3RRJA

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima in complex with p1,p5-di(adenosine-5') pentaphosphate
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
489
structure length
489
Chain Sequence
MKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
total genus 176
structure length 489
sequence length 489
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rrjA01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3rrjA02
1TZ6A 2HW1A 1RFUA 1YGJA 1V1AA 2DDMA 1LIIA 2O8NA 3PZSA 4PVVA 4N09A 5CM5A 3RQ6A 4LBXA 3RY7A 3RTBA 3GO7A 3ROXA 3LOOA 3BF5A 3UQ9A 3B1NA 3RO4A 4S1IB 3KZHA 3W4SA 4C5KA 4C5LA 3FHXA 4LC4A 1GC5A 1LIKA 1KYHA 4K9IA 4K93A 1BX4A 3NM1A 2XTBA 1DGMA 5CGAA 3MBHA 3RQ2A 2Q5RA 3ROEA 4EUMA 5C3YA 1C3QA 2F7KA 3IN1A 3K5WA 4E8ZA 3IKHA 4GM6A 4E69A 3BGKA 4XDAA 3RTDA 2V78A 1JXIA 3QA2A 3B3LA 5TQIA 3NM3A 2I5BA 3KD6A 4E84A 5C40A 2FV7A 2DDWA 4XCKA 2DCNA 2QHPA 3B1OA 5B6AA 1EKQA 3QAIA 2AX3A 3RS8A 1LHPA 2R3EA 3RPHA 5C3ZA 1RK2A 3RRJA 2PKNA 4KBEA 3UMPA 3GBUA 3H74A 3FHYA 3LHXA 4C5MA 4K8PA 4S1IA 1RKSA 4N08A 3ROZA 5C41A 1EKKA 2A9ZA 4EBUA 1YHJA 3I3YA 4B8SA 1LIJA 1RKAA 1RKDA 2AJRA 3NBVA 4LCAA 3RPZA 3IE7A 1UB0A 5EY7A 3RQQA 2AA0A 3UMOA 3UBOA 4EOHA 1TZ3A 4U7XA 3UQ6A 3RTGA 5BYFA 4WJMA 2QCVA 2YXUA 4DU5A 4XF7A 2F02A 2HQQA 3OTXA 3MBJA 3RQ8A 1JZTA 1ESQA 1TD2A 2PKMA 3LJSA 5BYCA 3RU3A 3NBWA 2AJPA 3B1PA 3IBQA 5EYNA 3HYOA 1LIOA 2I6AA 2A9YA 3RTAA 3IQ0A 2DDOA 5F11A 1VI9A 3RNOA 1L2LA 3Q1YA 4X8FA 2AB8A 3RTCA 3NL3A 3NC9A 2RBCA 3RTEA 3KTNA 3H49A 3Q92A 2PKKA 3RT9A 3HPDA 2R3BA 3UQDA 3NC2A 4B8RA 3B1RA 2AWDA 2I6BA 3RQ5A 3ROGA 3IH0A 2JG1A 3RS9A 1TYYA 3B1QA 3DZVA 4JKUA 2JGVA 3JULA 3UQEA 1JXHA 3RT7A 1GQTA 2ABQA 1V1SA 4K8TA 4YWRA 1WYEA 5TRWA 1YGKA 3RQXA 3RSGA 3D3KA 3RREA 3NCAA 2C49A 4KADA 4LBGA 4O1LA 1RFVA 2AFBA 4E8YA 3NL2A 4S1MA 4JJPA 3KEUA 4K8KA 3RQHA 3VASA 3N1CA 4KANA 5COJA 4C5JA 3RRBA 2VARA 4K8CA 3RM5A 3RU2A 4K9CA 3K9EA 3ZS7A 3RSFA 3CQDA 1LHRA 4E3AA 3RO7A 4KAHA 4EN4A 2C4EA 1VK4A 3RRFA 3RSSA 4KALA 4S1HA 4UBEA 4YL5A 4E8WA 5F0ZA 1ESJA 2JG5A 2PKFA 1V19A 3VAQA 4DC3A 5BYDA 2NWHA 3HICA 4XF6A 1U2XA 3RSQA 2YXTA 3GO6A 5BYEA 2ABSA 3D3JA 3NL5A 2DG2A 5CGEA 1VM7A 2HLZA 4O1GA 1UA4A 4C5NA 1V1BA 3PL2A 3EWMA 3LKIA 3DRWA 3NL6A 1RFTA 4JKSA
chains in the Genus database with same CATH superfamily
4M9XA 2NLOA 3FTQA 5BSHA 2A5DA 4ND1A 1EWTA 2DP4E 3KFLA 5AKEA 1GCGA 3QF7A 2AHOA 2GN6A 4BECA 3F6YA 1P62B 4K2AA 4DM4A 4ZYWA 5EXSA 3K35A 1XWIA 1HI9A 1L5YA 2WFZA 4FN4A 4BFXA 4DZRA 1E3LA 3G2OA 3GFBA 3GAFA 3PQFA 1I4WA 1YB7A 4R01A 4FFDA 1MJNA 3I39X 1WO8A 5HFAA 2BMFA 3MN1A 2C7GA 3DJYA 5ETJA 3MCTA 4HDOB 5EWJA 4B79A 5K2OA 2XCSB 2GBGA 1WM1A 3BXPA 1JJVA 1RRGA 4HRVA 3GYBA 2VDRB 3RTDA 2OQ2A 2DT8A 1UP7A 4GL4A 1Y1KE 4ND3A 1NN3A 5LYYA 1W2WB 4AC9A 2ES4A 3NJ4A 2ORIA 2NUTA 2VNAA 2WNSA 4U9HS 4RPLA 1PFGA 1PL8A 1RYZA 2WDZA 3F7TA 1A9ZA 1QBGA 3P2KA 2B99A 4B3RB 2F7SA 3PGJA 3RPHA 4TS3A 4G81A 4DMHA 4EHHA 2UUBB 1U8TA 1PAUA 1J33A 3UICA 1DCFA 2X8BA 1YBMA 3P4YA 5C52B 3M89A 1DC8A 1JG4A 1KDPA 2VRBA 1K68A 2TYSB 2PS3A 3V7WA 4G1BA 4WINA 2MDTA 2WE8A 1LIJA 2AJRA 2I4RA 2OL4A 3C41J 2J5KA 3IDFA 1ODLA 1J8FA 3GGCA 1KKUA 1N75A 2WHPA 3QZUA 2OCXA 4Y6GB 1Q7EA 2OFOA 5AVKA 2ZRKA 4RJLA 1Y8QA 4Z9YA 5FPPA 1T1SA 2ZIEA 1UFOA 3OFNA 4UHBA 4HAZA 5CAEA 3TCXB 1HR0B 1H66A 3Q0IA 4EYGA 3KVOA 1MEJA 4QGGA 2CGEA 2FFRA 2N0SA 3PP8A 4CKWB 4MP6A 4G5SA 4YMIA 1YOVA 1OTHA 4BB6A 2CXQA 4G23A 4JLUA 4P0TA 5ALWA 3X1ZA 3KPVA 5A9SB 4YCLA 3J80A 3QV1A 1LC0A 2ACVA 4ITRC 3A9WA 3OESA 1XTPA 2X3UA 4KAXA 5HF5A 2RHHA 3R9IA 9LDBA 3U6BA 1YU6A 1ZGBA 5DX0A 1WR8A 1DG3A 2CMHA 1KK2A 3KYDA 5AWFC 2O3UA 5NULA 3M3DA 3RTEA 4BQFA 1HDOA 2OLEA 2QPOA 4MMZB 1IMOA 1SHUX 4PBRA 5C9ZA 4ARIA 4HDRA 4MLCA 4KP7A 3AB8A 5EXDA 2H06A 1KVQA 5IDVA 4B48A 2E2WA 1NXTA 2JEOA 4PAQA 2BGIA 2BFCA 2WD9A 4XTRA 1LDEA 2PLNA 3GRYA 3ONVA 4FYMA 4URFA 5DE3A 4JI5B 2O2SA 2ZBUA 3BXFA 5L3QA 1CV2A 1FS4A 1ZK4A 2IV2X 1AKYA 1FW8A 1OFTA 1U7UA 5EJFA 2F00A 3P19A 5ICCA 2AZDA 4IFBA 4JLWA 4D42A 3PDWA 4F2WA 1RRPA 2W83A 4XGKA 1J2TA 4M9CA 4RVFA 1N2XA 5CFPA 1DO0A 1RCUA 5DNAA 3S99A 4F4JA 1VDMA 1WW8A 1TOAA 2AG6A 5B7QA 1FRZA 1C7FA 3SAJA 1CK4A 2Q99A 2V98A 4JELA 3P9SA 5D1NA 2YWDA 3QLTA 5I48A 1CSEE 2B9EA 4ZO7A 4UNRA 1I1NA 1I94B 2AQ8A 1BE6A 5EHQA 3KJQA 3EVBA 1E3WB 2FZWA 1P8AA 3NAGA 1RLIA 5BPFA 1YWGO 3C1AA 2WJ6A 5EVCA 2VARA 1T2NA 2W2QA 2CEAA 1KK3A 2TMKA 2V7WA 3E5HA 5T8KA 1FX0B 4LBXA 2VCHA 2JFZA 3U7GA 4XB6B 1HORA 4L4RA 3CUSA 1RM5A 5LOVF 1E5TA 4BLOA 4W9RA 1E3IA 3IQIX 4OMFG 5EKUA 3AW9A 2XSZD 2ZIWB 2WSMA 2BHSA 4KFUA 3HY3A 4KUEA 1V11B 3IBFA 4YS6A 3WLLA 4WZAB 1CQPA 3D9QX 3MUEA 3UOAB 5C35A 4CLRB 2HFJA 1JDUA 1Z12A 1PO7A 1E1CA 4IBOA 4NYJR 1F2TA 3UXHA 2I6GA 4WECA 3WKBA 5EUQB 5JRDS 3PJDA 3AR2A 3JASA 2UZ0A 3LUHA 1W76A 4YYZA 2DHDA 3EZNA 4QU8A 1OFVA 2WA1A 4X1YB 1GLVA 4WLEA 3S1AB 5IAAA 1S6YA 1H4TA 1HO3A 2H1LA 3LECA 4HSGA 4JQOA 5TQIA 3FPBA 3PC2A 1CJCA 1TJYA 1DEKA 2IYVA 2ZVPX 4UUNA 3RLIA 5HIIA 5L95A 5C5EA 4MS4A 4D7AA 3S2YA 4G36A 3LT2A 4N3CA 3W4IA 3IIKA 2HR1A 3CR8A 1W6RA 2ZUDA 3U37A 2OCGA 3W4KA 5JAZA 2EBFX 1ITZA 4P84A 4KVAA 1G18A 4ND4A 4AS3A 2Y3IA 1CRZA 1ONNA 4I3HA 4ENWA 2NZ2A 4EBUA 4U8HA 2OXCA 1SOWA 4A82A 4LE0A 4FM9A 1AOXA 3CLRC 4Z4IA 1J0EA 4J6FA 1R8QA 4N47A 2J30A 4B80A 4RY0A 3O92A 1SPBS 2YUIA 1JR3E 3HVRA 2GARA 1VE1A 1KOGA 1WNTA 1QHNA 2W2KA 1I7PA 1RAFA 2CWDA 1DC6A 2XCIA 3ELWA 2YYAA 3GUCA 5HTKA 1E0AA 3C0KA 4WN9A 2ZQZA 2PZAA 2F67A 4AQDA 1XVVA 4H6PA 1DDOA 3FHCB 2HMUA 3LRTA 4JVNA 2R65A 3CZRA 5IG2A 1CWUA 5DHAA 3ZWXA 1ZK1A 2RSLA 1MQ9A 5IM5A 1ACMA 1W34A 2J9XB 4KZKA 2OESA 5FUXA 4MDYA 2IK8A 5IYZA 1ESEA 2COEA 3A3PA 3AIIA 1VKZA 2NUBA 2ZRLA 5L3RA 4S12A 3ROPA 5JFTA 4F5YA 4Q4AB 1EX1A 3LC2O 3RSZA 4J2TA 1K3TA 3CUTA 4ZOEA 1SG9A 3I6ZA 3ROMA 5AW1A 5J43A 1BXRB 2GEVA 3WWCA 4DM7A 1IU9A 3K0FA 1K92A 3MPOA 1WHTA 1MHPA 3INYA 4YECA 5T3UA 5JAPA 1QOZA 2VWGA 3NBAA 4GKVA 4G2TA 4NWIA 3OT5A 3VR6A 3PITA 4KV9A 5JR3A 1V48A 5B6IA 5KMGB 4CG2A 4PCVA 1F8GA 1T2FA 3DE2X 3I58A 1A9SA 4WD3A 3K53A 3GLVA 1IWPB 1OYVA 2JFNA 3GG9A 2J0SA 4Z7JA 1F9EA 1OF1A 3COWA 3QVVA 1NE7A 1YE8A 1VJTA 3QKSA 1THZA 4DSNA 1ZD9A 2VQ3A 3CCCA 2NQTA 4S1WA 1I2MA 1NVTA 3BJMA 3WO1A 2C96A 1LIIA 4EB6A 3DWIA 1UIMA 1T8WA 3TLEA 3IO3A 2I55A 3L5OA 1LRLA 2BZSA 1DRUA 4H0CA 4B87A 3JWGA 1Z6TA 2JJ2A 3F90A 1EPUA 1FQOA 2NU7A 2Q5FA 2X9NA 3PDCA 3A9RA 2VDWB 1GL7A 1EAMA 4IOMA 4RA9B 3IPLA 4JUCA 1JDJA 1B00A 1XK7A 4PYNA 4BE7B 4N18A 3A4MA 2R4UA 5EMJA 4Q5IA 3VKHA 3ZCTA 1NLYA 3LV8A 1Z4MA 1E4EB 1YA6A 1GNSA 2P3OA 4EG6A 1N4DA 4H3KB 4AN1A 1JQEA 4D4JA 2EFJA 4EJFA 3RRXA 4MZXA 4ER0A 1K2VN 1ICEA 1NNEA 3SX4A 3IALA 5F7XA 1I4DD 3HKBA 1FSSA 2LKDA 5LQAA 2QTLA 5KTKA 3GPLA 3B1OA 2QX9A 3RUAA 2ZB3A 1K6EA 1BS2A 4OQNA 2HA2A 3B1JA 2IVZA 3EF3A 2Q07A 2NIPA 3ZY2A 1F9AA 2GPSA 3AETB 5DHUA 2DTEA 1LS1A 2XD9A 3QYAA 2GN9A 2ZG6A 1A8QA 3LLMA 3O1HB 4IDNA 3F1KA 4NZZA 5ALEA 5JVDB 3T34A 3V6LA 3A06A 4N8EA 2OXIA 5FWNA 1WHSA 3QIAA 4RYLA 5GAJA 4PO8A 3T7IA 2IQIA 1PQ4A 5AVXA 1CZLA 1TYBE 2GYWA 2JCGA 2P2LA 2XT6A 4RM2A 1JHDA 5BQPA 3EC7A 2CW5A 3EUFA 2P90A 4AZ3A 2VPIA 3KYCB 4BZQA 2AFHE 1QHYA 2BEJA 1TAHA 3D8NA 3MOGA 1OLUB 5F7ZA 1ADJA 2NW6A 3J7AC 2ZOSA 5CJJA 4U5QA 5ITZA 3SBEA 3LLVA 4WEQA 4JX8A 4MQ6A 3W5SA 4FOLA 3KXLA 1H8EA 4AWBA 3R9XB 5CVJA 3EVZA 5TMPA 3OO0A 3CMCO 5EJ2A 3IPAA 3UKJA 4XOUA 2QMEA 2UYQA 1ZM4A 4GXTA 2VEDA 3GV0A 1ZEJA 4IILA 3IGFA 2PKKA 2JGRA 1QDEA 3OPYB 4JLKA 3HYRA 3I2FA 3FNBA 1QHFA 4FCVA 3ZW8A 5L4SA 3KD3A 2P4EA 2ORWA 4AKEA 2ZTSA 4WUTA 1KWGA 2D4HA 4Z6KA 3ZWWA 3N6RA 1NF9A 2C07A 2C4WA 2O7SA 2O1XA 3D64A 1TVCA 1QB7A 2YOHA 3DUFB 3KJIA 3L0OA 1Y6ZA 3TIFA 3U4DA 3IJRA 2X2OA 4HNRA 3H5OA 4UZSA 2HJHA 3U39A 4JQCA 1YIOA 3HDTA 1QH9A 2VTDA 1VIDA 4QRDA 2QTBA 1YJXA 2J3IA 2ZBEA 3CURA 1W36D 2V5VA 1J22A 4B3MB 1RWNA 1YGPA 4RULA 3N2KB 4I4NA 1B6TA 5G3YA 5AP9A 3EZGA 2I87A 3GFQA 3QYJA 2EF0A 5JZMA 4H1VA 4MDFA 1RBZA 3F67A 5I7HA 3HSSA 2VHXA 3GG2A 5BYDA 4FYWA 1LCIA 3GOQA 3KOYA 4LYFA 4YCMA 4OXXA 1QP4A 1GLGA 4MVJH 3L1IA 5IXJA 4RGBA 2R62A 4B33A 1AUXA 4GOOD 3JZFA 1RRKA 3EVAA 4JEIA 1O7JA 3TSAA 5F9FA 2FHPA 3EEFA 5EJGA 1RFUA 1J8QA 2RAPA 2D2FA 3ANYB 3ZE9A 4M8NE 3DPIA 4CM5A 4E33A 2X19A 1D2NA 2JVIA 2OB1A 2XWSA 3KJGA 2Q0HA 5H59A 4YXWD 1QVVA 5KJ1A 3AVPA 1X8JA 3I37X 2Q46A 1E9BA 2HHAA 3JRWA 3M4XA 1QP8A 3DOFA 3VO8A 5JTTA 4J1NA 4OI0A 1LI5A 3ESCA 5B36A 1X7YA 4BKPA 4A7PA 2WWFA 1FS5A 3C8UA 1F12A 3AVUA 3NG1A 2IX3A 3OT1B 4FFBB 4K0RA 4MWDA 1WUIS 5KJEA 1ECGA 2PLWA 2IZ7A 4L3OA 3FYTA 4PTLA 3OFJA 4CR8A 3PC8C 1NQ5A 2VPWA 2WVJA 2EQ5A 3PEVA 4JGGA 4RY2A 2ZIFA 4RUKA 1OVGA 2N75A 3F4BA 2VUSA 3MMZA 4WA7A 1RQNA 1VL6A 1VRWA 2QQ5A 5FF9A 1Z07A 3F6BX 3HYNA 2JAXA 3FFTA 3T9FA 3LF1A 5AVRA 2CLDX 3GGDA 1ODIA 3SJUA 2C9DA 1WRBA 1IOZA 2PT5A 4R1MA 5EP1A 4B6PA 1M7GA 3OQVA 4C6TA 1Y3HA 4IYJA 4KQHA 3VTFA 2I2BA 5KNCA 1QZ3A 2M1ZA 1RJGA 2H5EA 1R4MA 4FFRA 2HAEA 5CVUA 1NNI1 4BEJA 3GLGE 1FL9A 4IUDS 2Q3EA 3BN3A 3BM5A 3BQMB 3BUSA 2J33A 2QL6A 3CLTD 3ND8A 2X23A 3U0VA 2V3CC 4LHSA 4Z4GA 2M9MA 3G5TA 1RAHA 2WP8J 1PBNA 4ZAFA 2IKSA 4A6XA 4JR2A 4ZI3A 1Q3TA 3PNOA 2J07A 1JSZA 1R8YA 1XDGA 1G7CA 2J0UA 1QMPA 4IGFA 4MUXA 4XVRA 2BLNA 4AG5A 7ADHA 4TV8A 5KU1A 4JASB 3BK1A 1E32A 4PSCA 5JZOA 3CJQA 3N2YA 4NBRA 5M7EA 2BTEA 1N8TA 1JZTA 2RIPA 2PGJA 5F7JA 4GE0A 1UT6A 4ZCTA 5DLYA 4R3NA 4E13A 5HIMA 3WYDA 1OH8A 1OR8A 4OUDB 5A0FA 4W5HA 4OOFA 1EINA 5F33A 2J6BA 1RYFA 1Y48E 2ZUUA 4GVXA 5FA6A 4D8VA 2N3ZA 2RB4A 4TT8A 1NRXA 1GR1A 5J63A 3GB9A 3OPMA 1OOEA 5IEJA 1R66A 1HSOA 3OQOA 3WY9A 3I72A 3DLBA 1W5EA 2UZ1B 3OY2A 1NC3A 3DV2A 3VMFA 2XT0A 1Z0FA 1DKMA 4ED9A 5A5VA 3NR2A 5DM2A 1G5IA 1PGJA 3HA7A 3HI6A 4W5TA 2JIMA 1APBA 2V7EA 2C2MA 4CXMA 5MF6A 2Z56A 2ZB2A 5ALSA 4DEYA 2GEBA 1TZ2A 1QC5B 3V6MA 2HQOA 1SXJE 3NJ8A 3AUJB 4QJ5A 3GUYA 1OXKB 4TLAA 4WT7A 1GZHB 1GGHA 3HJGA 3K09A 1FVFA 3Q8XB 3CJTA 2WAMA 3TSZA 3X43A 5FWXB 1QZXA 4IJVA 3SHWA 5B6PA 3EPJA 1KETA 2ZI3A 1TYEB 1GUBA 4I2VA 1HDZA 1U11A 2VTEA 1CUEA 3UVEA 2HJWA 5JISA 1VMAA 4LW8A 4C7OB 2CE2X 2OCPA 3W9YA 4HCJA 1V5GA 2AMVA 2R8RA 3BDIA 3E03A 3I9NA 5CT8A 4EL5A 3ZHOA 1G5FA 2OAEA 5JS2A 5LMZA 3LUFA 5IT0A 4G1MB 3OKCA 4X60A 4TL8A 3W3AA 1R4AA 3QYPA 2EC5A 3HBFA 4UMVA 1EIWA 1JFVA 3B8HA 1DRKA 4KOAA 1CKEA 4KXQA 1GEGA 4MQ5A 5IC6A 1YJ5A 3QTBA 2VFAA 3F2IA 3FCAA 1REQB 2ZRQA 5ESXA 2EKQA 3W5UA 3E9YA 3MIIA 3QKWA 1U8FO 2EVWX 1KI8A 3UAZA 4MAAA 4MO9A 3PXUA 2R1UA 3C16C 3LK7A 1VE9A 4QA9A 4XSHA 1C8LA 3Q6MA 4RKYA 1AE1A 3MTIA 1RYNA 5CX4A 2HL6A 2WA2A 4X95A 5JRJA 1DJMA 1XGKA 2GA8A 5DX1A 4Q7JB 2B5VA 4FMCB 4LJ7A 3DL7A 1IBMB 1R8SA 1D04A 2DQSA 5G1NA 1Q16A 1S5PA 2IPNA 4OX9B 1YC5A 4P3YA 1E6WA 2WVGA 3G8CA 1KO8A 3QF4A 2XUDA 4NHOA 5F1YA 1C7EA 1T5LA 1S96A 1XROA 3R6WA 4CL8A 1FQWA 2IH2A 2VHJA 2V78A 1QQBA 1QF7A 3FWPA 4LYYA 4TLCA 2DY0A 1HFWA 2J48A 4KUGA 3RJTA 4B6RA 1V1MA 1VE3A 1J2RA 5CITA 3C2QA 3ZDQA 3YASA 1Q0LA 3N75A 5H0IA 2QRHA 5T41A 2Q5QA 1W87A 1W4LA 3C97A 4XVHA 4IMPA 1I14A 1QIDA 1ZMOA 2Q27A 2WUVA 4HDSB 4P7GA 5CH5A 3O1LA 2ERYA 3BD9A 4TV9B 4DV7B 4ZQBA 2YHAA 4ALNA 1V8BA 2AFRA 3ZLBA 2Q3DA 2VXBA 4FZJA 2HF9A 5ARDA 3T3OA 2ID9A 1SQ5A 3D6FA 3SF8A 1TQ8A 4BN4A 3IO5A 4O4LB 3WIUA 5J4LA 4B43A 5BV2P 1NGSA 3T4EA 1EFKA 1CE8A 1Q0ZA 5GWXA 2XXAB 3I05A 1HGXA 1OKKD 1TQHA 3HLKA 4KQGA 4XKJA 3L82B 1T2AA 3NIFB 2XTMA 1E3JA 2P2DA 3AEQA 4ETMA 1JWLA 2B7BA 3WLQA 2CHVA 2Q9CA 1O95A 1UQRA 1SWWA 2OKCA 2XTNA 4HKTA 4D4MA 3F6SA 4MQBA 2PBZA 4IHKA 5H1YA 3WLFA 1P0PA 4HNVA 1G9SA 1VP3A 2RGAA 3UXMA 2RGXA 4FJ0A 1VXOA 2PX5A 3V4VB 2J45A 1KMQA 1QGUA 3UKOA 4CF4A 5B30A 4RZSA 3D4BA 2R3BA 4WLNA 3TOXA 2AWDA 2ZE7A 4I1PA 1SNYA 2NV2B 1AKEA 1DEHA 4EKNB 2FQYA 3VC1A 3DVSX 3ZY4A 3M4YA 2PZMA 5IZCC 3QWBA 3Q41A 2J3QA 1SBIA 2C57A 4D44A 1FC0A 1JQKA 3HA3A 4ZO4A 4GL2A 2V3WA 1RFGE 3PHJA 4MXDA 4TL6A 3KLNA 2DPLA 4BTEA 4OLJA 5GZ1A 2ZSHA 1DSSG 2AZMA 3OLZA 4I5GA 5ALGA 1GT91 5E1DA 4F9TA 1D9ZA 2ECOA 1LI7A 3TMYA 4UBOA 4DIKA 2Q6KA 4RKWA 3FJ1A 1HA3A 1C30B 1HWYA 2QLNA 3BG5A 3AESB 4IY1A 1JQLB 2NYRA 4C01A 1R5BA 1MX5A 5KSYA 5KTMA 1E18A 3MOIA 4KPUA 5TDHA 3ED1A 4MGHA 4CT4B 1UPAA 2EZUA 4ZYTA 3T1YB 2QLLA 1K06A 2YRWA 2JJ1D 1CVIA 1MGOA 3GROA 3I09A 3L8GA 2WHXA 3EODA 4UM5A 3GRAA 1FNMA 5JSYA 1YASA 1RM4A 3VISA 4DBZA 4ND2A 4WKCA 3L3BA 5ANRB 1T8PA 2GXQA 1M1YA 4NPAA 1FLAA 1PU2A 4NE9A 4YALA 1E9SA 2AJBA 1D4OA 3EH1A 1JBVA 4OJTA 2VO1A 5FNVF 2VDKB 4OA5A 5K05A 2QI9F 3L8YA 1V7ZA 4DDHA 4YCNA 5K3AA 3UFXA 3DDZX 4B44A 4NV3A 4DR2B 1IIBA 2CZGA 4EPVA 3ILVA 3GFSA 2DF8A 3RWMB 4MB6A 1PF7E 4KXXA 4HJRA 1SBCA 5BW5A 3Q5GA 2FLWA 1LK7A 3A4LA 4UU1A 4D9FA 3D7SA 1EFPA 1E6UA 4BO0A 1U8YA 2W4IA 5C8VA 3MHPA 4LYEA 5DYIA 5ECDA 1LC3A 2JIPA 3RHFA 4BL5A 1QU3A 2D59A 4RSMA 3IIIA 4DA9A 3RARA 5HF6A 4JOQA 2XHZA 1BFKA 1M74A 4U00A 1BWRA 5B58C 3COJA 1N6IA 1TGVA 3STTA 3AVXA 1SVWA 4QYIA 1ETUA 1M2VB 2AYYA 1CIJA 1T4CB 3ESDA 3OD1A 4P36A 3WK5A 3RADC 3ZCXA 3BF8A 4F56A 3JV7A 2H4XA 4UCFA 4AZWA 4IJ6A 5EIBD 3COPA 4P4SB 4ZMSA 1EXMA 2BRUA 5KYYA 3KR0A 1WF3A 3OIVA 4ZCRA 1FBTA 5C8YB 1AU9A 3AG5A 4LRUA 5GV8A 4EF5A 3E8XA 1DAOA 1Q57A 1H85A 1RTTA 2YZ7A 1PLJA 3CLUD 2VJMB 2RGGA 2NV6A 3EXFB 4MVJI 4DBVO 1LBQA 4GZ6A 4RLQA 3ZXSA 2VPXA 1CDDA 1G1AA 2OC9A 1UKBA 2QVYX 1GXSA 2ZWAA 4KK4A 5AMXA 5EHIA 3RIXA 4MH0R 4BNZA 3T1VA 4EHAA 2PBRA 5AQ1A 2G4CA 2X8JA 1AZSC 1CUFA 2Y67A 3AEKA 3ILSA 3UYKA 4V24A 5LKRA 2RGRA 1EK0A 3K1AB 2ZSAA 3KQKA 1PX0A 1MABB 3X1YA 3KUXA 4XCQA 2W8ZA 3BEDA 3UIEA 4ZOCA 2AOTA 4QGFA 2VP0A 2A92A 2YN0A 3RAPR 3T52A 4D9JA 3ZVKA 5LSAA 1EZZA 5AVOA 2X0FA 3MMNA 4B4OA 3EXAA 4EWLA 4LJ9A 2QJTA 3TN7A 5I7VA 5CB4B 3OAAD 4RDCA 4IO0A 4YJ3F 5JHHB 1LNZA 2E4VA 1JSLA 3EZLA 3NWOA 4X7MA 5JE8A 2ZE5A 4F0JA 4A15A 3B2QA 3IIJA 1TM7E 2HREA 1M6VB 1W29A 1HQCA 1Y4AE 2MSEB 4LCEA 4M8IA 1EFVB 2JCBA 4MW2A 2Q8QA 3M9XA 4J07A 4ZPXA 3ZHRA 1XCLA 1OXMA 1WPXA 2ISSD 2QRMA 4HQKA 3HRIA 1O6ZA 4C0AC 1EUZA 3OJEA 1DB3A 4GBMA 1XQXA 1FFHA 2HFKA 1WUTA 2IY8A 2P9BA 4TLMB 4UBNA 4KI0A 1GGKA 3EGVA 1FK8A 1UC8A 2I3GA 2GN1A 2P67A 2P9JA 4OGLA 4P3OA 4QICA 5CA0F 2YBDA 3O8BA 5LU8A 2D2EA 1BROA 1OLSA 4DCPA 1NN5A 2BKLA 4DKJA 2JKZA 1N0HA 4Q3AA 5B1EA 2PE5A 4C78A 1PFYA 3EA5A 1P5RA 1FP4A 5COAA 4ABTA 4QDTA 3HP4A 3TWOA 4ZI5A 1AVTA 3AY7A 1G8SA 3BMOA 3OLCX 3N7AA 5TQVA 1HK7A 4P08A 4G0YA 5DWVA 1H3NA 3OEHD 1F6DA 4TS1A 1O77A 2GVZC 3L0CA 1RNLA 2C4TA 3HLTA 3TIVA 3HXOA 3LOOA 3T1HB 3CBGA 3E7XA 1PL0A 3KZCA 3NU1A 4AULA 2ZB8A 5CDFA 3W4SA 2ZULA 3R5XA 1JA1A 3N2LA 4K03A 4YAJA 4V1CI 2QYTA 3C6BA 4O59O 5BNWA 721PA 2E6UX 1XLTA 2Q45A 1NOKA 1G98A 1SQGA 1TM2A 1VB3A 3RNLA 4IS2A 1FYWA 1QBKC 3A14A 5HZHA 1GPKA 3WZMA 4IUBS 4BPRA 1OZGA 3WGUA 3OCXA 7REQA 4HLCA 2EFYA 5LYJA 3O8RA 2O0JA 4RAQA 2ONZA 1N8NA 1C4XA 5DOZA 4FZRA 2I5BA 3KD6A 2PLRA 3P9RA 1SRQA 3CWQA 3L6OO 3DKKA 5CXSA 1USKA 3IEKA 2A88A 4M54A 4POAA 2W6CX 4BC1A 3NDIA 1K4YA 2IYOA 1UOOA 3CIFA 2FGJA 2JGDB 2P9ZA 2PRKA 2FRVA 2XMRA 3FI9A 1B1AA 2XRMA 2G07A 3TR0A 1Y5NA 2W71A 5KNDA 3R8FA 1QRUA 3NC4A 3ID6C 1VYUA 3UHJA 4CL3A 1QR2A 1SQ6A 1FRFS 2EEZA 2HPHA 3DW1X 4K9DA 2ZZMA 4EOHA 1D8TA 3Q7PA 3ORFA 1S8FA 4WZBB 3HADA 4BNXA 1C3JA 1SUSA 3NGLA 3UBOA 3NDJA 1KQGA 2QYOA 5I4IA 1MO4A 1C9YA 2PMCA 4QJIA 4ZVUA 1XPJA 4ZC1A 5FH9A 2A5LA 1G8PA 1ZLXA 7ABPA 1A5ZA 1GFWA 3AI1A 3QFRA 2J4DA 1GLNA 4BO2A 1LF0A 3KTOA 5B6JA 3NHKA 2VH5R 3E0QA 4L72A 2C77A 4E2ZA 1NVAA 3RC7A 1U28C 1E1RA 2AJPA 3TXYA 1CB7A 5K6AC 3A9SA 2HW8A 1C80A 3EZ6A 2I6QA 1VSTA 2IXGA 5BR4A 3NGXA 4RJTA 2FQXA 5HKAA 1Q7GA 1Z8HA 1RXUA 1AF7A 4L7QA 2G9QA 5FYQA 3SMQA 3SXJA 3WB1A 4CIXA 4D92A 3C5EA 3W04A 3Q6NA 3IT0A 3AONB 3WLKX 4KXUA 2FUNB 1LF5A 1VBKA 1XKLA 1H2WA 3MGKA 5BY2A 2IPAB 3OX2A 3ZBUA 4MA0A 5E9AA 1RDFA 3UANA 4X64B 1L4HA 5A4IS 1TL7C 3VR2D 3DAYA 3DHYA 2D0PB 3H9JA 3DZCA 2NUPA 4QUKA 5WRFA 3IUSA 3X1XA 5TS3A 1KGDA 1PJAA 1SOVA 4U2FA 3I5AA 1N5LA 3AXTA 5COQA 5ALHA 3R6LA 1QG2A 4BE4A 1BW9B 1LK5A 3I4LA 1WOYA 1ZH2A 1FNNA 1L7QA 1U7XA 2H57A 1JAIA 1QH8B 3N1UA 3ZW7A 4QOIA 3UHOA 5FCDA 3RM5A 4P8RA 4JSRA 3WWYA 3MGCA 3IVXA 1LV8A 2JPDA 3HJTA 2FW9A 3V8EA 1GUFA 4E3AA 3S2UA 2V7XA 3R0ZA 2AW5A 5LUBA 3MBKA 1YQDA 1TUGA 1THGA 1AURA 1UWKA 1ORRA 2CNKA 1V37A 3MNFA 5JMTA 4RTOA 4W5OA 2CV0A 1L8XA 4JJFA 1R0CA 2WSYB 3CSSA 5EGNA 4F3KA 2BY4A 4N65A 3ER9A 2ZQ5A 4BLSA 2G7ZA 2JGAA 1S3SA 3FNHA 3AKEA 3TRJA 4WBXC 4TQ9A 4D96A 3KG2A 3LDFA 2X5XA 3ZZMA 2Q2NA 3HJRA 2YHIA 1TM4E 3BULA 3U3JA 3NB0A 4G3XA 3RTBA 1SCUB 4LOLA 3LC0A 1GUZA 4R68A 2GN4A 4N3AA 5AKGA 2ZJ4A 3ZVMA 4OYHA 1Y89A 4F4CA 3H3XA 4B6SA 2QP4A 1CUIA 4PSAA 3OOHA 1U2QA 2HHCA 3LVFO 3OI7A 2EGUA 4ZI7F 1BXZA 3P4XA 4F93B 1N34B 2ZYSA 1F14A 4B3CA 4FYIA 2A5JA 4PIPA 5BR7A 2HRBA 1BN7A 2Z9CA 3GCGA 4LDNA 3C3AA 1HE2A 3BGWA 5CURA 5SZJA 1RI2A 3GDWA 3VVBA 4EJSC 1BS9A 1XD2B 2CE7A 2NVOA 5JYBA 5SYAA 4TOIA 2FWAA 2V0GA 1G3IA 1TMGE 2YJTD 4CLHA 2LKCA 5CT9A 1SFRA 2YZKA 4F91B 2C88A 4JLDA 4P31A 2M98A 3I52A 4H9GA 1KXZA 2RGNA 5HRAA 1WPGA 2C1ZA 1WPQA 1F2DA 1IN7A 1RM3A 1YJBA 3QJYA 3MB8A 3P96A 4FUTA 3ECCA 4KFTA 4LJAA 5C8XA 1VJGA 5DBFA 3BD8A 4Y0NA 3NHSA 5F78A 2R7LA 3EYAA 2VAMA 2NZVG 2X3FA 3FVWA 3AR3A 4JYCA 1XU4A 3NHJA 1EDBA 2PUWA 5CEEA 2VXYA 2Q1WA 3DC2A 3QG5A 2C3MA 2IU4A 2QAGA 4FXOA 4F3CA 5A7HA 5D3KA 2GLTA 3KKLA 4NEHB 4ZT7A 5LM3A 2H18A 1AQNA 1PJSA 2DJIA 2JLZA 1DC4A 2IHTA 3RQ8A 1YFKA 2KBFA 4TWBA 5TGZA 2C3PA 3H17A 3VRHA 4BBZA 4CMIB 3NTOA 1NW4A 5I3ZA 4BNDB 3Q2IA 4QPNA 2JGNA 1B23P 3MTQA 4OQFA 1VLVA 3DBHA 5K4GA 1Y42X 1Q1GA 2F59A 3A4VA 3RROA 5B1HA 2IU3A 1DLIA 1RXIA 3B9QA 3FOEC 2ZRCA 4QGAA 4E51A 3UV3A 1OBFO 3WGLA 1T0JB 1JXMA 4Y6PA 2HJ9A 1I51A 1XWFA 2QTAA 2Z04A 1TX4B 3FMGA 4KFSA 2QENA 4G6ZA 4WFKA 3HBLA 1ZN7A 2QPAA 1PZXA 3A4YA 3PQEA 4G1VA 4JBWA 421PA 4CU5A 2HIGA 4UU7A 2R79A 1H8HD 3PICA 1CJTC 2VRCD 1TB4A 2W6JD 4E07A 3G5LA 1AKRA 3PYXA 1ISHA 2V0CA 4AXXA 3UJPA 4G0VA 2DY1A 4S2EA 2C03A 1FYFA 3FY4A 5AI4A 3NL2A 5HNKA 2GEFA 2D13A 1UDWA 1V1JA 4G8JA 3L7MA 4J9VA 1LPPA 3T1NA 4C12A 3UJ9A 1JQBA 1RWQA 2OECA 4ZVQA 1SM4A 2I3ZA 5IK2A 4F60A 1Y8AA 2C7OA 1R8JA 4LXQA 3H87A 4HVLA 2FSVA 3GXBA 3U19A 4LVNA 5B58T 3D8TA 1TLFA 2PVCA 4G25A 1SC4A 2XA2A 4DGQA 2JLYA 4MQEB 3L0DA 2VZEA 4OQEA 4EATA 2YIJA 2ZM6B 1HL3A 1N7IA 1SC6A 2ZJ5A 3IUYA 3DOUA 3WYFA 3CVVA 1SXHA 1FFEA 5CP8A 3PJRA 4MUKA 1L3BA 1OYOA 4BCDA 4TTQA 4C4SA 4FTWA 1QFJA 2YXNA 3DAPA 4LGYA 5FWYA 3G0IA 1HG1A 2GH1A 3EFEA 4J16A 4LVUA 4ZEWA 4ERNA 4M6WB 5JUWA 2ATIA 1QWOA 2DBVO 2PNFA 1ZP6A 4QREA 4YCCA 4AT1A 1R9NA 1Q6YA 3I76A 2GNPA 4INOA 4L9AA 3SYMA 2M1XA 4JHXA 4C5LA 1L4YA 2YWGA 4PLWA 4LWOA 1BA2A 5F5LA 2R1VA 4ZCPA 4CV2A 5JJ5A 4MHSA 4TKMA 4D0GA 4DLRA 3ZU5A 1W59A 2Z8XA 5BYBA 4CIAA 1S3IA 5LLSA 5IKEA 1XG5A 4AMGA 3S8EA 4EUMA 5HF8A 3ZHBA 1NJSA 4FKZA 3OE7D 4RC9A 1NUQA 3HACA 3DP9A 1ISJA 4RK5A 3TLYA 2BFEB 4OBXA 5DX8A 4V0SA 1I33A 2C5GA 5D8DA 3TBFA 3CT6A 4OMDA 3OVMA 4NAVA 5J4YA 2Q1XA 4NBNA 1WMFA 4TZKA 2A9OA 3JQFC 1XRQA 3DSRA 4EUHA 4LFBB 2BPOA 3N8DA 2Y6VA 3RF6A 3OWHA 2SKDA 5KVSA 3KEGA 3Q11A 3KC2A 1U1IA 1E77A 4DV4B 3TZHA 3FLMA 2YZGA 1C50A 3WLOA 4DC9A 2HIHA 5HR5A 1TT5A 2I3BA 4DKXA 4PZAA 5CM2Z 5JXJA 1TZ3A 2QSYA 3KSRA 4LXYA 5EGSA 2XUOA 3GD5A 1K08A 2VUHB 1OJ7A 3EDOA 1MX1A 2NVWA 3IKJA 3HVKA 5HZGA 5DEOA 2ANBA 4JI8B 1N9GB 3HMQA 3SVZA 2DX7A 2IU6A 4I46A 2OZLB 4RSRA 3QLVA 5I8PA 3FAZA 4TV8F 3PGA1 4QSMA 2J3DA 3URKA 3MBOA 2OE2A 4YMGA 4Q7QA 4H15A 1D6NA 2FOLA 2HLPA 3B2NA 2QN7A 1DTSA 4HAVA 4UAGA 4MUNA 4LECA 4L8LA 1NM5C 4BMDA 2VZ0A 3NIGB 4HY3A 2FEOA 2DSTA 3SJBA 2ZBDA 2I6BA 3PWSA 3GVHA 2IRWA 4MI1A 2FI1A 2QT9A 3DHEA 5M04A 4O4IA 1XMXA 4UJ5A 1IY0A 5LOVB 1DIRA 4PAGA 1SCQA 4ZMBA 2IDKA 3SQXA 1IM2A 3ESZA 3WV4A 3E35A 4H0FA 4NE7A 3QKTA 3L6EA 2RHLA 4X54A 5REQA 1MXHA 5J4VA 1MTOA 2FN8A 3PLAE 1YUNA 4S1NA 1PN3A 4FX5A 1SXGA 2Y76A 3RAJA 2C31A 1TIPA 4P92A 4TL7A 1LTHR 3HNPA 5BNFA 5JOQA 4YRTA 3N3AC 2XOEA 3I9FA 4JT4A 3ZS7A 1LBHA 4JSTA 3R0VA 3U62A 3FZEA 1MV8A 4XH9B 4LJYA 4KW7A 5CIQA 1MEOA 1E92A 4Y9UA 5I9LA 4IX1A 2OWDA 16PKA 3ESAA 4PXSA 4EKDA 4EVIA 4F5WA 4RENA 5KX5B 1KJZA 4QPJC 1U0NA 1XZLA 4P1ZA 5AJYA 2JCYA 2CYAA 1U1CA 4LRWA 5CXXA 4ZVNA 3DNMA 4UPEA 3KYIB 2Q2VA 4R4JA 1DBWA 2ZBFA 3QUCA 4M55A 4EEZA 2QBYB 1LBSA 2FUKA 1XZPA 2HWXA 4B32A 2Y4NA 4YPOA 1XZAA 3HZOA 4HYTA 1RABA 1K0FA 5BWNA 3KQNA 1V1AA 3BCHA 3VTAA 1OYWA 2X0KA 4JBXA 1EGHA 4XIJA 3UC5A 3AR6A 3BSFA 1H4SA 2SECE 4C4XA 2Q9UA 3UENA 2J0VA 5AT1A 1CY2A 2PKYX 4NZ9A 1KE1A 3W1WA 1LPAB 3ZDZB 4IF4A 3FHXA 4HYYA 1YUBA 5HRUA 2J5RA 3CX6A 3DHVA 4H17A 3AVQA 5B64A 2KB0A 3H49A 3OCWA 5CM9C 2VHZA 2CLHB 5BYKA 1ETHA 1GZ7A 5A62A 3HCCA 4B6EA 1L5QA 1TUEA 1WSBA 2GN0A 1V47A 4G8BA 4XPIA 3N7UA 4FQ5A 4A0FA 4X8FA 1KIMA 2X1VA 1G7TA 3HVUA 2RHMA 2I33A 4N3BA 4NU0A 3K2QA 1LZLA 2D54A 2QG4A 3HU1A 1Y5LA 5DGXA 4M8LA 1JIIA 1JXQA 2QTWB 1TRKA 3T7AA 4OLHA 2B8EA 3QUTA 2ZRPA 4GXRA 4PQGA 3TDKA 4MW0A 2V4MA 3KEQA 3W8RA 3QX9A 2O59A 3DZHA 2R1TA 1IQ0A 1RW4A 1XZGA 1Z08A 2FP4B 4Y2PA 4CTNA 5CXUA 3JATA 5G3ZA 1G41A 2H2FA 4Y6RA 4UM7A 2ATXA 2CK3A 2J1LA 1RIIA 1EVZA 4QQ8A 3DEZA 2WYHA 1AMNA 4AQ7A 4L2IB 4MLPA 3C5CA 4BFUA 3K73O 3SX0A 1YFZA 2WYVA 2BM1A 5ALQA 4N5HX 2BEUB 3RC1A 1VRVA 1LWOA 1KERA 1GFZA 1NAIA 2YWBA 1VMDA 1BU8A 3PQ8A 1KZYC 3RUIA 3FLBA 1CEYA 3LXRA 1DX6A 2N47A 4UTVA 1G21E 1B41A 3EGOA 4OFZA 3X2SA 4D6YA 5DNYB 4G0XA 1J0DA 1N6OA 3MTJA 3VZRA 5G0TA 3D43A 2FR1A 1GU0A 2ZWMA 4ZEVA 2XZPA 3I32A 1WVGA 4R83A 4DLKA 5LDGA 1XLWA 3QUQA 5TEWA 3RIGA 5JU6A 4PYOA 2BONA 3QVXA 1Z6ZA 4MUYA 4YT8A 3DTVD 2HQ1A 4LWPA 5JPIA 5IS2A 5IBRA 3WL5A 2FRDC 1V8FA 1YR6A 3TMAA 1COZA 3PD7A 2I4TA 4F4UA 3NQ41 1AS3A 3MQ4A 3VASA 4XLTA 5SY4A 1MUUA 4QPCA 3F8WA 4EUSA 4DA4A 2VWQA 2OHOA 1WB9A 1QRSA 3OCVA 5AIBA 3CGGA 4HNAB 3UW1A 3NJRA 4CKBA 4N3GA 4YJDA 1WDKA 4QT4A 3OLVA 2I7CA 4EYSA 3RFXA 4ZICA 3RQHA 3DO8A 1PZEA 3UM9A 2C9BA 4WV3A 1Z45A 2IH5A 4K8CA 1W0JD 1I13A 1PI3A 4BVKA 1U3DA 2PFSA 4DCCA 3THXA 2I1LA 1T9KA 3OEWA 4G07A 3R0IA 3BORA 4Y2SA 4HN2A 3RVQA 2ZE6A 3WLNA 1AZTA 3BWXA 4GVLA 1JKIA 1GN9A 1V3TA 2BBTA 1QIGA 1AGPA 1U4NA 1COWD 2BELA 2EFCB 4Y6SA 4Q21A 3AUSA 3MINA 3FTFA 5EI5A 1Z2DA 4ZXFA 3TL6A 1B6SA 5FOXA 2F6RA 4DE5A 2FCAA 2GTHA 5DBEX 4C3UA 2H4HA 2OTCA 3NYIA 1JX6A 2G5CA 4AMYA 3G2NA 3K94A 3ONEA 5FORA 3ZE8A 2HUPA 1SURA 1HMPA 4IOKA 3PZSA 3KO8A 1NV8A 1KI7A 5FUVA 3DFMA 3EMBA 4DYHA 3JRNA 1WUYA 1Z4JA 3USES 1O54A 4NMHA 3EE6A 4AWAA 3SJ7A 3ZXIA 3CH7A 1ZRSA 3CZCA 5EE3A 1LDGA 4R1SA 4X20B 4OK6A 3TAHA 3REQB 5B57C 1CW2B 3UEOA 1WLSA 4JJ8A 1OMOA 2CHEA 2IPOA 3FTNA 4BUBA 4UBJA 4DB2A 2B7LA 4HLNA 3WG9A 4AW9A 4HH3C 4MVXA 3PYZA 3KNZA 1WQ3A 1H3FA 4MA4A 5C31A 1ZOPA 1Z29A 2R4QA 3RM3A 1KJNA 5LQDA 5CBPB 4AYTA 3L02A 4GR5A 4RLHA 3R5TA 2IF2A 1XJWA 1U3VA 3P0IA 1ZN9A 1E0DA 3CRNA 4NPCA 3E9DA 3WJ7A 2HZBA 3TBHA 7AT1A 3P9ZA 3H74A 4KQWA 4LOAA 4Q82A 3EA4A 1K7SN 1I01A 2ZITA 3H65A 4L7VA 1R1DA 1FJHA 5EJ5A 1Y81A 4EFNA 3HBJA 4JP5A 4O2BF 4RH0A 5FOSA 1R50A 4XI9A 2UUCB 1IH8A 4I5EA 5EFOA 1J7JA 2H1CA 4Z9AA 1YZFA 3GGPA 4BGEA 1VSBA 1IOVA 5G0UA 3AXSA 4U9IS 3W5CA 4OLAA 3O9VA 4IFTA 4Y7CA 1KZ6A 2F02A 4PFQA 4W7SA 3HU3A 4UHDA 4F1JA 1ZMTA 2IDMA 1BIFA 3GEEA 2D1SA 1AIPA 1QG4A 3I9V6 4YJHA 3QW2A 4O2RA 2WUFA 4X7BA 4MW9A 2EP7A 1RQ7A 4P4TA 5B1YA 1ESCA 4MPRA 3NM5A 1ZVJA 4L8VA 3ER6A 3NV7A 1U4OA 3BK7A 3H11B 2ETVA 3FYDA 4UFOA 3T5AA 1XTIA 2D7JA 2V96A 2ZRBA 1M6HA 1QAMA 5ITWA 3KV1A 2FPOA 3ZHYA 4NV0A 3SR0A 2X0JA 2C8LA 2X6QA 5GZ3A 3IL2A 3K0EA 4RK0A 2B92A 4YJGB 1ULSA 1NATA 1G66A 3OEYA 2XIJA 4HQ0A 4DLNA 3I6MA 4EGFA 4D3XA 4RH3A 3EF1A 3KEOA 1Z2PX 3GFRA 3FD8A 3T99A 1SU6A 2AR0A 2QG6A 3U5ZB 2W8BA 5KJCA 1FLDA 3FN4A 4FCCA 1L4BA 2KWIA 2HSJA 2RHWA 3DZFA 3M81A 3RS2A 3VNSA 3FHOA 4EX7A 2HBRA 5J2TF 1NTRA 3OQNA 4KH0A 1YIAA 4ZOLA 5DCWA 4QF5A 2HXSA 4CT0A 2Q3LA 1B76A 1Q74A 3CW9A 3L7KA 4C7VA 4NOJA 1TVKA 2UV8A 4WWHA 4DIOA 1O94A 1O2DA 1DJPA 4WLVA 4IKEA 1Z74A 4NEQA 3F73A 5F0ZA 2C2KA 1ISFA 1JBEA 1NV9A 3BXXA 3GBVA 3PDHA 1JBQA 4G0NA 4EH1A 1PWXA 3PKJA 1NLFA 5AI6A 2LGJA 2P5UA 5JLAA 1EM8B 5CNMA 2GZMA 2V65A 3ZGYA 1GFIA 1WBJB 5KQLA 3G68A 1DL5A 3T7DA 1BDMA 3ADPA 1IG3A 3GFGA 3QUAA 1AUOA 5C7LO 4AF6A 1PFVA 2J7PD 2ZFUA 3HA5A 2MCFA 1K6MA 1Z88A 3IIMA 1XTVA 1I2BA 1Z62A 2XKAA 3IVCA 2J09A 3KQVA 5TS2A 5LA6F 5TVGA 1I3NA 4ZO9A 4LNAA 1AGNA 3IBSA 5T67A 3TL3A 1II0A 3EPPA 1PV1A 3FI0A 4M1ZA 1ZGHA 4E03A 3H16A 4CLXA 2XMZA 1OKKA 1XXLA 1K5PA 4FI3F 4QM7A 1H2RS 2PXXA 4R8RA 4PXAA 4WMLA 5B1IA 3V8QA 1RXWA 3DEYX 2QQFA 3O4RA 2B1IA 2PZ8A 4M1OA 1PS0A 3SR4A 1LLCA 4HMPA 1Z6GA 2CVFA 3GZTB 5EE5B 5MFZA 5IN4A 3OQBA 4TTRA 4N0EA 4L02A 1AGXA 2BE7A 3DVAA 3T0FA 2JJQA 2HU5A 2B4KA 3WGGA 1G42A 1PSDA 2ZBPA 3OCZA 3RYHA 4DR1B 1C9JA 4L16A 2AFIB 2FSUA 4NRDA 1RKDA 3ZH9B 1GWNA 3F8TA 4N82A 4PO3X 2XZOA 1AK9A 2ZI7A 3CU5A 5E9WA 3WKDA 5LQCA 5IKOA 1TYCA 4REMA 2JFQA 1TF2A 3E7DA 5BYFA 4HEJA 3EXIA 5E0OA 4OHZA 5SYNA 1W8IA 3MA0A 2L0XA 3JZAA 5AKIA 1X2EA 2PJDA 1CZUA 3TM5A 2ORVA 3VOTA 1DG1G 4GQAA 1A95A 4E5DA 1TD2A 1T13A 3FA2A 3K92A 1ZNZA 1D0IA 2Z2IA 4K88A 4JC5A 3UJDA 3PWZA 3ZCRA 3AM4A 4J29A 5K3EA 2VTBA 1YRBA 3BJRA 3ZE1B 3KQOA 3DOCA 3F6CA 5DXFA 5H9VA 3MJVA 1RJDA 4F1WA 6PFKA 2W11A 5DHRA 2JVKA 1Q0PA 1MJ5A 1ZD3A 2ZS9A 3G1TA 3K0AB 3PHGA 1JHZA 4EMBA 4Y9RA 1P2TA 2WAXA 3DAFA 3IJ5A 1UBNA 4R5MA 3VR4D 1ZMXA 3AUUA 5JD4A 3HC7A 3RASA 1TEZA 2VWPA 1LD3A 2PYZA 2X4IA 8MHTA 4TUYF 4DQLA 1QIKA 3ORHA 2JJ1A 3ZWYA 4OGFA 1OHHA 2JAWA 2Y05A 4JA2A 1Z0DA 3VU9B 3F4LA 2X8AA 3FOFC 2YYSA 5CYFA 2MYNA 5M3BA 4BVGA 3IC5A 1T3GA 3CLVA 5E6SB 1ZH4A 3CNBA 2PK3A 3TB4A 3DLIA 1FDOA 4WK2B 3OBIA 5HKKA 1ZAYA 2XCOA 5JYDA 2K2WA 4Y3UA 5HJ5A 1OAKA 4TTIA 2GZ3A 4BQOA 4H2DA 4E5YA 5LD2C 4JB0A 3IXMA 3IKLA 1ZM2A 3LT1A 4P80A 4A26A 4FYJA 1P1BA 4NFHA 1CG6A 3OHSX 3JQQA 1F5SA 4M86A 3E3LA 1X14A 1G5PA 2LCQA 3DE1X 3GO6A 5CVVA 4X1KB 1MZVA 4CM9A 2J9FB 3VR3A 4RGYA 3RFFA 1YHNA 2FLKA 3TUIC 2X6TA 1THTA 2NU9A 1LU9A 1C0EA 1NDQA 1C4KA 5AW9A 2JGIA 4PAMA 4QTTB 4R9VA 4BASA 4EHKA 5IM4A 5F1KA 1YGYA 4OB7A 3TW8A 2AJ8A 1OU4A 1UBKS 1ENOA 1KDTA 3B9PA 2XECA 1Z2EA 1ZUNA 1U0FA 1VIYA 1AC5A 4LPSA 3GHYA 3HVHA 1S2IA 2BGRA 3JVDA 3UB4A 5LLDA 3GLUA 2E49A 4FVTA 4D02A 1IXRC 1AO3A 4GQIA 5LP6F 4JLBA 3IUPA 5DIZA 2AOUA 1W4CA 4ZD6A 5GJWC 3U13A 2C1EA 3G9UA 2Q5EA 4GXNA 5JNTA 3VJRA 5ECYA 3UMVA 4QJ3A 1QCYA 2INGX 2RJNA 3ZJYA 3JQAA 2WWXA 5C3YA 3CR7A 2PH5A 1DKUA 2FW8A 1M1YE 4IAOA 4J0IA 2GLXA 4XDYA 5EUMA 5CG2A 1BHJA 2OV2A 2GETA 5IAJA 1UJ5A 3G2IA 5KOHB 4F9EA 2DLCX 3RHSA 3PYMA 3QITA 4E32A 2HMTA 1BCRB 3GMSA 1NF8A 4H1TA 2FG5A 4J1QA 4DQDA 1FRQA 4HN4B 3WMRA 2R48A 3FR7A 4D0LB 3LUAA 1MLDA 1W75A 3WQBA 1UMCA 5BNIA 2RG1A 1IUNA 2XMPA 5BOVA 3HZRA 4GZ3A 1AXGA 5CB0A 1IQUA 2XD4A 4LK2A 2OCBA 4NBUA 2DR2A 1IEQA 1DO2A 1NHGA 1LDMA 2E4ZA 4XYMA 2YN2A 4EL0A 3F78A 1K6IA 3IMGA 2DFNA 1A9XB 2G1AA 3KOMA 3OAAA 3PPIA 1PNOA 5KYUA 3DE7X 4FDLA 5EL0A 3Q5DA 4EHIA 1CJUC 1IFXA 2HDHA 3M9LA 3WYCA 2FWJA 2GK4A 1C41A 1BYIA 4PO9A 4UPVA 1M34A 2ZJ8A 3U3DA 3P9CA 4MW4A 5J40A 1VKJA 2COKA 1T9ZA 1PGQA 4HB0A 3GEPA 3CLSC 4FGWA 3DD5A 3WK7A 1LIOA 2Z4SA 3DFKA 1Z4PX 3E3AA 3EQZA 3H99A 1FXWA 1WB4A 3EQ2A 3Q72A 4GGPA 2JCXA 4L07A 4B8YA 3KJXA 2AC7A 4B40A 5BQFA 1BCSB 3EVDA 2BGTA 4PCLA 1X70A 3SLRA 1JQ3A 2WUEA 1NUAA 3NP7A 4L78A 1XFAA 3V42A 4CNQA 4DLLA 3OKPA 1DFHA 4Q15A 1PR4A 4EA8A 1JHVA 4YRCA 1I8TA 4JJZA 1C3OA 4KQKA 4N5IX 4OU5A 3RAFC 4U7GA 3D8RA 4Z53A 3HM9A 4DAOA 8OHMA 1IZ7A 5FNVB 3PTAA 5ADVA 1G5HA 3SDBA 2HZ7A 1R0XA 7GPBA 4ESVA 3D7RA 2VH1A 4RLFA 4TVKA 4GPTA 4DEVA 1IQPA 4Z49A 1CR1A 1CR0A 1FMTA 2EL9A 2ZYGA 5KC8A 1SBZA 2OV4A 4O3FA 4JYMA 4R1LA 3RVPA 3NYRA 1B14A 3RRBA 4RFSB 1BX0A 3AP3A 2OORC 2JI4A 1GTJ1 1KY4A 2JD2A 3GA7A 3SLKA 3ZN2A 1FP7A 4O8ZA 2AE1A 3CLHA 1X74A 3L0PA 4LZLA 1L5MA 4K1LA 1JU3A 2JASA 3K09C 1H9CA 3ILXA 3TQOA 2UAGA 3BCSA 2EWVA 2OAP1 2QGZA 4YDRA 2EW1A 4WBNF 3TFOA 3WGTA 2BBOA 4PRZA 1P0MA 3ZNPA 4UARA 3LAWA 3X1WA 3NHWA 2NUTB 3EVCA 1CIPA 4G9BA 2JH9A 4MV9A 5DT2A 4OSEA 1GPDG 2KW5A 4RE5A 1F8YA 4FYXA 4A0HA 3RH0A 1H2HA 1GQOA 1X1BA 1KMIY 3LLUA 4MIYA 4IHJA 3H2HA 4CKCA 2NUAA 2W4QA 2WTXA 4ALMA 3AY6A 3QWIA 1HDEA 4KQ9A 3WP0A 3E5RA 4ZVMA 2WE7A 4WVFA 1VHDA 4DNPA 1SWVA 3B6MA 4BRZA 1H3EA 4FSXA 4KJZA 2MMGA 3KM0A 1LTQA 4ZT5A 1LQUA 1WDMA 1RI4A 1EDOA 3NWEA 5A4FS 1Y7PA 1JDPA 1IATA 1PSWA 1WMSA 3N59A 3VC2A 3WNBA 4OLBA 1E9CA 4P3KA 4QUEA 1JVBA 1Y8QB 2QA5A 4JJEA 3RKUA 2J3KA 4XEHA 1NYTA 2Y92A 4E4YA 3LPCA 4LYHA 3GH3A 5EHNA 5ELLA 4F8JA 5HRCA 1KYTA 5CDFE 3H9CA 3IE1A 1C5KA 5AOBA 5DSZA 5JH7A 3LVBA 3NVDA 1ZD8A 3F3SA 3UTDA 3V1NA 4KFCA 1VZ3A 3PF9A 2I71A 2YICA 1KI9A 1Q7BA 4K6CA 4ACAA 3LL4A 4DCNA 3KYDB 4ZGGA 3QEAZ 2NGRA 1NJFA 3L4BA 2IHBA 3OIUA 3O74A 1NXOA 2PLFA 1RM0A 4US0R 3QW4B 4JXKA 4YJ3B 5DDIP 4M89A 5CFZA 2AHRA 2P2SA 3NATA 1PV2A 3OP1A 4HDRB 1VB5A 3LFHA 4YV1A 1FTQA 4B45A 2Z43A 5TLSA 4QUBA 4E21A 2RGDA 5DNVA 3ZQJA 5AYVA 3L7OA 4GLBA 4QQNA 3AGQA 3H97A 4AI6A 2P4SA 2HGZA 2VT6A 4D4IA 3ICVA 4ND5A 4QUJA 5IJXA 2O5EA 2YBEA 3SHQA 3NORA 1KMHA 3L93A 3I3SR 4ZMRA 1YQ9A 5CA0B 5KU7A 5C4MA 4YCSA 3P9QA 1VYTA 2WWVD 4HBGA 1G5TA 1LNSA 2ODNA 4REQA 5DYGA 1WMDA 4HT3B 1ONSA 1SU4A 3UMRA 4TMKA 4R0NA 4F84A 4OH1A 3BAZA 2Y99A 1XA0A 3TE6A 3WGYA 3EG9B 4EGJA 1KVUA 4RIGA 2FMUA 4LS3A 3TGWA 4KODA 4YRBA 1JEYA 2W2LD 3AV0B 4ZU6X 3QE2A 1TZKA 1O95C 2OD7A 2PT7A 3BQNB 1KAHA 2FPXA 1P1IA 3QHAA 4MB2A 4WDQA 5C4GB 3SSAA 4X6YA 5BN3A 3PDUA 3OU6A 5HOEA 1QJCA 2VQSA 2O8BA 1TAGA 4IQ0A 4CL2A 3H6HA 2PRZA 4LC4A 2VAPA 3I34X 2ONJA 5CK4A 2E5LB 1DE0A 3LT0A 3Q3EA 1D4ZA 4J4BA 1GDTA 1K0UA 3RD5A 2A86A 3QG1A 1RKUA 2IWHA 2JFBA 3TLBA 3F6EX 3BZWA 1Z2AA 2H2HA 5E9JA 2OFWA 2OMKA 4IWNA 4K8KA 3FMPB 4AS2A 1U0HC 3GQBB 1WEKA 2A5GA 2CXUA 3OMXA 1BFUA 3P2OA 4WIAA 1F2TB 4Y2UA 3REFA 4YV7A 4ZDIA 1U98A 1IXSB 3JASB 1E2PA 4PPYA 2G08A 1U7WA 1VJ1A 1RPTA 3ZU3A 2Y9PB 3ZIUA 5ICMA 1U2XA 1FUUA 4K6OA 2AI2A 3LC1O 1HF3A 2GFIA 3B5JA 3D0QA 1N36B 5CH8A 4A5OA 3LPAA 1MAAA 1QKIA 1YIDA 2AV6A 2ZQYA 1X15A 1VLJA 2BISA 1D2HA 5KWSA 3PYLA 2RJ3A 3Q9SA 2N46A 3C4JA 1Q7CA 3FMFA 1NLMA 4E5KA 1VLZA 5HSGA 2AT1A 2MSNA 1T9HA 2O7NA 3W2HA 1Z8FA 4XOIA 5BR8B 2WG0A 1QU2A 1ZJZA 2QK4A 3I53A 2MSLA 3AOEA 1HZZC 1AGRA 2JCSA 3LHSA 4C7KA 4DCJA 5K0TA 1NI4B 4MVJP 2Q5CA 3UK2A 3DKRA 3RVSA 1ND6A 2VP9A 3EDCA 4FK8A 1I24A 3BE8A 3RF7A 1D09A 1L4NA 4I1VA 4Q16A 4LHYA 5KTTA 4ZVKA 3KYJB 4EZEA 1IMJA 3ORQA 5DBHX 5LQNA 1ZNWA 1EX9A 3DM9B 3DO5A 4EY4A 3H8VA 4KLCA 4RNDB 4IUCS 2M2IA 5HK9A 2JFGA 2GD1O 3RS8A 1JR3D 4D9KA 4Y1RA 4MZDA 4QXOA 4QQKA 1HNWB 1E1LA 2P1ZA 3H4IA 4I4TF 2V8BA 2WDPA 3U2QA 5IYZB 5I7AA 2J6CA 3L07A 3OE5A 2L19A 1OSNA 2GKGA 3ASVA 3R76A 4D8UA 4DR5B 1U5AA 2OFXA 3LHDA 2VPQA 2WWWA 5KKCA 3KZVA 1EWKA 4LCAA 1ZZEA 2X41A 2YH2A 2WG2A 3HXPA 3CGWA 1H8HA 3DYVA 2I3AA 4L5YA 3T5MA 3BJEA 1U63A 3RSLA 1H23A 4NH4A 4FOSA 1QH1B 1JT9A 3FSGA 4QLBA 4TTTS 4TVBA 1XL1A 2FUCA 3LRPA 3M70A 3FW1A 2ZXEA 5ALVA 1NVBA 5ADUS 3HO6A 5D5HA 3LY9A 3NBWA 2FJPA 1UBEA 3OIWA 4O2AA 4TL9A 2QRNA 2IF0A 2HJRA 2BRUC 3M4NA 1BE8A 3DC7A 2W43A 5HCUA 1U2TA 3LDAA 3AUFA 1WKCA 3R5SA 4YP5A 5D86A 5IC5A 2PS1A 4IJUA 3VUEA 1JEQA 1MJFA 3R7BA 5L8VA 2G9ZA 3M0EA 1VGVA 4KSCA 2RGEA 4HBZA 4PGHA 4ZVOA 4Y1EA 3QKSB 1ZNXA 4KLRA 4BU0A 3NEAA 4O2LA 4IQ4A 3LLCA 2G6TA 2WTAA 1TVEA 4JCOA 3ZV6A 1FMFA 4ZI7B 5L40A 2IJGX 1A8HA 2CCGA 1GY8A 4YMLA 1OZ0A 4J7AA 4KWCA 2GTPA 1R4NA 1J9GA 2NSLA 1RYHA 3D4IA 5IAOA 2WMOB 3B20A 3RSFA 2BAGA 4LJ8A 1GN8A 1PZHA 1EKXA 5CLGA 5B3KA 1Z7GA 4P9NA 3HQ4O 4ZJPA 5BMOA 1MAHA 4NTZA 1PD1A 1XB2A 3NLLA 2IYQA 4IG4A 1DCKA 4M99A 4MR9A 1MRZA 2NOAA 2R85A 4PG6A 2HLZA 1UT5A 5D1HA 1OH7A 3KP1A 1N3YA 3M1AA 3MILA 2XWBF 1EWYA 4JNKA 4IIUA 1M6YA 4F11A 1E1QD 5EN4A 1DOHA 1QQ6A 2BOVA 5DHFA 3O3OB 2V8OA 4IUYA 3M3PA 1EVEA 4ESHA 1LBEA 5IHXA 1QO7A 5IPFA 3K9QO 4XRRA 3U3RA 1WHSB 4BEWA 4FFSA 1U2GA 2ZT8A 1TZCA 1YD7A 3EWIA 4BX0A 3DVLA 1QM5A 4N7JA 1UBGA 5HJ2A 3D3QA 4D4LA 4K93A 3ZH2A 3C6XA 5JD5A 4OJKA 1OAAA 2QR3A 1KZ9A 4FBMA 1X13A 3D6AA 1NVWQ 2VYNA 1YE5A 5EIAA 5JADA 3VX3A 2OPHA 5GIPE 1RJ9A 4C0LA 5E4TA 3IP1A 1M8PA 2F9MA 2GLUA 3EGCA 1QO0A 2P69A 1SR8A 5F2EA 4XGNA 2CLKB 2NSJA 1LPOA 2AQHA 2CJWB 3PGKA 2PUAA 1FFXA 1XJQA 4L5JA 2Z6QA 9MHTA 3DBOB 3QXXA 1XLTC 1PS9A 2AD1A 4Y67A 3VSAA 3TF5A 1P60A 3K5PA 1DX9A 2NMVA 1T1JA 3AERA 3CW8X 5H7XA 2HK9A 1NC1A 5EIEA 4PM4A 4KX5A 4RZ2A 5ICFA 4INZA 1FFAA 1YZYA 4LGVA 2IDZA 4AMBA 3DMNA 3OTQA 3I1FA 1EWQA 1EK5A 1GKUB 1J20A 1SKBA 3LGXA 1USVA 1JRLA 1Q5PA 5C0OE 2BSAA 3H9EO 4BRWA 1A72A 4Q3NA 4DYVA 5LD2B 4KR0A 2JLCA 5B1DA 1ZM3A 5E4JA 2J3EA 2ICAA 1K98A 4I55F 3R74A 1T4BA 2OBXA 2QGFA 2QE7A 5NLLA 4UNQA 5FDFA 1JHQA 3CKLA 2YY7A 4TXLA 4LDPA 1WPRA 4LWQA 4BMNA 4W63A 4HNUA 1OWNA 4C03A 5FL3A 3H4VA 2H07A 1QLWA 4KLNA 4R2XA 2V1XA 3RS4A 2XA9A 3B9BA 5EP3A 5B2EA 3FTDA 5EFZA 5JC8A 4F1KA 3NHPA 3TTUA 5EWLA 5JSZB 5LFAA 4MR7B 2PWPA 5LLTA 2CVPA 2AG1A 1JMYA 1YZNA 3R7DA 1MIHA 2PANA 3D5TA 4YRFA 4IGEA 2Q5IA 2JDID 2Q1TA 3FNQA 3IAXA 3F7OA 3JPYA 1AMOA 2LTAA 4OREX 3ADCA 2PWYA 3OF3A 4GPAA 2IU0A 3ZIDA 4B8RA 3Q1KA 1DC7A 1GPBA 5BW6B 3ESYA 4ENSA 3ZQ6A 1R10A 2OGZA 2QUKA 1JEAA 3NOVA 1NIJA 4CQMB 4DV2B 3FR8A 2OLJA 4MVJA 1SEPA 4M37A 2FFBA 4ZAGA 2C3UA 3SEQA 1I7SB 2DYKA 2XCQA 2I99A 3H5TA 2X9LA 3BS4A 4OSOA 3VGPA 3I04M 1PTKA 3QPUA 5A5GA 3TR5A 4UHJA 1PT6A 1YQXA 3LO5A 4Z3DA 2ZTVA 4FP9A 4E4TA 4AQYB 4GLFA 3KT3A 2W6ID 3NRBA 3RBAA 2LR0A 7MDHA 2RC6A 3NONA 2VYVA 1X7YB 2NZUG 1UINA 2GZDA 1C7IA 1L9KA 1UZMA 4HXYA 3O4VA 4TKUB 4GKJB 2HK6A 2Y1GA 2H8GA 4I5DA 4LISA 4WCFB 2VF7A 3WSVA 3DBRA 3CX8A 3CB2A 5BT8A 3ZGZA 2CLLB 4ZOLF 4DUZB 1ZHOA 4CBVA 1GILA 3NW9A 4ZARA 1EP9A 3DOEA 1W8DA 4LIPD 5KQGA 1ZL0A 1WCYA 2GM5A 2E5WA 3FE2A 3K8YA 4Q9JA 4X1OA 1JR2A 5BUZA 2BGNA 3JQBA 4II3A 3GD7A 1UKVY 1USWA 1FMLA 2WT4A 3V9AA 5ILOA 3MTEA 5FFNA 3A3NA 2P2CA 2H08A 2PA0A 1GCUA 1ZEMA 4FT2A 1AJEA 3QXSA 4KSYA 1SBTA 3UMYA 4C6TB 1WUKS 1Z47A 3D8BA 2I7DA 3B1NA 5FRDA 2D7CA 3ZDYB 5DGIA 1JJBA 5C7YA 1N2JA 1ODCA 2P1RA 1ZIXA 4J1TA 4Q12A 3UXEA 1M54A 3GP5A 3VR4H 2Y0EA 4QOHA 1CDEA 1SUEA 3B3AA 4RWEA 1WB6A 4UU0A 3IUMA 1NF3A 1G0OA 3NC1C 3M5CA 1O8CA 1G16A 4L08A 2WYIA 4IKOA 1UFKA 2DR3A 2J0UB 3MTDA 4FDAA 4PZDA 1C3XA 1HG0A 2G06A 1B0PA 3ZKWB 4XVCA 4TV8B 2REBA 4R1NA 4XM2A 4YHBA 1Q95A 5AW6A 1H1LB 3CNOA 2QP9X 2PH7A 2NYAA 1NMXA 2N1MA 3CWZA 2PD4A 4MK4A 5I9SA 4NJOA 1KYIA 1MC1A 1N1GA 3NC0C 4PN7A 4FFNA 4BO8A 4NU6A 1U8UA 4CNBA 4UTRA 1XPUA 2REQB 3VZPA 3DNFA 2N9UA 3WRWA 4LHXA 4HUQA 3FPAA 5FV7A 5IAGA 3EEIA 1OTYA 3GJ4A 3KPJA 3REGA 4Y9SA 4Z86A 4D4KA 3MW8A 4EAQA 3Q10A 5C3ZA 1IB0A 3QJ5A 3ER8A 1Q1AA 4JJKA 4Q1DA 4BFWA 1LRJA 4V1CA 4M9SA 1GPWB 4CKZA 3BBLA 3L4KA 5F3DA 1UZNA 2DAPA 3LKVA 2AFIE 5ICSA 4XWAA 4MGKR 3PG5A 1ONBA 2RGNC 3IUBA 1SIUA 1IAQA 4IV8A 5EY5B 2A9QA 2I3DA 3U6KA 4YP6A 3QGMA 1F8UA 1I6MA 4Y30A 2A0FA 3RTGA 4E2XA 3K9BA 4OHWA 2EWWA 1JKMA 1TNDA 2ZAGA 2ZRNA 1DKQA 3C74A 3UJBA 4E0BA 4MJ3A 4NNPA 4R16A 2QKYA 5E4YA 2XT9A 1XWWA 2QPTA 1S1CA 1TMYA 3HKDA 4MGYR 3SHOA 5C51B 1FP2A 2PX3A 3KZNA 1HT2E 3FM9A 3QU4A 4G2NA 1T6XA 5DI3A 3D0KA 4O4HA 3KLOA 1H0HA 2RGCA 5JHGB 1IZYA 4EHDA 4Q39A 4RVHA 2AN9A 3KSMA 5DNWA 4CMKA 3WL3A 1KORA 4J2HA 4MGZR 4YP9A 2C2XA 1JU4A 4M9ZA 1NBHA 5DM1A 5JSUA 1YR8A 3B38A 3GA0A 3G0CA 1XTKA 1PNQA 4YMWA 3D6NB 4I50A 3RRMA 1N2ZA 1IC6A 3G5UA 2B6HA 3ZD9A 1GSOA 4L0QA 2JLWA 1M1UA 2R5WA 4MIEA 4HZIA 2R6GA 5KNBH 1N7JA 4BP3A 4O1LA 4L4SA 1PV4A 5AVWA 1U3WA 4MUIA 4MWEA 2SKCA 1FUEA 5CA1F 3OTIA 4CEIB 3RYIA 4ISCA 1EBBA 2V54A 4QNMA 1FFYA 4QOFA 3TX2A 1UZUA 1DWOA 1HT0A 1KFEB 1NDUA 1TK3A 2O2CA 4R2HA 3RU2A 4YRKA 3COVA 3RBXA 3HKEB 3VI3B 1NG1A 1CY1A 3IQHX 4IDHA 5BT9A 4CM8B 2I0FA 4E8WA 1U3FA 2EF1A 4DC3A 5K0JA 4AJ4A 4Y2QA 1R0LA 5HQ3A 3TUZC 3GLIB 5EUBA 1G4UR 4XLZA 1VA4A 4O1GA 1NW7A 1E8MA 4KKXB 2B3DA 1Z2OX 1MOQA 3OPYI 3QSGA 4LSZA 2XQJA 4JP3A 4R1OA 3HDJA 2C94A 4EITA 4QGSA 3Q8LA 1W0CA 1P3DA 4RVSA 4CZ2A 3THYB 4JBIA 1ABBA 1TKCA 1P2DA 5KYTA 4I8XA 5C46F 1E9DA 2CNWA 2DWOA 1XMIA 1JPUA 3NRCA 5B3AA 1N6NA 4D9MA 2XUQA 4ZAXA 4A0RA 1KVRA 2B25A 1JIXA 2PZFA 2PRYA 2QT0A 2V74B 3OJ0A 4YRGA 1OILA 3ZD6A 1ZCJA 3EW9A 2CXSA 5AXCA 1WZIA 1YDEA 3RSOA 4DLSA 3LX4A 3UJNA 1JDTA 3VNQA 3ISJA 1CE8B 2ZIUB 3N8IA 1A5AB 3JQ9A 4KIGA 2JBAA 2J59A 4MVJG 1NURA 1S0UA 1JW9B 1O5TA 3AEQB 4E3WA 5JAHA 4X1IB 4PRLA 1Q15A 4R0MA 2O8FB 3MD0A 2OOKA 3TX6A 4H0NA 4YPFA 1T91A 3TE7A 3ZWVA 4MR8A 5FBHA 1WCIB 4QNNA 1M2WA 1RXYA 3F3MA 4ZDWA 1MNQA 2BFDA 1OROA 2BUCA 4IS3A 1N5RA 2XYPA 4H77A 1BYUA 2RCNA 3QVGB 1RLTA 3JARA 3FNIA 4PONA 1TEVA 3FHYA 3USCS 2EKZA 4QDJA 4UQPA 4ANFA 5BSEA 2DBQA 3MFYA 3KCQA 3QKUA 2HD4A 1VI9A 4NZNA 1PDVA 1UKCA 3A32A 2A9PA 3F96A 3GRRA 4H7KA 4C20A 4LY3A 1IN1A 2AOWA 2A0UA 1Z75A 2A94A 2RONA 4Q3EA 3DDWA 3MWGA 3UG6A 3WV5A 2WTNA 1E2MA 3HCRA 4BGIA 4F85A 3A58B 4WESA 4B3FX 1QUEA 1Y3FE 3DOHA 1FB5A 5IKXA 1B3BA 1XOIA 2BJWA 3TOVA 2GCGA 1XCMA 2DPXA 4AX8A 4DQKA 4B2LA 2F55A 5AI0A 3U26A 4YUXA 4JWTA 1YVRA 4ZJZA 3IR7A 1X9IA 5J5AA 1RJWA 5AUQA 1I6WA 4DS3A 5JCJD 1RLMA 4EHNA 4UQLA 1Z6AA 3KQHA 1NR7A 1S2GA 5DCUA 1MPTA 3RC8A 1JPJA 1R0YA 3QLUA 4K9RA 5LL6P 2QN3A 2WPDD 2V9CA 1H6BA 1FXWF 2QPLA 2R8XA 4D97A 3H05A 2D3WA 4E2YA 5HUJA 4RD0A 4JBGA 4AY4A 2XGSA 3KK0A 3QLVC 5BN5B 1Y3IA 2E9SA 3AOGA 4U2CA 1FYDA 2XMCA 4XR4A 1SPXA 3C8HA 3RU9A 1JXHA 1XZCA 3H2BA 5E38A 3VXKA 3WGMA 2CT8A 1NZDA 4RVDA 4UE3S 4DV1B 3W7AA 1U0EA 1R12A 3CPSA 3NWJA 4IXWA 3SBXA 4E7PA 3K32A 1DJNA 2GJ9A 4ZK2A 3C15C 4A0QA 4D57A 2RHGB 4UULA 3UQYS 2FPRA 2ID7A 1EFDN 4UE2A 4OY3A 2GSWA 1S8OA 1WUHS 2RGWA 3IQDB 2JL1A 4S0XA 4C4TA 3EQ7A 3UFXB 2FG6C 1HNZB 1K6JA 3TLAA 1Q0SA 1A5SB 3PXEA 3DEJA 5HK8A 3VDMA 4KALA 2VHCA 4HVAA 1XFDA 2QY6A 1DTWA 1AHPA 3PGLA 3AVYA 1DO8A 1EFPB 4B1FA 1VE7A 2CL5A 4QBKA 1Z0UA 5JSHA 1YFJA 3QENA 1O96B 4K2HA 4ZGBA 2OQRA 1SA0A 3CVYA 2IW1A 3O2NA 5BP7A 2CXPA 3IKVA 4HLUC 3CX3A 3T1TA 3TGPA 1ZJ4A 1WZUA 4NBWA 4C07A 3ABIA 1EA5A 2Z5LA 4TSFD 3TSCA 3NAQA 1IWBB 1GIAA 1PKEA 2AN5A 1GZ5A 2WHRA 3UHAA 2PFKA 1LWNA 3WZ2A 4YXFA 2XGJA 3LZ6A 3BZUA 1G55A 4N0PA 1QWSA 4W1SA 2RHJA 521PA 4DIDA 3KOWA 3TRFA 5HJEA 4Y6OA 1XE3A 2BTQA 3VPBA 2C95A 3BRSA 1YB1A 3OZDA 5KYYB 1MQSA 1XKQA 2DOKA 2BR3A 3RQIA 1KK0A 1P5JA 1MEEA 2DWPA 4MV1A 3SKXA 3TZEA 4EUNA 4WK4B 3N0VA 2R1ZA 5CVDA 4XDAA 3CN9A 3KT6A 4CCYB 5IF9A 1P8JA 4ZHQA 1NI3A 1GXSB 4FE7A 5AM3A 1Z5ZA 2E4XA 5LCXA 1PNVA 4RZXA 3ZY5A 2I7VA 4CODB 2PX2A 4CF5A 3GAZA 1Q17A 4WNCA 3FPFA 1E6LA 1I2AA 5TXGA 4LF6B 4R2LA 3BTUA 3FXAA 3L7CA 3S7TA 1KDVA 1TA0A 1SIOA 2VLBA 3A04A 3H19A 3L1UA 3NOOA 3CONA 4JUFA 4EB8A 5C1BA 2AXPA 1DKRA 2GAFA 3ZV3A 3H2SA 3CVUA 1ZIDA 1GDDA 4N08A 3FCSB 3AR7A 3BJIC 3LBIA 1O6BA 3Q7QA 4MNTA 2H2GA 2VKQA 1V8PA 3P9XA 1Z5VA 1P9RA 3R3JA 2FSIA 1Z5OA 2JHCA 3EZ2A 2XF8A 2MT9A 3GEDA 4IZIA 3TQRA 2WB2A 3HJUA 3K70B 2DTDA 1RKVA 2FSHA 3B1YA 3ZZ1A 2JBHA 3LPMA 5J2TB 2NYUA 1T2EA 3TD2A 5KOIA 1JH8A 2E21A 2E7ZA 3M6AA 2JA2A 3PPXA 1U3CA 2VP6A 3DEIA 1EDZA 3NM4A 3ZHQA 5AO9A 1G8GA 4D45A 2GKSA 2X15A 3JQ8A 5IVKA 1MO2A 2FFJA 2LCIA 2IXEA 3O3MB 3PIRA 4JVLA 3TAXA 4Q7MB 1TU0A 3LDGA 4DQ0A 2F3TA 2XOKA 2X22A 3PRKE 3DE3X 1MB0A 1MVNA 2YFHA 1RHKA 3FDZA 5AK6A 4DMMA 2HNKA 1XZNA 3KJEA 3TZLA 4S05A 4I7EA 3AZOA 1OLSB 4HNGA 1J56A 3OOEA 3L2OB 4FGZA 2ZWIA 3RIYA 1SD5A 1PK8A 3O2QB 1XNRB 1T1IA 1UOQA 5I47A 1JFFA 4HMOA 3ZK7A 4K3VA 4UATA 3G8AA 4PX9A 3RWOA 4XGQA 2JHAA 2O7RA 5H5JA 2G9VA 5K2MA 4W1PA 2HO4A 3SFTA 1O6GA 5DI9A 3TLJA 4GBJA 3LUJA 3SYKA 1HDCA 1T8YA 3WYAA 2G1KA 4UEJA 5FLEX 3RK4A 5FHQA 1D6JA 3GJYA 2HBZA 3QU2A 5LA6B 3DBLB 3WYGA 2ST1A 4RE6A 1R5NA 4U7TB 1VJCA 4UBKA 1I5OA 4XAQA 1JXAA 3M6XA 1DC5A 2I78A 4RMIA 3UATA 1E2IA 4PGAA 4K9KA 3NOQA 1SC9A 1NUSA 3L7JA 1NFQA 4BLQA 5KB3A 4HX2A 3ZUGA 3W6NA 1ILEA 3OA2A 3NBMA 3Q4GA 4QXAA 7REQB 3WVNA 5AKLA 2BMJA 2P5SA 2ECQA 1WABA 4R2IA 5DLDA 4DZZA 3SQWA 4C5NA 3RC9A 4WXPA 5FBKA 4EGSA 2QORA 1CUWA 1VFNA 3DOIA 2IY9A 2J4FA 4AZTA 4EY3A 2B78A 4YCJA 3TG8A 2AM1A 1J97A 5A4KA 5LPNA 1AQIA 2R7KA 4J0JA 4KDFA 1KH3A 2IT1A 3QK7A 3B12A 3PFNA 4QX6A 3VNUA 1IRXA 3HO1A 3ETNA 2P9CA 3GLFA 1SZPA 1S2NA 2OZVA 4JYBA 1F5NA 2PMEA 1Q6ZA 3LW7A 2DCUA 4FB5A 1E5LA 5IASA 1DQNA 1F2UB 3FOAA 4GM0A 2Q41A 4WX2B 3UGQA 4XWTA 3IUNA 1P2GA 1B16A 1TAQA 1GT6A 1ADYA 3GEMA 1U1GA 5HQTA 2ZJBA 4PYIA 3H13A 3BL5A 3RHZA 1GZVA 2GPAA 1TGYA 3CN7A 1MB9A 1GA4A 4CVLA 3CY6A 5FOQA 2C9OA 4IJWA 4KRXA 4M1QA 2R11A 4PSUA 3CR3C 1AG9A 2V6IA 2P75A 1NJ2A 2C0CA 4RPKA 3TPZA 3CLTC 3O8QA 3W3ZB 1D6SA 4NK5A 4XWOA 3ON5A 1WA5A 4DVGA 1TIKA 2ZK7A 5GOZA 4KR2A 1O97D 1W73A 4F96A 2PKNA 4I3FA 4M76B 3TTXA 1EK2A 3B53X 3DS8A 4X7RA 4K46A 2IPXA 2RIRA 4HGOA 3ZU2A 1EUQA 1ZSNA 3LVQE 3B6ZA 3PFIA 3R7FA 1XD8A 5GM2A 2ZBGA 3DEFA 3WBKA 1D9XA 5E9QA 3WBFA 1H1DA 5LMCA 2YQ5A 2IYAA 2NG1A 5GONF 1TK2A 1JS1X 3AP1A 5FP0A 2QU7A 5DXAA 1TQDA 5KHOC 1RXCA 1ES9A 2JFPA 1CX9B 2QN2A 4NEGA 3JQGB 4FHFA 4FR5A 5EMKA 5IMSA 5J1SB 2FFAA 5LU9A 3OWOA 4JB8A 3IEMA 4BX8A 5AICA 4YJ2F 2XNCA 1PYDA 4JHLA 5FO0A 2ZR7A 2A30A 1BDJA 2YS6A 2Z3WA 5EJIA 1MU0A 3C1OA 4KQ1A 4ARAA 4FZVA 4KN6A 3MJEA 1NX6A 1MQ8B 1ESNA 5D5PA 3VYUB 4BNHA 1M0TA 2WICA 8GPBA 1P7PA 2ZP1A 3R4CA 1AX9A 4FT4A 1NW3A 3M1IA 1XPRA 2C78A 2EJTA 4AUMA 2FZEA 4TVSA 2Q6TA 2QMHA 3AINA 4F2DA 5JZBA 3FNGA 4UVDA 2C2BA 4IHQA 4IIJA 1N0VC 2AGVA 3SIPA 5E7IA 4CMEC 3T7EA 1YGKA 1HM5A 1IHPA 3SOZA 4G0MA 2OXTA 2YINC 4D9CA 5JS1A 4NS1A 2ZJZA 1KAMA 5LP6B 3GFVA 3ZVRA 4BUJA 2YVKA 1AN0A 4DLXA 4EVQA 1QGED 5CHYA 2A1TS 1BSVA 2HBYA 3L8HA 2J5QA 4LBZA 1E3SA 1FPQA 2F1HA 2VK2A 4HTFA 4RGVA 3UJCA 1QJ4A 2HDWA 3AT1A 4LCJA 4B2YA 1ISPA 4B3JA 4MKXA 5GP1A 5JY1A 5JSFA 1V9SA 1VI5A 3MSXA 1KARA 3KKPA 3J81A 1TRHA 1A8IA 2HQSA 1C3LA 3ITDA 1W0KA 4ENQA 3ZDAA 2CD7A 3PNMA 2Y71A 1DX4A 3MEQA 4EMSA 1LX6A 1QV9A 1SVSA 3GDHA 3I0NA 2XX3A 1GPYA 3IRUA 1ESJA 4YNBA 2AEFA 4CV0A 5K3FA