1V1B A;  1YGK A;  2AJP A;  1VK4 A;  3KZH A;  3NBV A;  3NRS A;  5COJ A;  1J6U A;  3ZM5 A;  1P3D A;  1EEH A;  2AFB A;  3IE7 A;  2DCN A;  2HW1 A;  2V78 A;  3IQ0 A;  4YWR A;  3VAQ A;  3PYZ A;  4DC3 A;  3GBU A;  2UUP A;  1YHJ A;  4LC4 A;  1JBV A;  2AJR A;  2Y68 A;  5A5F A;  3HPD A;  4E3A A;  4E8W A;  1JBW A;  3UMP A;  5EYN A;  3RQH A;  3Q92 A;  2AA0 A;  3RQQ A;  3RRE A;  3W4S A;  3HN7 A;  5BYD A;  2WJP A;  1LIO A;  3HIC A;  1WYE A;  2XTB A;  3QAI A;  4S1I A;  3RQ8 A;  4LBG A;  3RTA A;  4EOH A;  1BX4 A;  3B1Q A;  4N08 A;  3KEU A;  3RQ5 A;  3LK7 A;  1JXH A;  2X5O A;  2A9Z A;  3KTN A;  3RO4 A;  3KD6 A;  1ESJ A;  4DU5 A;  1GQQ A;  3RSQ A;  1P31 A;  2QCV A;  3IH0 A;  1O5Z A;  2RBC A;  3RS8 A;  3LKI A;  5C41 A;  4E69 A;  4C5J A;  1GC5 A;  3PZS A;  2F7K A;  3RTE A;  4C12 A;  3NC2 A;  3B1O A;  3NL6 A;  4B8R A;  2I6A A;  2ABS A;  4K8P A;  5B6A A;  4UBE A;  4K8T A;  4KAN A;  5C3Z A;  3LOO A;  1UA4 A;  2GCB A;  3DZV A;  1VI9 A;  2WTZ A;  4CVK A;  4E8Z A;  5CGE A;  1RKD A;  1V1A A;  4K8C A;  4XDA A;  3QA2 A;  1W7K A;  3BGK A;  4PVV A;  3RU3 A;  3MBJ A;  3UQ6 A;  4B8S A;  3HJ6 A;  3IN1 A;  4C5N A;  4E84 A;  3Q1Y A;  1JXI A;  4C13 A;  5F0Z A;  4EBU A;  1TYY A;  2VAR A;  3UAG A;  5CM5 A;  4C5M A;  4UAG A;  2AM2 A;  5BYF A;  1W78 A;  2HQQ A;  4N09 A;  4EUM A;  4JJP A;  1V1S A;  3ZL8 A;  3RT9 A;  1EKK A;  4O1G A;  1LIK A;  3H49 A;  3NL5 A;  3RSS A;  5CGA A;  2PKN A;  3NM1 A;  4WJM A;  1UAG A;  2XPC A;  3OTX A;  2GCA A;  2A9Y A;  4KAL A;  3RPH A;  3MBH A;  3RTB A;  5BYE A;  2I5B A;  3B1R A;  3EAG A;  1VM7 A;  2HLZ A;  2JFH A;  1TZ6 A;  2PKM A;  1LHP A;  2YXT A;  2YXU A;  3UMO A;  2Y67 A;  2Y1O A;  3H74 A;  1GG4 A;  4K8K A;  2AB8 A;  2VOS A;  1RFV A;  1RKS A;  3RSF A;  4U7X A;  4JKS A;  3QCZ A;  4KAD A;  2FV7 A;  4O1L A;  4ZIY A;  4HV4 A;  4BUC A;  4E8Y A;  3RY7 A;  4CVL A;  5BYC A;  2F02 A;  3UQE A;  2I6B A;  1RKA A;  2AM1 A;  2Y66 A;  1U2X A;  2XJA A;  3HYO A;  1EKQ A;  2UUO A;  3B3L A;  1YGJ A;  3IKH A;  3K9E A;  3RQX A;  2DDM A;  1E8C A;  2Q5R A;  4X8F A;  1ESQ A;  5TRW A;  2VTE A;  3RTD A;  3EWM A;  2JFG A;  2VOR A;  3K5W A;  4K9C A;  3RSG A;  3RQ2 A;  4QF5 A;  5F11 A;  3FHY A;  3I3Y A;  3RQ6 A;  4XF7 A;  4C5K A;  1TD2 A;  3JUL A;  3NCA A;  3RRF A;  4XF6 A;  3UBO A;  1LII A;  2UAG A;  4QDI A;  3LHX A;  3RTC A;  3RT7 A;  2R3B A;  3CQD A;  4KBE A;  3NL2 A;  4C5L A;  2QHP A;  4CVM A;  3VAS A;  2NWH A;  5C40 A;  1LHR A;  2JG5 A;  2DDO A;  3GO7 A;  1V19 A;  4LBX A;  1C3Q A;  1DGM A;  4S1M A;  5EY7 A;  3GO6 A;  2AX3 A;  3RRB A;  1GQY A;  2JG1 A;  4YL5 A;  1UB0 A;  3NBW A;  4S1H A;  3RPZ A;  3RU2 A;  2F00 A;  2AWD A;  3RS9 A;  3PL2 A;  5C3Y A;  1RFU A;  3RRJ A;  1FGS A;  1L2L A;  2VTD A;  3FHX A;  3UQD A;  5A5E A;  1RK2 A;  2PKF A;  4JKU A;  3UQ9 A; 
#chains in the Genus database with same CATH homology
 3NC9 A;  3RM5 A;  1GQT A;  3NL3 A;  2ABQ A;  3LJS A;  3N1C A;  1TZ3 A;  3IBQ A;  4K93 A;  1RFT A;  4XCK A;  1KYH A;  2DDW A;  3DRW A;  3B1N A;  3NM3 A;  5TQI A;  4EN4 A;  3B1P A;  4KAH A;  1LIJ A;  3RTG A;  2R3E A;  4LCA A;  4K9I A;  4S1I B;  2PKK A;  2C4E A;  2JGV A;  3BF5 A;  3ZS7 A;  4GM6 A;  2C49 A;  3KZH A;  1V1B A;  1YGK A;  2AJP A;  1VK4 A;  5COJ A;  3NBV A;  2AFB A;  3IE7 A;  3VAQ A;  2DCN A;  2HW1 A;  2V78 A;  3IQ0 A;  4YWR A;  4DC3 A;  3GBU A;  4LC4 A;  1YHJ A;  2AJR A;  3HPD A;  4E3A A;  4E8W A;  3UMP A;  5EYN A;  3RQH A;  3Q92 A;  2AA0 A;  3RQQ A;  3RRE A;  3W4S A;  5BYD A;  1LIO A;  3HIC A;  1WYE A;  2XTB A;  3QAI A;  4S1I A;  3RQ8 A;  4LBG A;  3RTA A;  4EOH A;  1BX4 A;  3B1Q A;  4N08 A;  3KEU A;  3RQ5 A;  1JXH A;  3KTN A;  2A9Z A;  3RO4 A;  3KD6 A;  1ESJ A;  4DU5 A;  3RSQ A;  5C41 A;  3IH0 A;  2QCV A;  2RBC A;  3RS8 A;  3LKI A;  4E69 A;  4C5J A;  1GC5 A;  3PZS A;  2F7K A;  3RTE A;  3NC2 A;  3B1O A;  3NL6 A;  4B8R A;  2I6A A;  2ABS A;  4K8P A;  5B6A A;  4UBE A;  4K8T A;  4KAN A;  5C3Z A;  3LOO A;  1UA4 A;  3DZV A;  1VI9 A;  4E8Z A;  5CGE A;  1RKD A;  1V1A A;  4K8C A;  4XDA A;  3QA2 A;  3BGK A;  4PVV A;  3RU3 A;  3MBJ A;  3UQ6 A;  4B8S A;  3HJ6 A;  3IN1 A;  4C5N A;  4E84 A;  3Q1Y A;  1JXI A;  5F0Z A;  4EBU A;  1TYY A;  2VAR A;  5BYF A;  5CM5 A;  4C5M A;  2HQQ A;  4N09 A;  4EUM A;  4JJP A;  1V1S A;  3RT9 A;  1EKK A;  4O1G A;  1LIK A;  3H49 A;  3NL5 A;  3RSS A;  5CGA A;  2PKN A;  3NM1 A;  4WJM A;  3OTX A;  2A9Y A;  4KAL A;  3RPH A;  3MBH A;  3RTB A;  5BYE A;  2I5B A;  3B1R A;  1VM7 A;  2HLZ A;  2PKM A;  1TZ6 A;  2YXT A;  1LHP A;  2YXU A;  3UMO A;  3H74 A;  4K8K A;  2AB8 A;  1RFV A;  1RKS A;  3RSF A;  4U7X A;  4JKS A;  4KAD A;  2FV7 A;  4O1L A;  4E8Y A;  3RY7 A;  5BYC A;  2F02 A;  3UQE A;  2I6B A;  1RKA A;  1U2X A;  3HYO A;  1EKQ A;  3B3L A;  3K9E A;  1YGJ A;  3IKH A;  3RQX A;  2DDM A;  2Q5R A;  4X8F A;  5TRW A;  1ESQ A;  3RTD A;  3EWM A;  3K5W A;  4K9C A;  3RSG A;  5F11 A;  3RQ2 A;  3FHY A;  3I3Y A;  3RQ6 A;  4XF7 A;  4C5K A;  1TD2 A;  3JUL A;  3NCA A;  3RRF A;  4XF6 A;  3UBO A;  1LII A;  3LHX A;  3RTC A;  3RT7 A;  2R3B A;  3CQD A;  4KBE A;  3NL2 A;  4C5L A;  2QHP A;  3VAS A;  2NWH A;  5C40 A;  1LHR A;  2JG5 A;  2DDO A;  3GO7 A;  1V19 A;  4LBX A;  1C3Q A;  1DGM A;  4S1M A;  5EY7 A;  3GO6 A;  2AX3 A;  3RRB A;  2JG1 A;  4YL5 A;  1UB0 A;  3NBW A;  4S1H A;  3RPZ A;  3RU2 A;  2AWD A;  3RS9 A;  3PL2 A;  5C3Y A;  1RFU A;  3RRJ A;  1L2L A;  3FHX A;  3UQD A;  1RK2 A;  2PKF A;  4JKU A;  3UQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...