2NWHA

Carbohydrate kinase from agrobacterium tumefaciens
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
312
structure length
307
Chain Sequence
MKKILVLGGAHIDRRGMIETETAPGASNPGSWMEEAGGGGFNAARNLSRLGFEVRIIAPRGGDVTGEVVAEAARQAGVEDTPFTFLDRRTPSYTAILERDGNLVIALADMDLYKLFTPRRLKVRAVREAIIASDFLLCDANLPEDTLTALGLIARACEKPLAAIAISPAKAVKLKAALGDIDILFMNEAEARALTGVRDWPNILRKAGLSGGVVTRGASEVVAFNGTEKAILHPPLIREVKDVTGAGDAMASGYLAAIAEGKTIREALRQGAAAAAITVQSSFATSQDLSKDSVEAMLGLVPQAEML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of carbohydrate kinase from Agrobacterium tumefaciens
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Signaling protein,transferase
molecule keywords carbohydrate kinase
total genus 101
structure length 307
sequence length 312
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 2nwhA00
3RQ6A 2AWDA 3RPZA 1V1AA 3BGKA 3N1CA 3HICA 3NC9A 5TRWA 3RTGA 3B1QA 3JULA 3LKIA 3RU2A 1LIJA 1RKSA 4JJPA 1L2LA 3HYOA 1RKDA 5B6AA 3LHXA 3K9EA 3RQ8A 1RFVA 3B1OA 3GO7A 3MBHA 1YGJA 3IH0A 2HW1A 4K8PA 4X8FA 3RQXA 3B1RA 4EOHA 2ABQA 1ESJA 3EWMA 2AB8A 4K8KA 4S1IA 4LCAA 3RM5A 3RQ2A 1TYYA 2HLZA 3B1PA 1GQTA 1TD2A 3KTNA 1GC5A 1RFUA 2DDWA 4N08A 4PVVA 3RU3A 2XTBA 3LOOA 3UQ9A 4C5JA 4DC3A 1DGMA 2PKFA 1RKAA 5C41A 5C3ZA 2F7KA 4K9CA 3GO6A 1TZ3A 4S1IB 5COJA 3FHYA 4S1HA 3RQ5A 3UMOA 3VASA 3NM3A 4K9IA 4JKUA 3RT9A 3IBQA 4C5KA 2C4EA 1UB0A 3RS9A 2QHPA 1YGKA 3KEUA 3NBWA 4E8WA 2ABSA 3UQ6A 1EKKA 3RTCA 1EKQA 2AJRA 3KD6A 3RRJA 3IQ0A 1KYHA 4YL5A 2I6BA 3CQDA 3IE7A 4KALA 5F11A 3QA2A 4K8CA 5F0ZA 3I3YA 3HPDA 3RTEA 1WYEA 5CGEA 4B8SA 4E3AA 4U7XA 3DRWA 4S1MA 3UMPA 3VAQA 4C5NA 3RT7A 2I5BA 3RSGA 1TZ6A 4DU5A 4KANA 3NL2A 3RTAA 2DDMA 5BYDA 3RQQA 4KAHA 2I6AA 2A9ZA 3NM1A 2FV7A 3IN1A 3RSQA 2C49A 5BYFA 2AJPA 1V19A 3H49A 5BYEA 5C40A 1ESQA 4KBEA 4XF6A 2JGVA 5C3YA 4O1GA 3RSSA 4JKSA 4XF7A 2V78A 4WJMA 3IKHA 3RS8A 3NL5A 1JXHA 1C3QA 2A9YA 2R3BA 4KADA 1UA4A 3RRBA 2YXTA 5EY7A 4LBGA 4K93A 2AFBA 3K5WA 3DZVA 3RTBA 5BYCA 4YWRA 4UBEA 2R3EA 3RTDA 4O1LA 5TQIA 3RO4A 4C5LA 1YHJA 4B8RA 4E69A 2Q5RA 5EYNA 1LIIA 3NCAA 3B3LA 3KZHA 3NL3A 1LIKA 4LBXA 3LJSA 4C5MA 3PZSA 3RRFA 3Q92A 3UQEA 4LC4A 2JG1A 4XDAA 5CM5A 1BX4A 3OTXA 3NBVA 3NC2A 1RK2A 3RY7A 2PKKA 4E84A 2DCNA 2F02A 1V1BA 3Q1YA 1RFTA 3BF5A 2JG5A 4XCKA 2DDOA 4K8TA 3RSFA 3GBUA 3NL6A 2YXUA 4E8ZA 1VK4A 3ZS7A 3H74A 1LIOA 4E8YA 3PL2A 4EBUA 1JXIA 2AA0A 2NWHA 3RREA 1VM7A 5CGAA 3B1NA 4GM6A 3W4SA 1LHPA 3FHXA 2PKNA 3MBJA 2VARA 3RPHA 1V1SA 2QCVA 2HQQA 3RQHA 3UQDA 3QAIA 4EUMA 1U2XA 1LHRA 4EN4A 4N09A 3UBOA 1VI9A 2AX3A 2PKMA 2RBCA
chains in the Genus database with same CATH superfamily
3RQ6A 2AWDA 3RPZA 4BUBA 1V1AA 3BGKA 3N1CA 3HICA 3NC9A 5TRWA 2UAGA 3B1QA 3JULA 3LKIA 3RTGA 3RU2A 3ZM6A 1LIJA 1RKSA 4JJPA 1L2LA 3HYOA 1RKDA 5B6AA 3LHXA 3K9EA 3RQ8A 1RFVA 4EOHA 2Y66A 3B1OA 3GO7A 1YGJA 3IH0A 2HW1A 3MBHA 4K8PA 4X8FA 3B1RA 3RQXA 2ABQA 1ESJA 2F00A 2AB8A 3EWMA 3HJ6A 4K8KA 4S1IA 4LCAA 3RM5A 3RQ2A 1TYYA 2HLZA 3B1PA 1GQTA 1TD2A 3KTNA 1GC5A 1RFUA 2DDWA 4N08A 4PVVA 3RU3A 2XTBA 3LK7A 3LOOA 3UQ9A 4C5JA 4DC3A 1DGMA 2Y67A 4HV4A 2PKFA 1RKAA 5C41A 5C3ZA 2F7KA 4K9CA 3GO6A 1TZ3A 4S1IB 5COJA 3FHYA 4S1HA 3RQ5A 2WTZA 3UMOA 3VASA 2JFHA 3NM3A 4K9IA 4JKUA 3ZL8A 3RT9A 2XPCA 3IBQA 4C5KA 2C4EA 1JBWA 1UB0A 1E8CA 1YGKA 2QHPA 3KEUA 3NBWA 2ABSA 3RS9A 3UQ6A 1EKKA 3RTCA 1EKQA 2AJRA 3EAGA 3KD6A 3RRJA 3IQ0A 1KYHA 2VTDA 2AM1A 3N2AA 4YL5A 2I6BA 3CQDA 3IE7A 4KALA 5F11A 4QDIA 5A5EA 3QA2A 4K8CA 2X5OA 5F0ZA 3I3YA 3HPDA 3RTEA 1WYEA 3UAGA 4ZIYA 4B8SA 4E3AA 4U7XA 5CGEA 3DRWA 3QCZA 4S1MA 3UMPA 3VAQA 4C5NA 3RT7A 2I5BA 3RSGA 1JBVA 1TZ6A 4C13A 4DU5A 4QF5A 2UUOA 4KANA 3NL2A 3RTAA 1EEHA 2DDMA 3RQQA 5BYDA 5A5FA 4KAHA 2GCAA 1FGSA 2I6AA 3NM1A 3RSQA 2FV7A 3IN1A 2C49A 3PYZA 5BYFA 2AJPA 1V19A 1GQQA 3NRSA 3H49A 5BYEA 5C40A 1ESQA 4KBEA 4XF6A 2JGVA 5C3YA 4O1GA 3RSSA 1GG4A 4JKSA 4XF7A 2V78A 4WJMA 3IKHA 3RS8A 3NL5A 1JXHA 1C3QA 2A9YA 2PKMA 2R3BA 4KADA 1GQYA 1UA4A 2YXTA 3RRBA 5EY7A 4LBGA 4K93A 2AFBA 3K5WA 3DZVA 3RTBA 5BYCA 4YWRA 4UBEA 1P3DA 1E0DA 2R3EA 3RTDA 4O1LA 1W78A 1W7KA 5TQIA 3RO4A 4BUCA 1YHJA 4C5LA 4B8RA 4E69A 2Q5RA 5EYNA 1LIIA 3NCAA 4CVLA 3B3LA 3KZHA 3NL3A 1LIKA 4LBXA 2GCBA 3LJSA 4C5MA 3PZSA 3RRFA 3Q92A 3UQEA 1UAGA 4LC4A 2VORA 4CVKA 2JG1A 4XDAA 5CM5A 1BX4A 3OTXA 3NBVA 2Y68A 3NC2A 1RK2A 3RY7A 2PKKA 2AM2A 3ZM5A 4E84A 2DCNA 2F02A 1V1BA 3Q1YA 1RFTA 3BF5A 2UUPA 2JFFA 2JG5A 3HN7A 2DDOA 4K8TA 4XCKA 3GBUA 3NL6A 2YXUA 3RSFA 4E8ZA 1VK4A 3ZS7A 4EUMA 3H74A 1LIOA 4E8YA 3PL2A 4CVMA 1JXIA 2AA0A 2NWHA 2XJAA 1VM7A 3RREA 4EBUA 3B1NA 4E8WA 1P31A 4GM6A 3W4SA 1LHPA 3FHXA 2WJPA 2PKNA 2GC6A 3MBJA 2VARA 1O5ZA 3RPHA 4C12A 1V1SA 2QCVA 2HQQA 3RQHA 3UQDA 3QAIA 2VOSA 1U2XA 1LHRA 2JFGA 1J6UA 4N09A 2GC5A 2VTEA 3UBOA 4EN4A 1VI9A 5CGAA 2Y1OA 4UAGA 2AX3A 2A9ZA 2RBCA
chains in the Genus database with same CATH topology
3RQ6A 2AWDA 3RPZA 1V1AA 3BGKA 3N1CA 3HICA 3NC9A 5TRWA 3RTGA 3B1QA 3JULA 3LKIA 3RU2A 1LIJA 1RKSA 4JJPA 1L2LA 3HYOA 1RKDA 5B6AA 3LHXA 3K9EA 3RQ8A 1RFVA 3B1OA 3GO7A 3MBHA 1YGJA 3IH0A 2HW1A 4K8PA 4X8FA 3RQXA 3B1RA 4EOHA 2ABQA 1ESJA 3EWMA 2AB8A 3HJ6A 4K8KA 4S1IA 4LCAA 3RM5A 3RQ2A 1TYYA 2HLZA 3B1PA 1GQTA 1TD2A 3KTNA 1GC5A 1RFUA 2DDWA 4N08A 4PVVA 3RU3A 2XTBA 3LOOA 3UQ9A 4C5JA 4DC3A 1DGMA 2PKFA 1RKAA 5C41A 5C3ZA 2F7KA 4K9CA 3GO6A 1TZ3A 4S1IB 5COJA 3FHYA 4S1HA 3RQ5A 3UMOA 3VASA 3NM3A 4K9IA 4JKUA 3RT9A 3IBQA 4C5KA 2C4EA 1UB0A 3RS9A 2QHPA 1YGKA 3KEUA 3NBWA 4E8WA 2ABSA 3UQ6A 1EKKA 3RTCA 1EKQA 2AJRA 3KD6A 3RRJA 3IQ0A 1KYHA 4YL5A 2I6BA 3CQDA 3IE7A 4KALA 5F11A 3QA2A 4K8CA 5F0ZA 3I3YA 3HPDA 3RTEA 1WYEA 5CGEA 4B8SA 4E3AA 4U7XA 3DRWA 4S1MA 3UMPA 3VAQA 4C5NA 3RT7A 2I5BA 3RSGA 1TZ6A 4DU5A 4KANA 3NL2A 3RTAA 2DDMA 5BYDA 3RQQA 4KAHA 2I6AA 2A9ZA 3NM1A 2FV7A 3IN1A 3RSQA 2C49A 5BYFA 2AJPA 1V19A 3H49A 5BYEA 5C40A 1ESQA 4KBEA 4XF6A 2JGVA 5C3YA 4O1GA 3RSSA 4JKSA 4XF7A 2V78A 4WJMA 3IKHA 3RS8A 3NL5A 1JXHA 1C3QA 2A9YA 2R3BA 4KADA 1UA4A 3RRBA 2YXTA 5EY7A 4LBGA 4K93A 2AFBA 3K5WA 3DZVA 3RTBA 5BYCA 4YWRA 4UBEA 2R3EA 3RTDA 4O1LA 5TQIA 3RO4A 4C5LA 1YHJA 4B8RA 4E69A 2Q5RA 5EYNA 1LIIA 3NCAA 3B3LA 3KZHA 3NL3A 1LIKA 4LBXA 3LJSA 4C5MA 3PZSA 3RRFA 3Q92A 3UQEA 4LC4A 2JG1A 4XDAA 5CM5A 1BX4A 3OTXA 3NBVA 3NC2A 1RK2A 3RY7A 2PKKA 4E84A 2DCNA 2F02A 1V1BA 3Q1YA 1RFTA 3BF5A 2JG5A 4XCKA 2DDOA 4K8TA 3RSFA 3GBUA 3NL6A 2YXUA 4E8ZA 1VK4A 3ZS7A 3H74A 1LIOA 4E8YA 3PL2A 4EBUA 1JXIA 2AA0A 2NWHA 3RREA 1VM7A 5CGAA 3B1NA 4GM6A 3W4SA 1LHPA 3FHXA 2PKNA 3MBJA 2VARA 3RPHA 1V1SA 2QCVA 2HQQA 3RQHA 3UQDA 3QAIA 4EUMA 1U2XA 1LHRA 4EN4A 4N09A 3UBOA 1VI9A 2AX3A 2PKMA 2RBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RQ6 A;  2AWD A;  3RPZ A;  1V1A A;  3BGK A;  3N1C A;  3HIC A;  3NC9 A;  5TRW A;  3RTG A;  3B1Q A;  3JUL A;  3LKI A;  3RU2 A;  1LIJ A;  1RKS A;  4JJP A;  1L2L A;  3HYO A;  1RKD A;  5B6A A;  3LHX A;  3K9E A;  3RQ8 A;  1RFV A;  3B1O A;  3GO7 A;  3MBH A;  1YGJ A;  3IH0 A;  2HW1 A;  4K8P A;  4X8F A;  3RQX A;  3B1R A;  4EOH A;  2ABQ A;  1ESJ A;  3EWM A;  2AB8 A;  4K8K A;  4S1I A;  4LCA A;  3RM5 A;  3RQ2 A;  1TYY A;  2HLZ A;  3B1P A;  1GQT A;  1TD2 A;  3KTN A;  1GC5 A;  1RFU A;  2DDW A;  4N08 A;  4PVV A;  3RU3 A;  2XTB A;  3LOO A;  3UQ9 A;  4C5J A;  4DC3 A;  1DGM A;  2PKF A;  1RKA A;  5C41 A;  5C3Z A;  2F7K A;  4K9C A;  3GO6 A;  1TZ3 A;  4S1I B;  5COJ A;  3FHY A;  4S1H A;  3RQ5 A;  3UMO A;  3VAS A;  3NM3 A;  4K9I A;  4JKU A;  3RT9 A;  3IBQ A;  4C5K A;  2C4E A;  1UB0 A;  3RS9 A;  2QHP A;  1YGK A;  3KEU A;  3NBW A;  4E8W A;  2ABS A;  3UQ6 A;  1EKK A;  3RTC A;  1EKQ A;  2AJR A;  3KD6 A;  3RRJ A;  3IQ0 A;  1KYH A;  4YL5 A;  2I6B A;  3CQD A;  3IE7 A;  4KAL A;  5F11 A;  3QA2 A;  4K8C A;  5F0Z A;  3I3Y A;  3HPD A;  3RTE A;  1WYE A;  5CGE A;  4B8S A;  4E3A A;  4U7X A;  3DRW A;  4S1M A;  3UMP A;  3VAQ A;  4C5N A;  3RT7 A;  2I5B A;  3RSG A;  1TZ6 A;  4DU5 A;  4KAN A;  3NL2 A;  3RTA A;  2DDM A;  5BYD A;  3RQQ A;  4KAH A;  2I6A A;  2A9Z A;  3NM1 A;  2FV7 A;  3IN1 A;  3RSQ A;  2C49 A;  5BYF A;  2AJP A;  1V19 A;  3H49 A;  5BYE A;  5C40 A;  1ESQ A;  4KBE A;  4XF6 A;  2JGV A;  5C3Y A;  4O1G A;  3RSS A;  4JKS A;  4XF7 A;  2V78 A;  4WJM A;  3IKH A;  3RS8 A;  3NL5 A;  1JXH A;  1C3Q A;  2A9Y A;  2R3B A;  4KAD A;  1UA4 A;  3RRB A;  2YXT A;  5EY7 A;  4LBG A;  4K93 A;  2AFB A;  3K5W A;  3DZV A;  3RTB A;  5BYC A;  4YWR A;  4UBE A;  2R3E A;  3RTD A;  4O1L A;  5TQI A;  3RO4 A;  4C5L A;  1YHJ A;  4B8R A;  4E69 A;  2Q5R A;  5EYN A;  1LII A;  3NCA A;  3B3L A;  3KZH A;  3NL3 A;  1LIK A;  4LBX A;  3LJS A;  4C5M A;  3PZS A;  3RRF A;  3Q92 A;  3UQE A;  4LC4 A;  2JG1 A;  4XDA A;  5CM5 A;  1BX4 A;  3OTX A;  3NBV A;  3NC2 A;  1RK2 A;  3RY7 A;  2PKK A;  4E84 A;  2DCN A;  2F02 A;  1V1B A;  3Q1Y A;  1RFT A;  3BF5 A;  2JG5 A;  4XCK A;  2DDO A;  4K8T A;  3RSF A;  3GBU A;  3NL6 A;  2YXU A;  4E8Z A;  1VK4 A;  3ZS7 A;  3H74 A;  1LIO A;  4E8Y A;  3PL2 A;  4EBU A;  1JXI A;  2AA0 A;  2NWH A;  3RRE A;  1VM7 A;  5CGA A;  3B1N A;  4GM6 A;  3W4S A;  1LHP A;  3FHX A;  2PKN A;  3MBJ A;  2VAR A;  3RPH A;  1V1S A;  2QCV A;  2HQQ A;  3RQH A;  3UQD A;  3QAI A;  4EUM A;  1U2X A;  1LHR A;  4EN4 A;  4N09 A;  3UBO A;  1VI9 A;  2AX3 A;  2PKM A;  2RBC A; 
#chains in the Genus database with same CATH topology
 3RQ6 A;  2AWD A;  3RPZ A;  4BUB A;  1V1A A;  3BGK A;  3N1C A;  3HIC A;  3NC9 A;  5TRW A;  2UAG A;  3B1Q A;  3JUL A;  3LKI A;  3RTG A;  3RU2 A;  3ZM6 A;  1LIJ A;  1RKS A;  4JJP A;  1L2L A;  3HYO A;  1RKD A;  5B6A A;  3LHX A;  3K9E A;  3RQ8 A;  1RFV A;  4EOH A;  2Y66 A;  3B1O A;  3GO7 A;  1YGJ A;  3IH0 A;  2HW1 A;  3MBH A;  4K8P A;  4X8F A;  3B1R A;  3RQX A;  2ABQ A;  1ESJ A;  2F00 A;  2AB8 A;  3EWM A;  3HJ6 A;  4K8K A;  4S1I A;  4LCA A;  3RM5 A;  3RQ2 A;  1TYY A;  2HLZ A;  3B1P A;  1GQT A;  1TD2 A;  3KTN A;  1GC5 A;  1RFU A;  2DDW A;  4N08 A;  4PVV A;  3RU3 A;  2XTB A;  3LK7 A;  3LOO A;  3UQ9 A;  4C5J A;  4DC3 A;  1DGM A;  2Y67 A;  4HV4 A;  2PKF A;  1RKA A;  5C41 A;  5C3Z A;  2F7K A;  4K9C A;  3GO6 A;  1TZ3 A;  4S1I B;  5COJ A;  3FHY A;  4S1H A;  3RQ5 A;  2WTZ A;  3UMO A;  3VAS A;  2JFH A;  3NM3 A;  4K9I A;  4JKU A;  3ZL8 A;  3RT9 A;  2XPC A;  3IBQ A;  4C5K A;  2C4E A;  1JBW A;  1UB0 A;  1E8C A;  1YGK A;  2QHP A;  3KEU A;  3NBW A;  2ABS A;  3RS9 A;  3UQ6 A;  1EKK A;  3RTC A;  1EKQ A;  2AJR A;  3EAG A;  3KD6 A;  3RRJ A;  3IQ0 A;  1KYH A;  2VTD A;  2AM1 A;  3N2A A;  4YL5 A;  2I6B A;  3CQD A;  3IE7 A;  4KAL A;  5F11 A;  4QDI A;  5A5E A;  3QA2 A;  4K8C A;  2X5O A;  5F0Z A;  3I3Y A;  3HPD A;  3RTE A;  1WYE A;  3UAG A;  4ZIY A;  4B8S A;  4E3A A;  4U7X A;  5CGE A;  3DRW A;  3QCZ A;  4S1M A;  3UMP A;  3VAQ A;  4C5N A;  3RT7 A;  2I5B A;  3RSG A;  1JBV A;  1TZ6 A;  4C13 A;  4DU5 A;  4QF5 A;  2UUO A;  4KAN A;  3NL2 A;  3RTA A;  1EEH A;  2DDM A;  3RQQ A;  5BYD A;  5A5F A;  4KAH A;  2GCA A;  1FGS A;  2I6A A;  3NM1 A;  3RSQ A;  2FV7 A;  3IN1 A;  2C49 A;  3PYZ A;  5BYF A;  2AJP A;  1V19 A;  1GQQ A;  3NRS A;  3H49 A;  5BYE A;  5C40 A;  1ESQ A;  4KBE A;  4XF6 A;  2JGV A;  5C3Y A;  4O1G A;  3RSS A;  1GG4 A;  4JKS A;  4XF7 A;  2V78 A;  4WJM A;  3IKH A;  3RS8 A;  3NL5 A;  1JXH A;  1C3Q A;  2A9Y A;  2PKM A;  2R3B A;  4KAD A;  1GQY A;  1UA4 A;  2YXT A;  3RRB A;  5EY7 A;  4LBG A;  4K93 A;  2AFB A;  3K5W A;  3DZV A;  3RTB A;  5BYC A;  4YWR A;  4UBE A;  1P3D A;  1E0D A;  2R3E A;  3RTD A;  4O1L A;  1W78 A;  1W7K A;  5TQI A;  3RO4 A;  4BUC A;  1YHJ A;  4C5L A;  4B8R A;  4E69 A;  2Q5R A;  5EYN A;  1LII A;  3NCA A;  4CVL A;  3B3L A;  3KZH A;  3NL3 A;  1LIK A;  4LBX A;  2GCB A;  3LJS A;  4C5M A;  3PZS A;  3RRF A;  3Q92 A;  3UQE A;  1UAG A;  4LC4 A;  2VOR A;  4CVK A;  2JG1 A;  4XDA A;  5CM5 A;  1BX4 A;  3OTX A;  3NBV A;  2Y68 A;  3NC2 A;  1RK2 A;  3RY7 A;  2PKK A;  2AM2 A;  3ZM5 A;  4E84 A;  2DCN A;  2F02 A;  1V1B A;  3Q1Y A;  1RFT A;  3BF5 A;  2UUP A;  2JFF A;  2JG5 A;  3HN7 A;  2DDO A;  4K8T A;  4XCK A;  3GBU A;  3NL6 A;  2YXU A;  3RSF A;  4E8Z A;  1VK4 A;  3ZS7 A;  4EUM A;  3H74 A;  1LIO A;  4E8Y A;  3PL2 A;  4CVM A;  1JXI A;  2AA0 A;  2NWH A;  2XJA A;  1VM7 A;  3RRE A;  4EBU A;  3B1N A;  4E8W A;  1P31 A;  4GM6 A;  3W4S A;  1LHP A;  3FHX A;  2WJP A;  2PKN A;  2GC6 A;  3MBJ A;  2VAR A;  1O5Z A;  3RPH A;  4C12 A;  1V1S A;  2QCV A;  2HQQ A;  3RQH A;  3UQD A;  3QAI A;  2VOS A;  1U2X A;  1LHR A;  2JFG A;  1J6U A;  4N09 A;  2GC5 A;  2VTE A;  3UBO A;  4EN4 A;  1VI9 A;  5CGA A;  2Y1O A;  4UAG A;  2AX3 A;  2A9Z A;  2RBC A; 
#chains in the Genus database with same CATH homology
 3RQ6 A;  2AWD A;  3RPZ A;  1V1A A;  3BGK A;  3N1C A;  3HIC A;  3NC9 A;  5TRW A;  3RTG A;  3B1Q A;  3JUL A;  3LKI A;  3RU2 A;  1LIJ A;  1RKS A;  4JJP A;  1L2L A;  3HYO A;  1RKD A;  5B6A A;  3LHX A;  3K9E A;  3RQ8 A;  1RFV A;  3B1O A;  3GO7 A;  3MBH A;  1YGJ A;  3IH0 A;  2HW1 A;  4K8P A;  4X8F A;  3RQX A;  3B1R A;  4EOH A;  2ABQ A;  1ESJ A;  3EWM A;  2AB8 A;  3HJ6 A;  4K8K A;  4S1I A;  4LCA A;  3RM5 A;  3RQ2 A;  1TYY A;  2HLZ A;  3B1P A;  1GQT A;  1TD2 A;  3KTN A;  1GC5 A;  1RFU A;  2DDW A;  4N08 A;  4PVV A;  3RU3 A;  2XTB A;  3LOO A;  3UQ9 A;  4C5J A;  4DC3 A;  1DGM A;  2PKF A;  1RKA A;  5C41 A;  5C3Z A;  2F7K A;  4K9C A;  3GO6 A;  1TZ3 A;  4S1I B;  5COJ A;  3FHY A;  4S1H A;  3RQ5 A;  3UMO A;  3VAS A;  3NM3 A;  4K9I A;  4JKU A;  3RT9 A;  3IBQ A;  4C5K A;  2C4E A;  1UB0 A;  3RS9 A;  2QHP A;  1YGK A;  3KEU A;  3NBW A;  4E8W A;  2ABS A;  3UQ6 A;  1EKK A;  3RTC A;  1EKQ A;  2AJR A;  3KD6 A;  3RRJ A;  3IQ0 A;  1KYH A;  4YL5 A;  2I6B A;  3CQD A;  3IE7 A;  4KAL A;  5F11 A;  3QA2 A;  4K8C A;  5F0Z A;  3I3Y A;  3HPD A;  3RTE A;  1WYE A;  5CGE A;  4B8S A;  4E3A A;  4U7X A;  3DRW A;  4S1M A;  3UMP A;  3VAQ A;  4C5N A;  3RT7 A;  2I5B A;  3RSG A;  1TZ6 A;  4DU5 A;  4KAN A;  3NL2 A;  3RTA A;  2DDM A;  5BYD A;  3RQQ A;  4KAH A;  2I6A A;  2A9Z A;  3NM1 A;  2FV7 A;  3IN1 A;  3RSQ A;  2C49 A;  5BYF A;  2AJP A;  1V19 A;  3H49 A;  5BYE A;  5C40 A;  1ESQ A;  4KBE A;  4XF6 A;  2JGV A;  5C3Y A;  4O1G A;  3RSS A;  4JKS A;  4XF7 A;  2V78 A;  4WJM A;  3IKH A;  3RS8 A;  3NL5 A;  1JXH A;  1C3Q A;  2A9Y A;  2R3B A;  4KAD A;  1UA4 A;  3RRB A;  2YXT A;  5EY7 A;  4LBG A;  4K93 A;  2AFB A;  3K5W A;  3DZV A;  3RTB A;  5BYC A;  4YWR A;  4UBE A;  2R3E A;  3RTD A;  4O1L A;  5TQI A;  3RO4 A;  4C5L A;  1YHJ A;  4B8R A;  4E69 A;  2Q5R A;  5EYN A;  1LII A;  3NCA A;  3B3L A;  3KZH A;  3NL3 A;  1LIK A;  4LBX A;  3LJS A;  4C5M A;  3PZS A;  3RRF A;  3Q92 A;  3UQE A;  4LC4 A;  2JG1 A;  4XDA A;  5CM5 A;  1BX4 A;  3OTX A;  3NBV A;  3NC2 A;  1RK2 A;  3RY7 A;  2PKK A;  4E84 A;  2DCN A;  2F02 A;  1V1B A;  3Q1Y A;  1RFT A;  3BF5 A;  2JG5 A;  4XCK A;  2DDO A;  4K8T A;  3RSF A;  3GBU A;  3NL6 A;  2YXU A;  4E8Z A;  1VK4 A;  3ZS7 A;  3H74 A;  1LIO A;  4E8Y A;  3PL2 A;  4EBU A;  1JXI A;  2AA0 A;  2NWH A;  3RRE A;  1VM7 A;  5CGA A;  3B1N A;  4GM6 A;  3W4S A;  1LHP A;  3FHX A;  2PKN A;  3MBJ A;  2VAR A;  3RPH A;  1V1S A;  2QCV A;  2HQQ A;  3RQH A;  3UQD A;  3QAI A;  4EUM A;  1U2X A;  1LHR A;  4EN4 A;  4N09 A;  3UBO A;  1VI9 A;  2AX3 A;  2PKM A;  2RBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...