2NWHA

Carbohydrate kinase from agrobacterium tumefaciens
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
312
structure length
307
Chain Sequence
MKKILVLGGAHIDRRGMIETETAPGASNPGSWMEEAGGGGFNAARNLSRLGFEVRIIAPRGGDVTGEVVAEAARQAGVEDTPFTFLDRRTPSYTAILERDGNLVIALADMDLYKLFTPRRLKVRAVREAIIASDFLLCDANLPEDTLTALGLIARACEKPLAAIAISPAKAVKLKAALGDIDILFMNEAEARALTGVRDWPNILRKAGLSGGVVTRGASEVVAFNGTEKAILHPPLIREVKDVTGAGDAMASGYLAAIAEGKTIREALRQGAAAAAITVQSSFATSQDLSKDSVEAMLGLVPQAEML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of carbohydrate kinase from Agrobacterium tumefaciens
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Signaling protein,transferase
molecule keywords carbohydrate kinase
total genus 101
structure length 307
sequence length 312
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 2nwhA00
1TZ3A 2AJRA 1V1AA 2HW1A 2ABQA 3RRJA 5COJA 3GO7A 3B1PA 3KTNA 4EUMA 2F7KA 4E69A 3UQDA 3RT7A 2JG5A 4N09A 3NL5A 1LIJA 5EYNA 1YGKA 4N08A 3KEUA 1UA4A 3FHYA 3HPDA 3RQ8A 2F02A 2YXTA 1TZ6A 3RTEA 3UQEA 1UB0A 4S1IB 4LBGA 2QCVA 3NM3A 2DDMA 4XDAA 3NL2A 1LHPA 2I6AA 1WYEA 3LHXA 3RQHA 3RTGA 1V1SA 4YWRA 4K8CA 3LOOA 4B8RA 4DU5A 4E84A 3IH0A 3RQXA 4B8SA 2C49A 3RQ5A 1DGMA 3Q92A 3RREA 3RT9A 5BYDA 1LHRA 3RY7A 3IN1A 4KBEA 5TQIA 3RQQA 3RTBA 2AFBA 4C5MA 4E8ZA 3PZSA 1ESQA 4JJPA 4JKUA 3RQ2A 4DC3A 3RRFA 3RSGA 4K9IA 2PKMA 1EKKA 5EY7A 3VASA 5C41A 2R3BA 2JG1A 4EOHA 3RO4A 3RSFA 1L2LA 4LCAA 2A9ZA 5CGEA 2A9YA 2RBCA 3RS8A 5F0ZA 4K8KA 2Q5RA 1U2XA 3FHXA 3NL6A 3LKIA 1RFTA 4K8TA 4XF7A 4GM6A 3W4SA 3NCAA 4O1GA 3PL2A 3HICA 2NWHA 3NL3A 4LBXA 4U7XA 5CGAA 1VM7A 1ESJA 2DDOA 2V78A 4K9CA 3RU2A 2FV7A 4S1IA 3RQ6A 4C5KA 3UQ9A 2DDWA 4S1MA 3H49A 3UQ6A 2HQQA 4E8WA 1LIIA 3DRWA 2QHPA 1LIKA 3QA2A 1TYYA 3Q1YA 3B1NA 3MBJA 4LC4A 2I6BA 3RS9A 3K9EA 3KD6A 3UMPA 3VAQA 4E8YA 5BYCA 1VK4A 2AB8A 1C3QA 3BF5A 3B1QA 3GO6A 2PKKA 3I3YA 3NC2A 4O1LA 1V1BA 2AA0A 3IKHA 2YXUA 3MBHA 3RRBA 3IQ0A 4WJMA 4EBUA 5B6AA 2PKFA 2VARA 4PVVA 2ABSA 1RFUA 3RTAA 1JXIA 3B1OA 3RTCA 2AX3A 2DCNA 3UMOA 2R3EA 3EWMA 3LJSA 4XF6A 5TRWA 4C5JA 5C3YA 5C40A 3OTXA 4UBEA 3ZS7A 3HYOA 3RPZA 3RU3A 3RTDA 4EN4A 5C3ZA 2HLZA 5BYFA 3GBUA 4E3AA 4X8FA 4KANA 3B1RA 1BX4A 1YGJA 3RM5A 4K93A 2I5BA 3KZHA 3NM1A 1KYHA 3K5WA 3RPHA 3QAIA 4XCKA 3H74A 1RK2A 5F11A 1GC5A 1RFVA 1YHJA 4C5NA 1VI9A 1V19A 3NC9A 3NBWA 3CQDA 1RKDA 2PKNA 2AWDA 4JKSA 4K8PA 3BGKA 1RKSA 4S1HA 4YL5A 3RSSA 4C5LA 5CM5A 3DZVA 1EKQA 3B3LA 2AJPA 4KADA 2C4EA 1GQTA 3N1CA 3IBQA 4KAHA 4KALA 3IE7A 3UBOA 1RKAA 2JGVA 1TD2A 3JULA 3NBVA 1LIOA 3RSQA 1JXHA 5BYEA 2XTBA
chains in the Genus database with same CATH superfamily
1TZ3A 2AJRA 1V1AA 2AM1A 1FGSA 2HW1A 2ABQA 3RRJA 4CVMA 1GG4A 5COJA 3GO7A 2F00A 3B1PA 3KTNA 4CVKA 2F7KA 4E69A 4EUMA 3UQDA 3RT7A 2JG5A 3EAGA 2VTDA 4N09A 3NL5A 1LIJA 5EYNA 3PYZA 1YGKA 4N08A 3KEUA 1UA4A 3ZM6A 3FHYA 3HPDA 4HV4A 2Y68A 3RQ8A 2F02A 2YXTA 1TZ6A 4C12A 3RTEA 3UQEA 1UB0A 4QF5A 4S1IB 2JFHA 1O5ZA 4LBGA 2QCVA 3NM3A 4ZIYA 2DDMA 2Y66A 1P31A 2Y1OA 4XDAA 3NL2A 1LHPA 2I6AA 3ZM5A 1WYEA 3LHXA 3RQHA 5A5FA 3RTGA 1V1SA 4YWRA 4K8CA 3LOOA 4B8RA 4DU5A 4E84A 3IH0A 3RQXA 4B8SA 2C49A 3RQ5A 1DGMA 3Q92A 3RREA 3RT9A 5BYDA 1LHRA 3RY7A 3IN1A 4KBEA 5TQIA 3RQQA 3RTBA 2AFBA 3LK7A 3ZL8A 4C5MA 2GC5A 4E8ZA 3PZSA 2UAGA 1ESQA 2Y67A 4JJPA 1P3DA 4JKUA 3RQ2A 3RRFA 3RSGA 4K9IA 4DC3A 2PKMA 1EKKA 3HJ6A 2WJPA 2GC6A 5EY7A 3VASA 5C41A 2R3BA 2JG1A 1E8CA 4EOHA 3RO4A 3RSFA 1L2LA 4LCAA 2A9ZA 5CGEA 3HN7A 4CVLA 1W78A 2A9YA 2RBCA 4QDIA 3RS8A 5F0ZA 2AM2A 4K8KA 2Q5RA 1U2XA 3FHXA 3NL6A 3LKIA 1RFTA 2VTEA 4K8TA 4XF7A 2X5OA 4GM6A 3W4SA 3N2AA 3NCAA 4O1GA 3PL2A 3UAGA 3HICA 2NWHA 2XPCA 3NL3A 4LBXA 4U7XA 1VM7A 5CGAA 1ESJA 2DDOA 2V78A 2XJAA 4K9CA 3RU2A 2FV7A 1JBVA 4S1IA 3RQ6A 4C5KA 3UQ9A 2DDWA 4S1MA 3H49A 3UQ6A 2HQQA 2UUPA 4E8WA 1LIIA 1GQYA 3DRWA 2QHPA 1EEHA 1W7KA 3UBOA 1LIKA 3QA2A 1TYYA 3Q1YA 3B1NA 3MBJA 4LC4A 2I6BA 3RS9A 3K9EA 3KD6A 3UMPA 3VAQA 4BUBA 4E8YA 5BYCA 3QCZA 1VK4A 2AB8A 1C3QA 3BF5A 3B1QA 3GO6A 2PKKA 3I3YA 3NC2A 4O1LA 1V1BA 2AA0A 3IKHA 2YXUA 3MBHA 3RRBA 3IQ0A 4WJMA 4EBUA 5A5EA 5B6AA 2PKFA 2GCAA 2VARA 4PVVA 2ABSA 1RFUA 3RTAA 1JXIA 3B1OA 3RTCA 2AX3A 2DCNA 3UMOA 2R3EA 2GCBA 2WTZA 3EWMA 3LJSA 4XF6A 5TRWA 4C5JA 5C3YA 5C40A 3OTXA 4UBEA 3ZS7A 3HYOA 3RPZA 3RU3A 3RTDA 4EN4A 2VORA 2HLZA 5C3ZA 5BYFA 3GBUA 4E3AA 4X8FA 4KANA 3B1RA 1BX4A 1YGJA 2JFFA 4K93A 3RM5A 2I5BA 3KZHA 3NM1A 1KYHA 3K5WA 3NRSA 3QAIA 3RPHA 2VOSA 3H74A 1RK2A 4XCKA 5F11A 1GC5A 4C13A 1RFVA 1YHJA 4C5NA 1VI9A 1V19A 3NC9A 3NBWA 1E0DA 3CQDA 1RKDA 1J6UA 2AWDA 2PKNA 4JKSA 3BGKA 1RKSA 4K8PA 4S1HA 4YL5A 3RSSA 4BUCA 4C5LA 5CM5A 3DZVA 1UAGA 1EKQA 3B3LA 1GQQA 2AJPA 2C4EA 1GQTA 3N1CA 3IBQA 4KAHA 4KADA 3IE7A 4KALA 1RKAA 1JBWA 1TD2A 2JGVA 2JFGA 4UAGA 3JULA 3NBVA 1LIOA 2UUOA 3RSQA 1JXHA 5BYEA 2XTBA
chains in the Genus database with same CATH topology
1TZ3A 2AJRA 1V1AA 2HW1A 2ABQA 3RRJA 5COJA 3GO7A 3B1PA 3KTNA 4EUMA 2F7KA 4E69A 3UQDA 3RT7A 2JG5A 4N09A 3NL5A 1LIJA 5EYNA 1YGKA 4N08A 3KEUA 1UA4A 3FHYA 3HPDA 3RQ8A 2F02A 2YXTA 1TZ6A 3RTEA 3UQEA 1UB0A 4S1IB 4LBGA 2QCVA 3NM3A 2DDMA 4XDAA 3NL2A 1LHPA 2I6AA 1WYEA 3LHXA 3RQHA 3RTGA 1V1SA 4YWRA 4K8CA 3LOOA 4B8RA 4DU5A 4E84A 3IH0A 3RQXA 4B8SA 2C49A 3RQ5A 1DGMA 3Q92A 3RREA 3RT9A 5BYDA 1LHRA 3RY7A 3IN1A 4KBEA 5TQIA 3RQQA 3RTBA 2AFBA 4C5MA 4E8ZA 3PZSA 1ESQA 4JJPA 4JKUA 3RQ2A 4DC3A 3RRFA 3RSGA 4K9IA 2PKMA 1EKKA 3HJ6A 5EY7A 3VASA 5C41A 2R3BA 2JG1A 4EOHA 3RO4A 3RSFA 1L2LA 4LCAA 2A9ZA 5CGEA 2A9YA 2RBCA 3RS8A 5F0ZA 4K8KA 2Q5RA 1U2XA 3FHXA 3NL6A 3LKIA 1RFTA 4K8TA 4XF7A 4GM6A 3W4SA 3NCAA 4O1GA 3PL2A 3HICA 2NWHA 3NL3A 4LBXA 4U7XA 5CGAA 1VM7A 1ESJA 2DDOA 2V78A 4K9CA 3RU2A 2FV7A 4S1IA 3RQ6A 4C5KA 3UQ9A 2DDWA 4S1MA 3H49A 3UQ6A 2HQQA 4E8WA 1LIIA 3DRWA 2QHPA 1LIKA 3QA2A 1TYYA 3Q1YA 3B1NA 3MBJA 4LC4A 2I6BA 3RS9A 3K9EA 3KD6A 3UMPA 3VAQA 4E8YA 5BYCA 1VK4A 2AB8A 1C3QA 3BF5A 3B1QA 3GO6A 2PKKA 3I3YA 3NC2A 4O1LA 1V1BA 2AA0A 3IKHA 2YXUA 3MBHA 3RRBA 3IQ0A 4WJMA 4EBUA 5B6AA 2PKFA 2VARA 4PVVA 2ABSA 1RFUA 3RTAA 1JXIA 3B1OA 3RTCA 2AX3A 2DCNA 3UMOA 2R3EA 3EWMA 3LJSA 4XF6A 5TRWA 4C5JA 5C3YA 5C40A 3OTXA 4UBEA 3ZS7A 3HYOA 3RPZA 3RU3A 3RTDA 4EN4A 5C3ZA 2HLZA 5BYFA 3GBUA 4E3AA 4X8FA 4KANA 3B1RA 1BX4A 1YGJA 3RM5A 4K93A 2I5BA 3KZHA 3NM1A 1KYHA 3K5WA 3RPHA 3QAIA 4XCKA 3H74A 1RK2A 5F11A 1GC5A 1RFVA 1YHJA 4C5NA 1VI9A 1V19A 3NC9A 3NBWA 3CQDA 1RKDA 2PKNA 2AWDA 4JKSA 4K8PA 3BGKA 1RKSA 4S1HA 4YL5A 3RSSA 4C5LA 5CM5A 3DZVA 1EKQA 3B3LA 2AJPA 4KADA 2C4EA 1GQTA 3N1CA 3IBQA 4KAHA 4KALA 3IE7A 3UBOA 1RKAA 2JGVA 1TD2A 3JULA 3NBVA 1LIOA 3RSQA 1JXHA 5BYEA 2XTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TZ3 A;  2AJR A;  1V1A A;  2HW1 A;  2ABQ A;  3RRJ A;  5COJ A;  3GO7 A;  3B1P A;  3KTN A;  4EUM A;  2F7K A;  4E69 A;  3UQD A;  3RT7 A;  2JG5 A;  4N09 A;  3NL5 A;  1LIJ A;  5EYN A;  1YGK A;  4N08 A;  3KEU A;  1UA4 A;  3FHY A;  3HPD A;  3RQ8 A;  2F02 A;  2YXT A;  1TZ6 A;  3RTE A;  3UQE A;  1UB0 A;  4S1I B;  4LBG A;  2QCV A;  3NM3 A;  2DDM A;  4XDA A;  3NL2 A;  1LHP A;  2I6A A;  1WYE A;  3LHX A;  3RQH A;  3RTG A;  1V1S A;  4YWR A;  4K8C A;  3LOO A;  4B8R A;  4DU5 A;  4E84 A;  3IH0 A;  3RQX A;  4B8S A;  2C49 A;  3RQ5 A;  1DGM A;  3Q92 A;  3RRE A;  3RT9 A;  5BYD A;  1LHR A;  3RY7 A;  3IN1 A;  4KBE A;  5TQI A;  3RQQ A;  3RTB A;  2AFB A;  4C5M A;  4E8Z A;  3PZS A;  1ESQ A;  4JJP A;  4JKU A;  3RQ2 A;  4DC3 A;  3RRF A;  3RSG A;  4K9I A;  2PKM A;  1EKK A;  5EY7 A;  3VAS A;  5C41 A;  2R3B A;  2JG1 A;  4EOH A;  3RO4 A;  3RSF A;  1L2L A;  4LCA A;  2A9Z A;  5CGE A;  2A9Y A;  2RBC A;  3RS8 A;  5F0Z A;  4K8K A;  2Q5R A;  1U2X A;  3FHX A;  3NL6 A;  3LKI A;  1RFT A;  4K8T A;  4XF7 A;  4GM6 A;  3W4S A;  3NCA A;  4O1G A;  3PL2 A;  3HIC A;  2NWH A;  3NL3 A;  4LBX A;  4U7X A;  5CGA A;  1VM7 A;  1ESJ A;  2DDO A;  2V78 A;  4K9C A;  3RU2 A;  2FV7 A;  4S1I A;  3RQ6 A;  4C5K A;  3UQ9 A;  2DDW A;  4S1M A;  3H49 A;  3UQ6 A;  2HQQ A;  4E8W A;  1LII A;  3DRW A;  2QHP A;  1LIK A;  3QA2 A;  1TYY A;  3Q1Y A;  3B1N A;  3MBJ A;  4LC4 A;  2I6B A;  3RS9 A;  3K9E A;  3KD6 A;  3UMP A;  3VAQ A;  4E8Y A;  5BYC A;  1VK4 A;  2AB8 A;  1C3Q A;  3BF5 A;  3B1Q A;  3GO6 A;  2PKK A;  3I3Y A;  3NC2 A;  4O1L A;  1V1B A;  2AA0 A;  3IKH A;  2YXU A;  3MBH A;  3RRB A;  3IQ0 A;  4WJM A;  4EBU A;  5B6A A;  2PKF A;  2VAR A;  4PVV A;  2ABS A;  1RFU A;  3RTA A;  1JXI A;  3B1O A;  3RTC A;  2AX3 A;  2DCN A;  3UMO A;  2R3E A;  3EWM A;  3LJS A;  4XF6 A;  5TRW A;  4C5J A;  5C3Y A;  5C40 A;  3OTX A;  4UBE A;  3ZS7 A;  3HYO A;  3RPZ A;  3RU3 A;  3RTD A;  4EN4 A;  5C3Z A;  2HLZ A;  5BYF A;  3GBU A;  4E3A A;  4X8F A;  4KAN A;  3B1R A;  1BX4 A;  1YGJ A;  3RM5 A;  4K93 A;  2I5B A;  3KZH A;  3NM1 A;  1KYH A;  3K5W A;  3RPH A;  3QAI A;  4XCK A;  3H74 A;  1RK2 A;  5F11 A;  1GC5 A;  1RFV A;  1YHJ A;  4C5N A;  1VI9 A;  1V19 A;  3NC9 A;  3NBW A;  3CQD A;  1RKD A;  2PKN A;  2AWD A;  4JKS A;  4K8P A;  3BGK A;  1RKS A;  4S1H A;  4YL5 A;  3RSS A;  4C5L A;  5CM5 A;  3DZV A;  1EKQ A;  3B3L A;  2AJP A;  4KAD A;  2C4E A;  1GQT A;  3N1C A;  3IBQ A;  4KAH A;  4KAL A;  3IE7 A;  3UBO A;  1RKA A;  2JGV A;  1TD2 A;  3JUL A;  3NBV A;  1LIO A;  3RSQ A;  1JXH A;  5BYE A;  2XTB A; 
#chains in the Genus database with same CATH topology
 1TZ3 A;  2AJR A;  1V1A A;  2AM1 A;  1FGS A;  2HW1 A;  2ABQ A;  3RRJ A;  4CVM A;  1GG4 A;  5COJ A;  3GO7 A;  2F00 A;  3B1P A;  3KTN A;  4CVK A;  2F7K A;  4E69 A;  4EUM A;  3UQD A;  3RT7 A;  2JG5 A;  3EAG A;  2VTD A;  4N09 A;  3NL5 A;  1LIJ A;  5EYN A;  3PYZ A;  1YGK A;  4N08 A;  3KEU A;  1UA4 A;  3ZM6 A;  3FHY A;  3HPD A;  4HV4 A;  2Y68 A;  3RQ8 A;  2F02 A;  2YXT A;  1TZ6 A;  4C12 A;  3RTE A;  3UQE A;  1UB0 A;  4QF5 A;  4S1I B;  2JFH A;  1O5Z A;  4LBG A;  2QCV A;  3NM3 A;  4ZIY A;  2DDM A;  2Y66 A;  1P31 A;  2Y1O A;  4XDA A;  3NL2 A;  1LHP A;  2I6A A;  3ZM5 A;  1WYE A;  3LHX A;  3RQH A;  5A5F A;  3RTG A;  1V1S A;  4YWR A;  4K8C A;  3LOO A;  4B8R A;  4DU5 A;  4E84 A;  3IH0 A;  3RQX A;  4B8S A;  2C49 A;  3RQ5 A;  1DGM A;  3Q92 A;  3RRE A;  3RT9 A;  5BYD A;  1LHR A;  3RY7 A;  3IN1 A;  4KBE A;  5TQI A;  3RQQ A;  3RTB A;  2AFB A;  3LK7 A;  3ZL8 A;  4C5M A;  2GC5 A;  4E8Z A;  3PZS A;  2UAG A;  1ESQ A;  2Y67 A;  4JJP A;  1P3D A;  4JKU A;  3RQ2 A;  3RRF A;  3RSG A;  4K9I A;  4DC3 A;  2PKM A;  1EKK A;  3HJ6 A;  2WJP A;  2GC6 A;  5EY7 A;  3VAS A;  5C41 A;  2R3B A;  2JG1 A;  1E8C A;  4EOH A;  3RO4 A;  3RSF A;  1L2L A;  4LCA A;  2A9Z A;  5CGE A;  3HN7 A;  4CVL A;  1W78 A;  2A9Y A;  2RBC A;  4QDI A;  3RS8 A;  5F0Z A;  2AM2 A;  4K8K A;  2Q5R A;  1U2X A;  3FHX A;  3NL6 A;  3LKI A;  1RFT A;  2VTE A;  4K8T A;  4XF7 A;  2X5O A;  4GM6 A;  3W4S A;  3N2A A;  3NCA A;  4O1G A;  3PL2 A;  3UAG A;  3HIC A;  2NWH A;  2XPC A;  3NL3 A;  4LBX A;  4U7X A;  1VM7 A;  5CGA A;  1ESJ A;  2DDO A;  2V78 A;  2XJA A;  4K9C A;  3RU2 A;  2FV7 A;  1JBV A;  4S1I A;  3RQ6 A;  4C5K A;  3UQ9 A;  2DDW A;  4S1M A;  3H49 A;  3UQ6 A;  2HQQ A;  2UUP A;  4E8W A;  1LII A;  1GQY A;  3DRW A;  2QHP A;  1EEH A;  1W7K A;  3UBO A;  1LIK A;  3QA2 A;  1TYY A;  3Q1Y A;  3B1N A;  3MBJ A;  4LC4 A;  2I6B A;  3RS9 A;  3K9E A;  3KD6 A;  3UMP A;  3VAQ A;  4BUB A;  4E8Y A;  5BYC A;  3QCZ A;  1VK4 A;  2AB8 A;  1C3Q A;  3BF5 A;  3B1Q A;  3GO6 A;  2PKK A;  3I3Y A;  3NC2 A;  4O1L A;  1V1B A;  2AA0 A;  3IKH A;  2YXU A;  3MBH A;  3RRB A;  3IQ0 A;  4WJM A;  4EBU A;  5A5E A;  5B6A A;  2PKF A;  2GCA A;  2VAR A;  4PVV A;  2ABS A;  1RFU A;  3RTA A;  1JXI A;  3B1O A;  3RTC A;  2AX3 A;  2DCN A;  3UMO A;  2R3E A;  2GCB A;  2WTZ A;  3EWM A;  3LJS A;  4XF6 A;  5TRW A;  4C5J A;  5C3Y A;  5C40 A;  3OTX A;  4UBE A;  3ZS7 A;  3HYO A;  3RPZ A;  3RU3 A;  3RTD A;  4EN4 A;  2VOR A;  2HLZ A;  5C3Z A;  5BYF A;  3GBU A;  4E3A A;  4X8F A;  4KAN A;  3B1R A;  1BX4 A;  1YGJ A;  2JFF A;  4K93 A;  3RM5 A;  2I5B A;  3KZH A;  3NM1 A;  1KYH A;  3K5W A;  3NRS A;  3QAI A;  3RPH A;  2VOS A;  3H74 A;  1RK2 A;  4XCK A;  5F11 A;  1GC5 A;  4C13 A;  1RFV A;  1YHJ A;  4C5N A;  1VI9 A;  1V19 A;  3NC9 A;  3NBW A;  1E0D A;  3CQD A;  1RKD A;  1J6U A;  2AWD A;  2PKN A;  4JKS A;  3BGK A;  1RKS A;  4K8P A;  4S1H A;  4YL5 A;  3RSS A;  4BUC A;  4C5L A;  5CM5 A;  3DZV A;  1UAG A;  1EKQ A;  3B3L A;  1GQQ A;  2AJP A;  2C4E A;  1GQT A;  3N1C A;  3IBQ A;  4KAH A;  4KAD A;  3IE7 A;  4KAL A;  1RKA A;  1JBW A;  1TD2 A;  2JGV A;  2JFG A;  4UAG A;  3JUL A;  3NBV A;  1LIO A;  2UUO A;  3RSQ A;  1JXH A;  5BYE A;  2XTB A; 
#chains in the Genus database with same CATH homology
 1TZ3 A;  2AJR A;  1V1A A;  2HW1 A;  2ABQ A;  3RRJ A;  5COJ A;  3GO7 A;  3B1P A;  3KTN A;  4EUM A;  2F7K A;  4E69 A;  3UQD A;  3RT7 A;  2JG5 A;  4N09 A;  3NL5 A;  1LIJ A;  5EYN A;  1YGK A;  4N08 A;  3KEU A;  1UA4 A;  3FHY A;  3HPD A;  3RQ8 A;  2F02 A;  2YXT A;  1TZ6 A;  3RTE A;  3UQE A;  1UB0 A;  4S1I B;  4LBG A;  2QCV A;  3NM3 A;  2DDM A;  4XDA A;  3NL2 A;  1LHP A;  2I6A A;  1WYE A;  3LHX A;  3RQH A;  3RTG A;  1V1S A;  4YWR A;  4K8C A;  3LOO A;  4B8R A;  4DU5 A;  4E84 A;  3IH0 A;  3RQX A;  4B8S A;  2C49 A;  3RQ5 A;  1DGM A;  3Q92 A;  3RRE A;  3RT9 A;  5BYD A;  1LHR A;  3RY7 A;  3IN1 A;  4KBE A;  5TQI A;  3RQQ A;  3RTB A;  2AFB A;  4C5M A;  4E8Z A;  3PZS A;  1ESQ A;  4JJP A;  4JKU A;  3RQ2 A;  4DC3 A;  3RRF A;  3RSG A;  4K9I A;  2PKM A;  1EKK A;  3HJ6 A;  5EY7 A;  3VAS A;  5C41 A;  2R3B A;  2JG1 A;  4EOH A;  3RO4 A;  3RSF A;  1L2L A;  4LCA A;  2A9Z A;  5CGE A;  2A9Y A;  2RBC A;  3RS8 A;  5F0Z A;  4K8K A;  2Q5R A;  1U2X A;  3FHX A;  3NL6 A;  3LKI A;  1RFT A;  4K8T A;  4XF7 A;  4GM6 A;  3W4S A;  3NCA A;  4O1G A;  3PL2 A;  3HIC A;  2NWH A;  3NL3 A;  4LBX A;  4U7X A;  5CGA A;  1VM7 A;  1ESJ A;  2DDO A;  2V78 A;  4K9C A;  3RU2 A;  2FV7 A;  4S1I A;  3RQ6 A;  4C5K A;  3UQ9 A;  2DDW A;  4S1M A;  3H49 A;  3UQ6 A;  2HQQ A;  4E8W A;  1LII A;  3DRW A;  2QHP A;  1LIK A;  3QA2 A;  1TYY A;  3Q1Y A;  3B1N A;  3MBJ A;  4LC4 A;  2I6B A;  3RS9 A;  3K9E A;  3KD6 A;  3UMP A;  3VAQ A;  4E8Y A;  5BYC A;  1VK4 A;  2AB8 A;  1C3Q A;  3BF5 A;  3B1Q A;  3GO6 A;  2PKK A;  3I3Y A;  3NC2 A;  4O1L A;  1V1B A;  2AA0 A;  3IKH A;  2YXU A;  3MBH A;  3RRB A;  3IQ0 A;  4WJM A;  4EBU A;  5B6A A;  2PKF A;  2VAR A;  4PVV A;  2ABS A;  1RFU A;  3RTA A;  1JXI A;  3B1O A;  3RTC A;  2AX3 A;  2DCN A;  3UMO A;  2R3E A;  3EWM A;  3LJS A;  4XF6 A;  5TRW A;  4C5J A;  5C3Y A;  5C40 A;  3OTX A;  4UBE A;  3ZS7 A;  3HYO A;  3RPZ A;  3RU3 A;  3RTD A;  4EN4 A;  5C3Z A;  2HLZ A;  5BYF A;  3GBU A;  4E3A A;  4X8F A;  4KAN A;  3B1R A;  1BX4 A;  1YGJ A;  3RM5 A;  4K93 A;  2I5B A;  3KZH A;  3NM1 A;  1KYH A;  3K5W A;  3RPH A;  3QAI A;  4XCK A;  3H74 A;  1RK2 A;  5F11 A;  1GC5 A;  1RFV A;  1YHJ A;  4C5N A;  1VI9 A;  1V19 A;  3NC9 A;  3NBW A;  3CQD A;  1RKD A;  2PKN A;  2AWD A;  4JKS A;  4K8P A;  3BGK A;  1RKS A;  4S1H A;  4YL5 A;  3RSS A;  4C5L A;  5CM5 A;  3DZV A;  1EKQ A;  3B3L A;  2AJP A;  4KAD A;  2C4E A;  1GQT A;  3N1C A;  3IBQ A;  4KAH A;  4KAL A;  3IE7 A;  3UBO A;  1RKA A;  2JGV A;  1TD2 A;  3JUL A;  3NBV A;  1LIO A;  3RSQ A;  1JXH A;  5BYE A;  2XTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...