4DC3A

Adenosine kinase from schistosoma mansoni in complex with 2-fluoroadenosine
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
344
structure length
339
Chain Sequence
LSEGYVFGMGNPLLDIIVDADDFMYRKYNLKKDNIVLAEEKHMTIYDEIQKKKKLNYIAGGATLNTVKMIQWIIQKPFVCSYVGCIGADIQGKYIKNDCSALDLVTEFQIAEEPLMTGKVAVLVSRSMVTYLGAACDLSLAHIEQPHVWSLVEKAQVYYIAGFVINTCYEGMLKIAKHSLENEKLFCFNLSAPFLSQFNTKEVDEMISYSNIVFGNESEAEAYGEVHGLLEDTVHATARYIADLPFADGKKRKRLVIITRGKNPLLYTDSSDSEIHQFMVEQFKDDQIIDGAGDAFAAGFIADYIRGKPMITSLHAAVKAAAYIICRSGFSLGSRDSYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Adenosine kinase from Schistosoma mansoni: structural basis for the differential incorporation of nucleoside analogues.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Transferase
molecule keywords Adenosine kinase
total genus 116
structure length 339
sequence length 344
chains with identical sequence B
ec nomenclature ec 2.7.1.20: Adenosine kinase.
pdb deposition date 2012-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1110.10 Alpha Beta 2-Layer Sandwich Adenosine kinase, small domain Adenosine kinase, small domain 4dc3A02
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 4dc3A01
3UQ9A 1LIKA 5COJA 4KADA 5C3ZA 2AFBA 4O1LA 2JG1A 4EUMA 5F0ZA 5TQIA 1TD2A 4K93A 3QA2A 3KTNA 1RFTA 1UB0A 1RK2A 1V1BA 4LC4A 4K8PA 4XF7A 3RQ6A 3RQ5A 1V1SA 4XF6A 3UMPA 4K8CA 1ESJA 3RQHA 4LBXA 4S1MA 5TRWA 3RSGA 1C3QA 1EKKA 3RRJA 1LIOA 1ESQA 4E84A 3LKIA 4X8FA 3GO6A 1LHPA 3B1PA 1U2XA 2R3BA 3UQEA 5BYEA 4DU5A 4B8RA 5B6AA 3B3LA 3KZHA 4C5MA 5BYDA 3IE7A 4JKSA 3RQ2A 3IN1A 1JXIA 3B1NA 3W4SA 1VM7A 2JG5A 3K5WA 3RTBA 2PKNA 3NM1A 4KALA 4B8SA 3RPZA 1RKSA 3RTEA 1UA4A 5BYCA 1EKQA 2VARA 3HICA 3UBOA 4S1IA 3RPHA 3NL5A 2DCNA 4LCAA 2C49A 5C40A 1TYYA 4GM6A 3NL6A 3IH0A 4N08A 3HPDA 3NBVA 3DRWA 4KAHA 3RSFA 3PZSA 2ABQA 2AB8A 3B1OA 4JKUA 3RM5A 3RRBA 4JJPA 2AWDA 4E69A 2A9YA 3HYOA 3RQQA 5BYFA 4K9IA 3VASA 2I6BA 4KBEA 3NBWA 1LIJA 3DZVA 4C5NA 4C5JA 4UBEA 2ABSA 3GO7A 3H49A 3IQ0A 2DDMA 3JULA 3RS9A 3VAQA 2HLZA 3NL3A 1VI9A 3Q1YA 3RU3A 3RQXA 2V78A 3MBJA 3NL2A 1RFUA 2NWHA 1WYEA 4E8WA 1GQTA 1RFVA 3KEUA 5F11A 2F02A 2F7KA 3B1QA 1LHRA 3RSQA 5C41A 5CGAA 3ZS7A 1RKAA 1JXHA 3MBHA 4PVVA 2AA0A 3BGKA 4KANA 4LBGA 1DGMA 4YWRA 3RTAA 4C5LA 3IKHA 4EOHA 2C4EA 4C5KA 1YGKA 2A9ZA 3PL2A 3RY7A 4S1IB 3LJSA 2HW1A 1L2LA 3NC9A 3UMOA 3KD6A 3RTGA 3LHXA 2AJRA 3RT7A 2PKKA 1RKDA 1V19A 2FV7A 2DDOA 2QHPA 3FHYA 1YHJA 2DDWA 2PKMA 3IBQA 4K9CA 4E8YA 4EBUA 1V1AA 5C3YA 5EYNA 1LIIA 3RO4A 3RTCA 3RQ8A 4XDAA 1TZ3A 2XTBA 2I5BA 2PKFA 1YGJA 5CGEA 4XCKA 3RTDA 3BF5A 1GC5A 3I3YA 3NM3A 3FHXA 3UQ6A 3NC2A 4YL5A 4S1HA 2RBCA 2YXUA 2YXTA 3RREA 3NCAA 2JGVA 4K8TA 4WJMA 4K8KA 3RT9A 3H74A 3QAIA 4DC3A 4N09A 3RRFA 2AJPA 3RU2A 3GBUA 1TZ6A 3CQDA 5EY7A 4E3AA 1BX4A 2Q5RA 4O1GA 3UQDA 2HQQA 4E8ZA 4EN4A 3LOOA 2R3EA 3N1CA 1VK4A 3RS8A 1KYHA 3B1RA 2AX3A 2QCVA 3OTXA 3K9EA 3Q92A 4U7XA 3EWMA 5CM5A 2I6AA 3RSSA
chains in the Genus database with same CATH superfamily
3UQ9A 2WJPA 1LIKA 5COJA 2AM1A 4KADA 2AFBA 4O1LA 2JG1A 4EUMA 5C3ZA 5F0ZA 5TQIA 1TD2A 2F00A 3QA2A 4K93A 3KTNA 1RFTA 1UB0A 1RK2A 1V1BA 2UUPA 4K8PA 4LC4A 4XF7A 3RQ6A 1V1SA 4XF6A 3RQ5A 3UMPA 4K8CA 1ESJA 4C13A 3RQHA 4LBXA 4S1MA 5TRWA 3RSGA 1C3QA 2XJAA 1EKKA 3RRJA 1LIOA 4HV4A 1ESQA 4E84A 3LKIA 4X8FA 3GO6A 1LHPA 3B1PA 1U2XA 2R3BA 3UQEA 5BYEA 4DU5A 4B8RA 5B6AA 3B3LA 3KZHA 4C5MA 2VOSA 3IE7A 3LK7A 4JKSA 5BYDA 5C3YA 3RQ2A 3IN1A 1JXIA 3B1NA 3W4SA 4QF5A 1VM7A 2JG5A 3K5WA 4CVLA 3RTBA 3UAGA 2PKNA 3NM1A 4KALA 4B8SA 3RPZA 1RKSA 3RTEA 1UA4A 5BYCA 1EKQA 2AM2A 2VARA 1JBWA 3HICA 3UBOA 4S1IA 3RPHA 1J6UA 3NL5A 2DCNA 2JFGA 4LCAA 2GCBA 2Y67A 2C49A 5C40A 1W7KA 1TYYA 4GM6A 3NL6A 3IH0A 3QCZA 4N08A 3HPDA 4E8ZA 3NBVA 3DRWA 2GC6A 4KAHA 3RSFA 3ZM5A 3PZSA 2ABQA 2AB8A 3B1OA 4JKUA 2GC5A 3RM5A 2GCAA 3RRBA 2UUOA 4JJPA 2AWDA 2Y1OA 4E69A 2A9YA 3HYOA 3RQQA 5BYFA 1FGSA 2X5OA 4K9IA 2I6BA 3VASA 4KBEA 3NBWA 1LIJA 1O5ZA 2UAGA 3N2AA 3DZVA 4C5NA 4C5JA 4UBEA 2ABSA 3GO7A 3H49A 3IQ0A 3HJ6A 2DDMA 2WTZA 3JULA 3RS9A 3VAQA 2HLZA 3NL3A 1VI9A 3Q1YA 4CVMA 3ZL8A 3RU3A 3RQXA 2V78A 3MBJA 3NL2A 1GQYA 1RFUA 2NWHA 1WYEA 4E8WA 1GQTA 1RFVA 3KEUA 5F11A 2F02A 2F7KA 3B1QA 1LHRA 3RSQA 1P31A 4EBUA 5C41A 5CGAA 3ZS7A 4EOHA 1RKAA 1JXHA 1UAGA 3MBHA 4PVVA 2AA0A 3BGKA 4KANA 4LBGA 1DGMA 2Y66A 4YWRA 3RTAA 2JFFA 3IKHA 4C5LA 2C4EA 4C5KA 1YGKA 2A9ZA 3PL2A 3RY7A 4S1IB 3LJSA 2HW1A 3FHYA 1L2LA 3NC9A 3UMOA 2JFHA 3KD6A 3RTGA 3LHXA 2AJRA 3RT7A 4ZIYA 2PKKA 1RKDA 1V19A 2FV7A 2DDOA 2QHPA 3EAGA 1YHJA 2DDWA 2PKMA 3IBQA 4K9CA 4QDIA 4BUBA 1V1AA 4E8YA 5A5EA 5EYNA 1LIIA 1JBVA 3NRSA 3RO4A 1GQQA 3RTCA 2Y68A 3RQ8A 4XDAA 1TZ3A 2XTBA 2I5BA 2PKFA 1YGJA 5CGEA 4XCKA 4C12A 3RTDA 3BF5A 2VTEA 1GC5A 3I3YA 3NM3A 1P3DA 1W78A 2VORA 1E0DA 3FHXA 3UQ6A 3NC2A 4YL5A 4S1HA 2RBCA 2YXUA 2YXTA 3RREA 3NCAA 3ZM6A 2JGVA 4K8TA 4WJMA 4K8KA 3RT9A 3H74A 3QAIA 4DC3A 4N09A 3RRFA 2AJPA 3RU2A 4BUCA 3GBUA 1TZ6A 3CQDA 5EY7A 4E3AA 1E8CA 2XPCA 1BX4A 2Q5RA 2VTDA 4O1GA 3UQDA 1EEHA 2HQQA 1GG4A 4UAGA 3LOOA 2R3EA 3N1CA 1VK4A 3RS8A 1KYHA 3B1RA 4EN4A 4CVKA 5A5FA 2AX3A 2QCVA 3OTXA 3HN7A 3K9EA 3Q92A 4U7XA 3EWMA 3PYZA 5CM5A 2I6AA 3RSSA
chains in the Genus database with same CATH topology
3UQ9A 1LIKA 5COJA 4KADA 5C3ZA 2AFBA 4O1LA 2JG1A 4EUMA 5F0ZA 5TQIA 1TD2A 4K93A 3QA2A 3KTNA 1RFTA 1UB0A 1RK2A 1V1BA 4LC4A 4K8PA 4XF7A 3RQ6A 3RQ5A 1V1SA 4XF6A 3UMPA 4K8CA 1ESJA 3RQHA 4LBXA 4S1MA 5TRWA 3RSGA 1C3QA 1EKKA 3RRJA 1LIOA 1ESQA 4E84A 3LKIA 4X8FA 3GO6A 1LHPA 3B1PA 1U2XA 2R3BA 3UQEA 5BYEA 4DU5A 4B8RA 5B6AA 3B3LA 3KZHA 4C5MA 5BYDA 3IE7A 4JKSA 3RQ2A 3IN1A 1JXIA 3B1NA 3W4SA 1VM7A 2JG5A 3K5WA 3RTBA 2PKNA 3NM1A 4KALA 4B8SA 3RPZA 1RKSA 3RTEA 1UA4A 5BYCA 1EKQA 2VARA 3HICA 3UBOA 4S1IA 3RPHA 3NL5A 2DCNA 4LCAA 2C49A 5C40A 1TYYA 4GM6A 3NL6A 3IH0A 4N08A 3HPDA 3NBVA 3DRWA 4KAHA 3RSFA 3PZSA 2ABQA 2AB8A 3B1OA 4JKUA 3RM5A 3RRBA 4JJPA 2AWDA 4E69A 2A9YA 3HYOA 3RQQA 5BYFA 4K9IA 2I6BA 3VASA 4KBEA 3NBWA 1LIJA 3DZVA 4C5NA 4C5JA 4UBEA 2ABSA 3GO7A 3H49A 3IQ0A 3HJ6A 2DDMA 3JULA 3RS9A 3VAQA 2HLZA 3NL3A 1VI9A 3Q1YA 3RU3A 3RQXA 2V78A 3MBJA 3NL2A 1RFUA 2NWHA 1WYEA 4E8WA 1GQTA 1RFVA 3KEUA 5F11A 2F02A 2F7KA 3B1QA 1LHRA 3RSQA 5C41A 5CGAA 3ZS7A 1RKAA 1JXHA 3MBHA 4PVVA 2AA0A 3BGKA 4KANA 4LBGA 1DGMA 4YWRA 3RTAA 4C5LA 3IKHA 4EOHA 2C4EA 4C5KA 1YGKA 2A9ZA 3PL2A 3RY7A 4S1IB 3LJSA 2HW1A 1L2LA 3NC9A 3UMOA 3KD6A 3RTGA 3LHXA 2AJRA 3RT7A 2PKKA 1RKDA 1V19A 2FV7A 2DDOA 2QHPA 3FHYA 1YHJA 2DDWA 2PKMA 3IBQA 4K9CA 4E8YA 4EBUA 1V1AA 5C3YA 5EYNA 1LIIA 3RO4A 3RTCA 3RQ8A 4XDAA 1TZ3A 2XTBA 2I5BA 2PKFA 1YGJA 5CGEA 4XCKA 3RTDA 3BF5A 1GC5A 3I3YA 3NM3A 3FHXA 3UQ6A 3NC2A 4YL5A 4S1HA 2RBCA 2YXUA 2YXTA 3RREA 3NCAA 2JGVA 4K8TA 4WJMA 4K8KA 3RT9A 3H74A 3QAIA 4DC3A 4N09A 3RRFA 2AJPA 3RU2A 3GBUA 1TZ6A 3CQDA 5EY7A 4E3AA 1BX4A 2Q5RA 4O1GA 3UQDA 2HQQA 4E8ZA 4EN4A 3LOOA 2R3EA 3N1CA 1VK4A 3RS8A 1KYHA 3B1RA 2AX3A 2QCVA 3OTXA 3K9EA 3Q92A 4U7XA 3EWMA 5CM5A 2I6AA 3RSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UQ9 A;  1LIK A;  5COJ A;  4KAD A;  5C3Z A;  2AFB A;  4O1L A;  2JG1 A;  4EUM A;  5F0Z A;  5TQI A;  1TD2 A;  4K93 A;  3QA2 A;  3KTN A;  1RFT A;  1UB0 A;  1RK2 A;  1V1B A;  4LC4 A;  4K8P A;  4XF7 A;  3RQ6 A;  3RQ5 A;  1V1S A;  4XF6 A;  3UMP A;  4K8C A;  1ESJ A;  3RQH A;  4LBX A;  4S1M A;  5TRW A;  3RSG A;  1C3Q A;  1EKK A;  3RRJ A;  1LIO A;  1ESQ A;  4E84 A;  3LKI A;  4X8F A;  3GO6 A;  1LHP A;  3B1P A;  1U2X A;  2R3B A;  3UQE A;  5BYE A;  4DU5 A;  4B8R A;  5B6A A;  3B3L A;  3KZH A;  4C5M A;  5BYD A;  3IE7 A;  4JKS A;  3RQ2 A;  3IN1 A;  1JXI A;  3B1N A;  3W4S A;  1VM7 A;  2JG5 A;  3K5W A;  3RTB A;  2PKN A;  3NM1 A;  4KAL A;  4B8S A;  3RPZ A;  1RKS A;  3RTE A;  1UA4 A;  5BYC A;  1EKQ A;  2VAR A;  3HIC A;  3UBO A;  4S1I A;  3RPH A;  3NL5 A;  2DCN A;  4LCA A;  2C49 A;  5C40 A;  1TYY A;  4GM6 A;  3NL6 A;  3IH0 A;  4N08 A;  3HPD A;  3NBV A;  3DRW A;  4KAH A;  3RSF A;  3PZS A;  2ABQ A;  2AB8 A;  3B1O A;  4JKU A;  3RM5 A;  3RRB A;  4JJP A;  2AWD A;  4E69 A;  2A9Y A;  3HYO A;  3RQQ A;  5BYF A;  4K9I A;  3VAS A;  2I6B A;  4KBE A;  3NBW A;  1LIJ A;  3DZV A;  4C5N A;  4C5J A;  4UBE A;  2ABS A;  3GO7 A;  3H49 A;  3IQ0 A;  2DDM A;  3JUL A;  3RS9 A;  3VAQ A;  2HLZ A;  3NL3 A;  1VI9 A;  3Q1Y A;  3RU3 A;  3RQX A;  2V78 A;  3MBJ A;  3NL2 A;  1RFU A;  2NWH A;  1WYE A;  4E8W A;  1GQT A;  1RFV A;  3KEU A;  5F11 A;  2F02 A;  2F7K A;  3B1Q A;  1LHR A;  3RSQ A;  5C41 A;  5CGA A;  3ZS7 A;  1RKA A;  1JXH A;  3MBH A;  4PVV A;  2AA0 A;  3BGK A;  4KAN A;  4LBG A;  1DGM A;  4YWR A;  3RTA A;  4C5L A;  3IKH A;  4EOH A;  2C4E A;  4C5K A;  1YGK A;  2A9Z A;  3PL2 A;  3RY7 A;  4S1I B;  3LJS A;  2HW1 A;  1L2L A;  3NC9 A;  3UMO A;  3KD6 A;  3RTG A;  3LHX A;  2AJR A;  3RT7 A;  2PKK A;  1RKD A;  1V19 A;  2FV7 A;  2DDO A;  2QHP A;  3FHY A;  1YHJ A;  2DDW A;  2PKM A;  3IBQ A;  4K9C A;  4E8Y A;  4EBU A;  1V1A A;  5C3Y A;  5EYN A;  1LII A;  3RO4 A;  3RTC A;  3RQ8 A;  4XDA A;  1TZ3 A;  2XTB A;  2I5B A;  2PKF A;  1YGJ A;  5CGE A;  4XCK A;  3RTD A;  3BF5 A;  1GC5 A;  3I3Y A;  3NM3 A;  3FHX A;  3UQ6 A;  3NC2 A;  4YL5 A;  4S1H A;  2RBC A;  2YXU A;  2YXT A;  3RRE A;  3NCA A;  2JGV A;  4K8T A;  4WJM A;  4K8K A;  3RT9 A;  3H74 A;  3QAI A;  4DC3 A;  4N09 A;  3RRF A;  2AJP A;  3RU2 A;  3GBU A;  1TZ6 A;  3CQD A;  5EY7 A;  4E3A A;  1BX4 A;  2Q5R A;  4O1G A;  3UQD A;  2HQQ A;  4E8Z A;  4EN4 A;  3LOO A;  2R3E A;  3N1C A;  1VK4 A;  3RS8 A;  1KYH A;  3B1R A;  2AX3 A;  2QCV A;  3OTX A;  3K9E A;  3Q92 A;  4U7X A;  3EWM A;  5CM5 A;  2I6A A;  3RSS A; 
#chains in the Genus database with same CATH topology
 3UQ9 A;  2WJP A;  1LIK A;  5COJ A;  2AM1 A;  4KAD A;  2AFB A;  4O1L A;  2JG1 A;  4EUM A;  5C3Z A;  5F0Z A;  5TQI A;  1TD2 A;  2F00 A;  3QA2 A;  4K93 A;  3KTN A;  1RFT A;  1UB0 A;  1RK2 A;  1V1B A;  2UUP A;  4K8P A;  4LC4 A;  4XF7 A;  3RQ6 A;  1V1S A;  4XF6 A;  3RQ5 A;  3UMP A;  4K8C A;  1ESJ A;  4C13 A;  3RQH A;  4LBX A;  4S1M A;  5TRW A;  3RSG A;  1C3Q A;  2XJA A;  1EKK A;  3RRJ A;  1LIO A;  4HV4 A;  1ESQ A;  4E84 A;  3LKI A;  4X8F A;  3GO6 A;  1LHP A;  3B1P A;  1U2X A;  2R3B A;  3UQE A;  5BYE A;  4DU5 A;  4B8R A;  5B6A A;  3B3L A;  3KZH A;  4C5M A;  2VOS A;  3IE7 A;  3LK7 A;  4JKS A;  5BYD A;  5C3Y A;  3RQ2 A;  3IN1 A;  1JXI A;  3B1N A;  3W4S A;  4QF5 A;  1VM7 A;  2JG5 A;  3K5W A;  4CVL A;  3RTB A;  3UAG A;  2PKN A;  3NM1 A;  4KAL A;  4B8S A;  3RPZ A;  1RKS A;  3RTE A;  1UA4 A;  5BYC A;  1EKQ A;  2AM2 A;  2VAR A;  1JBW A;  3HIC A;  3UBO A;  4S1I A;  3RPH A;  1J6U A;  3NL5 A;  2DCN A;  2JFG A;  4LCA A;  2GCB A;  2Y67 A;  2C49 A;  5C40 A;  1W7K A;  1TYY A;  4GM6 A;  3NL6 A;  3IH0 A;  3QCZ A;  4N08 A;  3HPD A;  4E8Z A;  3NBV A;  3DRW A;  2GC6 A;  4KAH A;  3RSF A;  3ZM5 A;  3PZS A;  2ABQ A;  2AB8 A;  3B1O A;  4JKU A;  2GC5 A;  3RM5 A;  2GCA A;  3RRB A;  2UUO A;  4JJP A;  2AWD A;  2Y1O A;  4E69 A;  2A9Y A;  3HYO A;  3RQQ A;  5BYF A;  1FGS A;  2X5O A;  4K9I A;  2I6B A;  3VAS A;  4KBE A;  3NBW A;  1LIJ A;  1O5Z A;  2UAG A;  3N2A A;  3DZV A;  4C5N A;  4C5J A;  4UBE A;  2ABS A;  3GO7 A;  3H49 A;  3IQ0 A;  3HJ6 A;  2DDM A;  2WTZ A;  3JUL A;  3RS9 A;  3VAQ A;  2HLZ A;  3NL3 A;  1VI9 A;  3Q1Y A;  4CVM A;  3ZL8 A;  3RU3 A;  3RQX A;  2V78 A;  3MBJ A;  3NL2 A;  1GQY A;  1RFU A;  2NWH A;  1WYE A;  4E8W A;  1GQT A;  1RFV A;  3KEU A;  5F11 A;  2F02 A;  2F7K A;  3B1Q A;  1LHR A;  3RSQ A;  1P31 A;  4EBU A;  5C41 A;  5CGA A;  3ZS7 A;  4EOH A;  1RKA A;  1JXH A;  1UAG A;  3MBH A;  4PVV A;  2AA0 A;  3BGK A;  4KAN A;  4LBG A;  1DGM A;  2Y66 A;  4YWR A;  3RTA A;  2JFF A;  3IKH A;  4C5L A;  2C4E A;  4C5K A;  1YGK A;  2A9Z A;  3PL2 A;  3RY7 A;  4S1I B;  3LJS A;  2HW1 A;  3FHY A;  1L2L A;  3NC9 A;  3UMO A;  2JFH A;  3KD6 A;  3RTG A;  3LHX A;  2AJR A;  3RT7 A;  4ZIY A;  2PKK A;  1RKD A;  1V19 A;  2FV7 A;  2DDO A;  2QHP A;  3EAG A;  1YHJ A;  2DDW A;  2PKM A;  3IBQ A;  4K9C A;  4QDI A;  4BUB A;  1V1A A;  4E8Y A;  5A5E A;  5EYN A;  1LII A;  1JBV A;  3NRS A;  3RO4 A;  1GQQ A;  3RTC A;  2Y68 A;  3RQ8 A;  4XDA A;  1TZ3 A;  2XTB A;  2I5B A;  2PKF A;  1YGJ A;  5CGE A;  4XCK A;  4C12 A;  3RTD A;  3BF5 A;  2VTE A;  1GC5 A;  3I3Y A;  3NM3 A;  1P3D A;  1W78 A;  2VOR A;  1E0D A;  3FHX A;  3UQ6 A;  3NC2 A;  4YL5 A;  4S1H A;  2RBC A;  2YXU A;  2YXT A;  3RRE A;  3NCA A;  3ZM6 A;  2JGV A;  4K8T A;  4WJM A;  4K8K A;  3RT9 A;  3H74 A;  3QAI A;  4DC3 A;  4N09 A;  3RRF A;  2AJP A;  3RU2 A;  4BUC A;  3GBU A;  1TZ6 A;  3CQD A;  5EY7 A;  4E3A A;  1E8C A;  2XPC A;  1BX4 A;  2Q5R A;  2VTD A;  4O1G A;  3UQD A;  1EEH A;  2HQQ A;  1GG4 A;  4UAG A;  3LOO A;  2R3E A;  3N1C A;  1VK4 A;  3RS8 A;  1KYH A;  3B1R A;  4EN4 A;  4CVK A;  5A5F A;  2AX3 A;  2QCV A;  3OTX A;  3HN7 A;  3K9E A;  3Q92 A;  4U7X A;  3EWM A;  3PYZ A;  5CM5 A;  2I6A A;  3RSS A; 
#chains in the Genus database with same CATH homology
 3UQ9 A;  1LIK A;  5COJ A;  4KAD A;  5C3Z A;  2AFB A;  4O1L A;  2JG1 A;  4EUM A;  5F0Z A;  5TQI A;  1TD2 A;  4K93 A;  3QA2 A;  3KTN A;  1RFT A;  1UB0 A;  1RK2 A;  1V1B A;  4LC4 A;  4K8P A;  4XF7 A;  3RQ6 A;  3RQ5 A;  1V1S A;  4XF6 A;  3UMP A;  4K8C A;  1ESJ A;  3RQH A;  4LBX A;  4S1M A;  5TRW A;  3RSG A;  1C3Q A;  1EKK A;  3RRJ A;  1LIO A;  1ESQ A;  4E84 A;  3LKI A;  4X8F A;  3GO6 A;  1LHP A;  3B1P A;  1U2X A;  2R3B A;  3UQE A;  5BYE A;  4DU5 A;  4B8R A;  5B6A A;  3B3L A;  3KZH A;  4C5M A;  5BYD A;  3IE7 A;  4JKS A;  3RQ2 A;  3IN1 A;  1JXI A;  3B1N A;  3W4S A;  1VM7 A;  2JG5 A;  3K5W A;  3RTB A;  2PKN A;  3NM1 A;  4KAL A;  4B8S A;  3RPZ A;  1RKS A;  3RTE A;  1UA4 A;  5BYC A;  1EKQ A;  2VAR A;  3HIC A;  3UBO A;  4S1I A;  3RPH A;  3NL5 A;  2DCN A;  4LCA A;  2C49 A;  5C40 A;  1TYY A;  4GM6 A;  3NL6 A;  3IH0 A;  4N08 A;  3HPD A;  3NBV A;  3DRW A;  4KAH A;  3RSF A;  3PZS A;  2ABQ A;  2AB8 A;  3B1O A;  4JKU A;  3RM5 A;  3RRB A;  4JJP A;  2AWD A;  4E69 A;  2A9Y A;  3HYO A;  3RQQ A;  5BYF A;  4K9I A;  2I6B A;  3VAS A;  4KBE A;  3NBW A;  1LIJ A;  3DZV A;  4C5N A;  4C5J A;  4UBE A;  2ABS A;  3GO7 A;  3H49 A;  3IQ0 A;  3HJ6 A;  2DDM A;  3JUL A;  3RS9 A;  3VAQ A;  2HLZ A;  3NL3 A;  1VI9 A;  3Q1Y A;  3RU3 A;  3RQX A;  2V78 A;  3MBJ A;  3NL2 A;  1RFU A;  2NWH A;  1WYE A;  4E8W A;  1GQT A;  1RFV A;  3KEU A;  5F11 A;  2F02 A;  2F7K A;  3B1Q A;  1LHR A;  3RSQ A;  5C41 A;  5CGA A;  3ZS7 A;  1RKA A;  1JXH A;  3MBH A;  4PVV A;  2AA0 A;  3BGK A;  4KAN A;  4LBG A;  1DGM A;  4YWR A;  3RTA A;  4C5L A;  3IKH A;  4EOH A;  2C4E A;  4C5K A;  1YGK A;  2A9Z A;  3PL2 A;  3RY7 A;  4S1I B;  3LJS A;  2HW1 A;  1L2L A;  3NC9 A;  3UMO A;  3KD6 A;  3RTG A;  3LHX A;  2AJR A;  3RT7 A;  2PKK A;  1RKD A;  1V19 A;  2FV7 A;  2DDO A;  2QHP A;  3FHY A;  1YHJ A;  2DDW A;  2PKM A;  3IBQ A;  4K9C A;  4E8Y A;  4EBU A;  1V1A A;  5C3Y A;  5EYN A;  1LII A;  3RO4 A;  3RTC A;  3RQ8 A;  4XDA A;  1TZ3 A;  2XTB A;  2I5B A;  2PKF A;  1YGJ A;  5CGE A;  4XCK A;  3RTD A;  3BF5 A;  1GC5 A;  3I3Y A;  3NM3 A;  3FHX A;  3UQ6 A;  3NC2 A;  4YL5 A;  4S1H A;  2RBC A;  2YXU A;  2YXT A;  3RRE A;  3NCA A;  2JGV A;  4K8T A;  4WJM A;  4K8K A;  3RT9 A;  3H74 A;  3QAI A;  4DC3 A;  4N09 A;  3RRF A;  2AJP A;  3RU2 A;  3GBU A;  1TZ6 A;  3CQD A;  5EY7 A;  4E3A A;  1BX4 A;  2Q5R A;  4O1G A;  3UQD A;  2HQQ A;  4E8Z A;  4EN4 A;  3LOO A;  2R3E A;  3N1C A;  1VK4 A;  3RS8 A;  1KYH A;  3B1R A;  2AX3 A;  2QCV A;  3OTX A;  3K9E A;  3Q92 A;  4U7X A;  3EWM A;  5CM5 A;  2I6A A;  3RSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...