4DC3A

Adenosine kinase from schistosoma mansoni in complex with 2-fluoroadenosine
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
344
structure length
339
Chain Sequence
LSEGYVFGMGNPLLDIIVDADDFMYRKYNLKKDNIVLAEEKHMTIYDEIQKKKKLNYIAGGATLNTVKMIQWIIQKPFVCSYVGCIGADIQGKYIKNDCSALDLVTEFQIAEEPLMTGKVAVLVSRSMVTYLGAACDLSLAHIEQPHVWSLVEKAQVYYIAGFVINTCYEGMLKIAKHSLENEKLFCFNLSAPFLSQFNTKEVDEMISYSNIVFGNESEAEAYGEVHGLLEDTVHATARYIADLPFADGKKRKRLVIITRGKNPLLYTDSSDSEIHQFMVEQFKDDQIIDGAGDAFAAGFIADYIRGKPMITSLHAAVKAAAYIICRSGFSLGSRDSYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Adenosine kinase from Schistosoma mansoni: structural basis for the differential incorporation of nucleoside analogues.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Transferase
molecule keywords Adenosine kinase
total genus 116
structure length 339
sequence length 344
chains with identical sequence B
ec nomenclature ec 2.7.1.20: Adenosine kinase.
pdb deposition date 2012-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1110.10 Alpha Beta 2-Layer Sandwich Adenosine kinase, small domain Adenosine kinase, small domain 4dc3A02
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 4dc3A01
3VAQA 4K8KA 3NC9A 4YL5A 3Q1YA 1YHJA 2I5BA 4C5LA 2HLZA 1VK4A 2RBCA 4KAHA 2YXUA 3RSFA 1LIIA 2AX3A 4LBGA 2DDWA 1RKDA 1GC5A 3JULA 3NCAA 3RSGA 4C5MA 1TYYA 4KBEA 4XF7A 3RS8A 2AWDA 3B1NA 1LHRA 4S1IB 3N1CA 1V1AA 4C5KA 3B1OA 4O1GA 5EYNA 3RSQA 4N08A 2A9ZA 3RRFA 4XF6A 3B1QA 4C5JA 2PKFA 1RFVA 4EBUA 2NWHA 2DDOA 3GO7A 3LKIA 5C3YA 4E69A 2JGVA 3HPDA 3RQXA 3RT9A 4EN4A 2JG1A 5CGEA 1V19A 3RQ6A 3RS9A 3NC2A 3HICA 3NL5A 1GQTA 1KYHA 2DDMA 3B1RA 4LBXA 4PVVA 2Q5RA 4JJPA 3RQQA 3IBQA 3UBOA 3FHXA 5F11A 1BX4A 3NL2A 3NM3A 3RT7A 2V78A 2I6BA 3VASA 1WYEA 1UB0A 3KZHA 4O1LA 3UQ9A 1VM7A 3I3YA 4K9CA 4E8ZA 3H49A 5CM5A 3RTGA 3OTXA 3NL3A 3RQ8A 2VARA 5TRWA 1DGMA 5BYDA 3LJSA 3NBWA 3QAIA 3RRBA 1JXIA 4E84A 5BYCA 2PKMA 3RO4A 1TD2A 1LIJA 3RTEA 1ESQA 3RSSA 2I6AA 3UQEA 2A9YA 3ZS7A 1LHPA 3HYOA 5EY7A 3RQHA 3UMOA 4B8RA 4B8SA 1TZ3A 3KD6A 3RY7A 1EKQA 3K5WA 5C3ZA 2F7KA 4JKSA 2XTBA 3NBVA 4S1MA 5B6AA 2PKNA 2C4EA 3RTBA 5C40A 4GM6A 3DRWA 3MBHA 4KALA 1V1SA 2R3EA 4K93A 4E3AA 3LHXA 5BYFA 2AJRA 3NM1A 2HW1A 2R3BA 2F02A 4KANA 1RKAA 4JKUA 3IN1A 3QA2A 4LCAA 2QHPA 5F0ZA 3UQ6A 3EWMA 2QCVA 2FV7A 4U7XA 3B3LA 4K8CA 5COJA 1C3QA 3DZVA 3PZSA 3RQ5A 2YXTA 4K8TA 1V1BA 1YGJA 2PKKA 1U2XA 1JXHA 3IE7A 3NL6A 4DU5A 1RK2A 2HQQA 3GO6A 2C49A 4K8PA 3IKHA 4XDAA 3W4SA 4UBEA 3RTAA 3RTDA 3UMPA 3H74A 2ABSA 3GBUA 4YWRA 3RQ2A 5C41A 1RFUA 5BYEA 3IH0A 4K9IA 1RFTA 1YGKA 4S1HA 4XCKA 1LIOA 2AFBA 4S1IA 3RPHA 3RU3A 4C5NA 1ESJA 2AJPA 3KTNA 3BF5A 3Q92A 3RPZA 4EOHA 5CGAA 3CQDA 3KEUA 1LIKA 4WJMA 3LOOA 3B1PA 3RRJA 2AA0A 2AB8A 3MBJA 1VI9A 3RU2A 4EUMA 3K9EA 4LC4A 3RTCA 1TZ6A 3RM5A 4E8YA 3RREA 1EKKA 5TQIA 2DCNA 2JG5A 4KADA 3BGKA 3PL2A 1RKSA 4X8FA 1L2LA 1UA4A 2ABQA 3FHYA 4E8WA 3IQ0A 3UQDA 4N09A 4DC3A
chains in the Genus database with same CATH superfamily
3VAQA 4K8KA 2UUPA 3NC9A 4YL5A 3QCZA 3Q1YA 1YHJA 4HV4A 2I5BA 2JFHA 2HLZA 1VK4A 2RBCA 4KAHA 2YXUA 3RSFA 4C5LA 1LIIA 2AX3A 2Y66A 2DDWA 4LBGA 1RKDA 2VORA 1GC5A 3JULA 3NCAA 3RSGA 4BUBA 4C5MA 1TYYA 4KBEA 4XF7A 3RS8A 2AWDA 3B1NA 1E8CA 1LHRA 2GCBA 4S1IB 3N1CA 1V1AA 4C5KA 3B1OA 4O1GA 4CVLA 5EYNA 5A5EA 3RSQA 2Y67A 4N08A 2A9ZA 3RRFA 4XF6A 3B1QA 4C5JA 2PKFA 2UUOA 1RFVA 1E0DA 2NWHA 2DDOA 4EBUA 3GO7A 3LKIA 4ZIYA 4BUCA 2GCAA 4E69A 2JGVA 5C3YA 2JFGA 3HPDA 3RQXA 3RT9A 4EN4A 2JG1A 4QDIA 5CGEA 3HN7A 4C13A 1V19A 3RQ6A 2Y68A 3RS9A 3NC2A 3HICA 3LK7A 1GQTA 1KYHA 2DDMA 3B1RA 2WJPA 3NL5A 2Q5RA 4JJPA 4LBXA 4PVVA 1EEHA 3IBQA 3RQQA 3UBOA 3FHXA 5F11A 1BX4A 3NL2A 3NM3A 3RT7A 2V78A 2I6BA 3VASA 4UAGA 1WYEA 1UB0A 3KZHA 4O1LA 3N2AA 1GG4A 3UQ9A 1VM7A 3I3YA 4K9CA 4C12A 1J6UA 3H49A 5CM5A 4E8ZA 3RTGA 3OTXA 3NL3A 3RQ8A 3ZL8A 2VARA 5TRWA 1DGMA 5BYDA 3ZM5A 3LJSA 3NBWA 3QAIA 3RRBA 1JXIA 4E84A 5BYCA 2PKMA 2Y1OA 1TD2A 1LIJA 3RO4A 3RTEA 1ESQA 3RSSA 2I6AA 3UQEA 2AM2A 2A9YA 2VTEA 3ZS7A 1LHPA 4B8RA 3HYOA 5EY7A 3RQHA 3UMOA 4B8SA 1TZ3A 3EAGA 3KD6A 3RY7A 1EKQA 3K5WA 5C3ZA 1JBVA 1P31A 2F7KA 4JKSA 2XTBA 3NBVA 4S1MA 5B6AA 2PKNA 2C4EA 3RTBA 5C40A 4GM6A 1FGSA 3DRWA 3MBHA 4KALA 1V1SA 3HJ6A 2R3EA 2XPCA 4K93A 4E3AA 3LHXA 5BYFA 2AJRA 3UAGA 3NM1A 2HW1A 2R3BA 2F02A 4KANA 1RKAA 4JKUA 3IN1A 3QA2A 4LCAA 2WTZA 2QHPA 5F0ZA 3UQ6A 2JFFA 2VTDA 3EWMA 2QCVA 3ZM6A 2FV7A 4U7XA 3B3LA 4K8CA 5COJA 1C3QA 3DZVA 3PZSA 2F00A 3RQ5A 2X5OA 2YXTA 1JBWA 1UAGA 2XJAA 4K8TA 1V1BA 1YGJA 2PKKA 1U2XA 1JXHA 3IE7A 3NL6A 1GQYA 4DU5A 1RK2A 2GC5A 2HQQA 3GO6A 2UAGA 2C49A 4K8PA 3IKHA 4XDAA 3W4SA 4UBEA 1GQQA 3RTAA 3RTDA 3UMPA 3H74A 2ABSA 1P3DA 3GBUA 4YWRA 3RQ2A 4CVKA 5C41A 1RFUA 1O5ZA 3IH0A 4K9IA 2VOSA 5BYEA 1RFTA 1YGKA 4S1HA 4XCKA 1LIOA 2AFBA 4S1IA 3RPHA 3RU3A 4C5NA 1ESJA 2AJPA 3KTNA 3BF5A 3Q92A 3RPZA 4EOHA 5CGAA 3CQDA 3KEUA 1LIKA 4WJMA 3LOOA 3B1PA 3PYZA 2AA0A 3RRJA 2AB8A 3MBJA 1VI9A 1W78A 1W7KA 3K9EA 3RU2A 4EUMA 4LC4A 4CVMA 5A5FA 3RTCA 1TZ6A 3RM5A 4E8YA 3RREA 2AM1A 4QF5A 1EKKA 5TQIA 2DCNA 2JG5A 4KADA 3BGKA 3PL2A 1RKSA 4X8FA 1L2LA 1UA4A 2ABQA 2GC6A 3FHYA 4E8WA 3IQ0A 3UQDA 4N09A 4DC3A 3NRSA
chains in the Genus database with same CATH topology
3VAQA 4K8KA 3NC9A 4YL5A 3Q1YA 1YHJA 2I5BA 4C5LA 2HLZA 1VK4A 2RBCA 4KAHA 2YXUA 3RSFA 1LIIA 2AX3A 4LBGA 2DDWA 1RKDA 1GC5A 3JULA 3NCAA 3RSGA 4C5MA 1TYYA 4KBEA 4XF7A 3RS8A 2AWDA 3B1NA 1LHRA 4S1IB 3N1CA 1V1AA 4C5KA 3B1OA 4O1GA 5EYNA 3RSQA 4N08A 2A9ZA 3RRFA 4XF6A 3B1QA 4C5JA 2PKFA 1RFVA 4EBUA 2NWHA 2DDOA 3GO7A 3LKIA 5C3YA 4E69A 2JGVA 3HPDA 3RQXA 3RT9A 4EN4A 2JG1A 5CGEA 1V19A 3RQ6A 3RS9A 3NC2A 3HICA 3NL5A 1GQTA 1KYHA 2DDMA 3B1RA 4LBXA 4PVVA 2Q5RA 4JJPA 3RQQA 3IBQA 3UBOA 3FHXA 5F11A 1BX4A 3NL2A 3NM3A 3RT7A 2V78A 2I6BA 3VASA 1WYEA 1UB0A 3KZHA 4O1LA 3UQ9A 1VM7A 3I3YA 4K9CA 4E8ZA 3H49A 5CM5A 3RTGA 3OTXA 3NL3A 3RQ8A 2VARA 5TRWA 1DGMA 5BYDA 3LJSA 3NBWA 3QAIA 3RRBA 1JXIA 4E84A 5BYCA 2PKMA 3RO4A 1TD2A 1LIJA 3RTEA 1ESQA 3RSSA 2I6AA 3UQEA 2A9YA 3ZS7A 1LHPA 4B8RA 3HYOA 5EY7A 3RQHA 3UMOA 4B8SA 1TZ3A 3KD6A 3RY7A 1EKQA 3K5WA 5C3ZA 2F7KA 4JKSA 2XTBA 3NBVA 4S1MA 5B6AA 2PKNA 2C4EA 3RTBA 5C40A 4GM6A 3DRWA 3MBHA 4KALA 1V1SA 3HJ6A 2R3EA 4K93A 4E3AA 3LHXA 5BYFA 2AJRA 3NM1A 2HW1A 2R3BA 2F02A 4KANA 1RKAA 4JKUA 3IN1A 3QA2A 4LCAA 2QHPA 5F0ZA 3UQ6A 3EWMA 2QCVA 2FV7A 4U7XA 3B3LA 4K8CA 5COJA 1C3QA 3DZVA 3PZSA 3RQ5A 2YXTA 4K8TA 1V1BA 1YGJA 2PKKA 1U2XA 1JXHA 3IE7A 3NL6A 4DU5A 1RK2A 2HQQA 3GO6A 2C49A 4K8PA 3IKHA 4XDAA 3W4SA 4UBEA 3RTAA 3RTDA 3UMPA 3H74A 2ABSA 3GBUA 4YWRA 3RQ2A 5C41A 1RFUA 5BYEA 3IH0A 4K9IA 1RFTA 1YGKA 4S1HA 4XCKA 1LIOA 2AFBA 4S1IA 3RPHA 3RU3A 4C5NA 1ESJA 2AJPA 3KTNA 3BF5A 3Q92A 3RPZA 4EOHA 5CGAA 3CQDA 3KEUA 1LIKA 4WJMA 3LOOA 3B1PA 3RRJA 2AA0A 2AB8A 3MBJA 1VI9A 3RU2A 4EUMA 3K9EA 4LC4A 3RTCA 1TZ6A 3RM5A 4E8YA 3RREA 1EKKA 5TQIA 2DCNA 2JG5A 4KADA 3BGKA 3PL2A 1RKSA 4X8FA 1L2LA 1UA4A 2ABQA 3FHYA 4E8WA 3IQ0A 3UQDA 4N09A 4DC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VAQ A;  4K8K A;  3NC9 A;  4YL5 A;  3Q1Y A;  1YHJ A;  2I5B A;  4C5L A;  2HLZ A;  1VK4 A;  2RBC A;  4KAH A;  2YXU A;  3RSF A;  1LII A;  2AX3 A;  4LBG A;  2DDW A;  1RKD A;  1GC5 A;  3JUL A;  3NCA A;  3RSG A;  4C5M A;  1TYY A;  4KBE A;  4XF7 A;  3RS8 A;  2AWD A;  3B1N A;  1LHR A;  4S1I B;  3N1C A;  1V1A A;  4C5K A;  3B1O A;  4O1G A;  5EYN A;  3RSQ A;  4N08 A;  2A9Z A;  3RRF A;  4XF6 A;  3B1Q A;  4C5J A;  2PKF A;  1RFV A;  4EBU A;  2NWH A;  2DDO A;  3GO7 A;  3LKI A;  5C3Y A;  4E69 A;  2JGV A;  3HPD A;  3RQX A;  3RT9 A;  4EN4 A;  2JG1 A;  5CGE A;  1V19 A;  3RQ6 A;  3RS9 A;  3NC2 A;  3HIC A;  3NL5 A;  1GQT A;  1KYH A;  2DDM A;  3B1R A;  4LBX A;  4PVV A;  2Q5R A;  4JJP A;  3RQQ A;  3IBQ A;  3UBO A;  3FHX A;  5F11 A;  1BX4 A;  3NL2 A;  3NM3 A;  3RT7 A;  2V78 A;  2I6B A;  3VAS A;  1WYE A;  1UB0 A;  3KZH A;  4O1L A;  3UQ9 A;  1VM7 A;  3I3Y A;  4K9C A;  4E8Z A;  3H49 A;  5CM5 A;  3RTG A;  3OTX A;  3NL3 A;  3RQ8 A;  2VAR A;  5TRW A;  1DGM A;  5BYD A;  3LJS A;  3NBW A;  3QAI A;  3RRB A;  1JXI A;  4E84 A;  5BYC A;  2PKM A;  3RO4 A;  1TD2 A;  1LIJ A;  3RTE A;  1ESQ A;  3RSS A;  2I6A A;  3UQE A;  2A9Y A;  3ZS7 A;  1LHP A;  3HYO A;  5EY7 A;  3RQH A;  3UMO A;  4B8R A;  4B8S A;  1TZ3 A;  3KD6 A;  3RY7 A;  1EKQ A;  3K5W A;  5C3Z A;  2F7K A;  4JKS A;  2XTB A;  3NBV A;  4S1M A;  5B6A A;  2PKN A;  2C4E A;  3RTB A;  5C40 A;  4GM6 A;  3DRW A;  3MBH A;  4KAL A;  1V1S A;  2R3E A;  4K93 A;  4E3A A;  3LHX A;  5BYF A;  2AJR A;  3NM1 A;  2HW1 A;  2R3B A;  2F02 A;  4KAN A;  1RKA A;  4JKU A;  3IN1 A;  3QA2 A;  4LCA A;  2QHP A;  5F0Z A;  3UQ6 A;  3EWM A;  2QCV A;  2FV7 A;  4U7X A;  3B3L A;  4K8C A;  5COJ A;  1C3Q A;  3DZV A;  3PZS A;  3RQ5 A;  2YXT A;  4K8T A;  1V1B A;  1YGJ A;  2PKK A;  1U2X A;  1JXH A;  3IE7 A;  3NL6 A;  4DU5 A;  1RK2 A;  2HQQ A;  3GO6 A;  2C49 A;  4K8P A;  3IKH A;  4XDA A;  3W4S A;  4UBE A;  3RTA A;  3RTD A;  3UMP A;  3H74 A;  2ABS A;  3GBU A;  4YWR A;  3RQ2 A;  5C41 A;  1RFU A;  5BYE A;  3IH0 A;  4K9I A;  1RFT A;  1YGK A;  4S1H A;  4XCK A;  1LIO A;  2AFB A;  4S1I A;  3RPH A;  3RU3 A;  4C5N A;  1ESJ A;  2AJP A;  3KTN A;  3BF5 A;  3Q92 A;  3RPZ A;  4EOH A;  5CGA A;  3CQD A;  3KEU A;  1LIK A;  4WJM A;  3LOO A;  3B1P A;  3RRJ A;  2AA0 A;  2AB8 A;  3MBJ A;  1VI9 A;  3RU2 A;  4EUM A;  3K9E A;  4LC4 A;  3RTC A;  1TZ6 A;  3RM5 A;  4E8Y A;  3RRE A;  1EKK A;  5TQI A;  2DCN A;  2JG5 A;  4KAD A;  3BGK A;  3PL2 A;  1RKS A;  4X8F A;  1L2L A;  1UA4 A;  2ABQ A;  3FHY A;  4E8W A;  3IQ0 A;  3UQD A;  4N09 A;  4DC3 A; 
#chains in the Genus database with same CATH topology
 3VAQ A;  4K8K A;  2UUP A;  3NC9 A;  4YL5 A;  3QCZ A;  3Q1Y A;  1YHJ A;  4HV4 A;  2I5B A;  2JFH A;  2HLZ A;  1VK4 A;  2RBC A;  4KAH A;  2YXU A;  3RSF A;  4C5L A;  1LII A;  2AX3 A;  2Y66 A;  2DDW A;  4LBG A;  1RKD A;  2VOR A;  1GC5 A;  3JUL A;  3NCA A;  3RSG A;  4BUB A;  4C5M A;  1TYY A;  4KBE A;  4XF7 A;  3RS8 A;  2AWD A;  3B1N A;  1E8C A;  1LHR A;  2GCB A;  4S1I B;  3N1C A;  1V1A A;  4C5K A;  3B1O A;  4O1G A;  4CVL A;  5EYN A;  5A5E A;  3RSQ A;  2Y67 A;  4N08 A;  2A9Z A;  3RRF A;  4XF6 A;  3B1Q A;  4C5J A;  2PKF A;  2UUO A;  1RFV A;  1E0D A;  2NWH A;  2DDO A;  4EBU A;  3GO7 A;  3LKI A;  4ZIY A;  4BUC A;  2GCA A;  4E69 A;  2JGV A;  5C3Y A;  2JFG A;  3HPD A;  3RQX A;  3RT9 A;  4EN4 A;  2JG1 A;  4QDI A;  5CGE A;  3HN7 A;  4C13 A;  1V19 A;  3RQ6 A;  2Y68 A;  3RS9 A;  3NC2 A;  3HIC A;  3LK7 A;  1GQT A;  1KYH A;  2DDM A;  3B1R A;  2WJP A;  3NL5 A;  2Q5R A;  4JJP A;  4LBX A;  4PVV A;  1EEH A;  3IBQ A;  3RQQ A;  3UBO A;  3FHX A;  5F11 A;  1BX4 A;  3NL2 A;  3NM3 A;  3RT7 A;  2V78 A;  2I6B A;  3VAS A;  4UAG A;  1WYE A;  1UB0 A;  3KZH A;  4O1L A;  3N2A A;  1GG4 A;  3UQ9 A;  1VM7 A;  3I3Y A;  4K9C A;  4C12 A;  1J6U A;  3H49 A;  5CM5 A;  4E8Z A;  3RTG A;  3OTX A;  3NL3 A;  3RQ8 A;  3ZL8 A;  2VAR A;  5TRW A;  1DGM A;  5BYD A;  3ZM5 A;  3LJS A;  3NBW A;  3QAI A;  3RRB A;  1JXI A;  4E84 A;  5BYC A;  2PKM A;  2Y1O A;  1TD2 A;  1LIJ A;  3RO4 A;  3RTE A;  1ESQ A;  3RSS A;  2I6A A;  3UQE A;  2AM2 A;  2A9Y A;  2VTE A;  3ZS7 A;  1LHP A;  4B8R A;  3HYO A;  5EY7 A;  3RQH A;  3UMO A;  4B8S A;  1TZ3 A;  3EAG A;  3KD6 A;  3RY7 A;  1EKQ A;  3K5W A;  5C3Z A;  1JBV A;  1P31 A;  2F7K A;  4JKS A;  2XTB A;  3NBV A;  4S1M A;  5B6A A;  2PKN A;  2C4E A;  3RTB A;  5C40 A;  4GM6 A;  1FGS A;  3DRW A;  3MBH A;  4KAL A;  1V1S A;  3HJ6 A;  2R3E A;  2XPC A;  4K93 A;  4E3A A;  3LHX A;  5BYF A;  2AJR A;  3UAG A;  3NM1 A;  2HW1 A;  2R3B A;  2F02 A;  4KAN A;  1RKA A;  4JKU A;  3IN1 A;  3QA2 A;  4LCA A;  2WTZ A;  2QHP A;  5F0Z A;  3UQ6 A;  2JFF A;  2VTD A;  3EWM A;  2QCV A;  3ZM6 A;  2FV7 A;  4U7X A;  3B3L A;  4K8C A;  5COJ A;  1C3Q A;  3DZV A;  3PZS A;  2F00 A;  3RQ5 A;  2X5O A;  2YXT A;  1JBW A;  1UAG A;  2XJA A;  4K8T A;  1V1B A;  1YGJ A;  2PKK A;  1U2X A;  1JXH A;  3IE7 A;  3NL6 A;  1GQY A;  4DU5 A;  1RK2 A;  2GC5 A;  2HQQ A;  3GO6 A;  2UAG A;  2C49 A;  4K8P A;  3IKH A;  4XDA A;  3W4S A;  4UBE A;  1GQQ A;  3RTA A;  3RTD A;  3UMP A;  3H74 A;  2ABS A;  1P3D A;  3GBU A;  4YWR A;  3RQ2 A;  4CVK A;  5C41 A;  1RFU A;  1O5Z A;  3IH0 A;  4K9I A;  2VOS A;  5BYE A;  1RFT A;  1YGK A;  4S1H A;  4XCK A;  1LIO A;  2AFB A;  4S1I A;  3RPH A;  3RU3 A;  4C5N A;  1ESJ A;  2AJP A;  3KTN A;  3BF5 A;  3Q92 A;  3RPZ A;  4EOH A;  5CGA A;  3CQD A;  3KEU A;  1LIK A;  4WJM A;  3LOO A;  3B1P A;  3PYZ A;  2AA0 A;  3RRJ A;  2AB8 A;  3MBJ A;  1VI9 A;  1W78 A;  1W7K A;  3K9E A;  3RU2 A;  4EUM A;  4LC4 A;  4CVM A;  5A5F A;  3RTC A;  1TZ6 A;  3RM5 A;  4E8Y A;  3RRE A;  2AM1 A;  4QF5 A;  1EKK A;  5TQI A;  2DCN A;  2JG5 A;  4KAD A;  3BGK A;  3PL2 A;  1RKS A;  4X8F A;  1L2L A;  1UA4 A;  2ABQ A;  2GC6 A;  3FHY A;  4E8W A;  3IQ0 A;  3UQD A;  4N09 A;  4DC3 A;  3NRS A; 
#chains in the Genus database with same CATH homology
 3VAQ A;  4K8K A;  3NC9 A;  4YL5 A;  3Q1Y A;  1YHJ A;  2I5B A;  4C5L A;  2HLZ A;  1VK4 A;  2RBC A;  4KAH A;  2YXU A;  3RSF A;  1LII A;  2AX3 A;  4LBG A;  2DDW A;  1RKD A;  1GC5 A;  3JUL A;  3NCA A;  3RSG A;  4C5M A;  1TYY A;  4KBE A;  4XF7 A;  3RS8 A;  2AWD A;  3B1N A;  1LHR A;  4S1I B;  3N1C A;  1V1A A;  4C5K A;  3B1O A;  4O1G A;  5EYN A;  3RSQ A;  4N08 A;  2A9Z A;  3RRF A;  4XF6 A;  3B1Q A;  4C5J A;  2PKF A;  1RFV A;  4EBU A;  2NWH A;  2DDO A;  3GO7 A;  3LKI A;  5C3Y A;  4E69 A;  2JGV A;  3HPD A;  3RQX A;  3RT9 A;  4EN4 A;  2JG1 A;  5CGE A;  1V19 A;  3RQ6 A;  3RS9 A;  3NC2 A;  3HIC A;  3NL5 A;  1GQT A;  1KYH A;  2DDM A;  3B1R A;  4LBX A;  4PVV A;  2Q5R A;  4JJP A;  3RQQ A;  3IBQ A;  3UBO A;  3FHX A;  5F11 A;  1BX4 A;  3NL2 A;  3NM3 A;  3RT7 A;  2V78 A;  2I6B A;  3VAS A;  1WYE A;  1UB0 A;  3KZH A;  4O1L A;  3UQ9 A;  1VM7 A;  3I3Y A;  4K9C A;  4E8Z A;  3H49 A;  5CM5 A;  3RTG A;  3OTX A;  3NL3 A;  3RQ8 A;  2VAR A;  5TRW A;  1DGM A;  5BYD A;  3LJS A;  3NBW A;  3QAI A;  3RRB A;  1JXI A;  4E84 A;  5BYC A;  2PKM A;  3RO4 A;  1TD2 A;  1LIJ A;  3RTE A;  1ESQ A;  3RSS A;  2I6A A;  3UQE A;  2A9Y A;  3ZS7 A;  1LHP A;  4B8R A;  3HYO A;  5EY7 A;  3RQH A;  3UMO A;  4B8S A;  1TZ3 A;  3KD6 A;  3RY7 A;  1EKQ A;  3K5W A;  5C3Z A;  2F7K A;  4JKS A;  2XTB A;  3NBV A;  4S1M A;  5B6A A;  2PKN A;  2C4E A;  3RTB A;  5C40 A;  4GM6 A;  3DRW A;  3MBH A;  4KAL A;  1V1S A;  3HJ6 A;  2R3E A;  4K93 A;  4E3A A;  3LHX A;  5BYF A;  2AJR A;  3NM1 A;  2HW1 A;  2R3B A;  2F02 A;  4KAN A;  1RKA A;  4JKU A;  3IN1 A;  3QA2 A;  4LCA A;  2QHP A;  5F0Z A;  3UQ6 A;  3EWM A;  2QCV A;  2FV7 A;  4U7X A;  3B3L A;  4K8C A;  5COJ A;  1C3Q A;  3DZV A;  3PZS A;  3RQ5 A;  2YXT A;  4K8T A;  1V1B A;  1YGJ A;  2PKK A;  1U2X A;  1JXH A;  3IE7 A;  3NL6 A;  4DU5 A;  1RK2 A;  2HQQ A;  3GO6 A;  2C49 A;  4K8P A;  3IKH A;  4XDA A;  3W4S A;  4UBE A;  3RTA A;  3RTD A;  3UMP A;  3H74 A;  2ABS A;  3GBU A;  4YWR A;  3RQ2 A;  5C41 A;  1RFU A;  5BYE A;  3IH0 A;  4K9I A;  1RFT A;  1YGK A;  4S1H A;  4XCK A;  1LIO A;  2AFB A;  4S1I A;  3RPH A;  3RU3 A;  4C5N A;  1ESJ A;  2AJP A;  3KTN A;  3BF5 A;  3Q92 A;  3RPZ A;  4EOH A;  5CGA A;  3CQD A;  3KEU A;  1LIK A;  4WJM A;  3LOO A;  3B1P A;  3RRJ A;  2AA0 A;  2AB8 A;  3MBJ A;  1VI9 A;  3RU2 A;  4EUM A;  3K9E A;  4LC4 A;  3RTC A;  1TZ6 A;  3RM5 A;  4E8Y A;  3RRE A;  1EKK A;  5TQI A;  2DCN A;  2JG5 A;  4KAD A;  3BGK A;  3PL2 A;  1RKS A;  4X8F A;  1L2L A;  1UA4 A;  2ABQ A;  3FHY A;  4E8W A;  3IQ0 A;  3UQD A;  4N09 A;  4DC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...