3RRJA

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima in complex with p1,p5-di(adenosine-5') pentaphosphate
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
489
structure length
489
Chain Sequence
MKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Putative uncharacterized protein
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 176
structure length 489
sequence length 489
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rrjA01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3rrjA02
3QAIA 4O1GA 1L2LA 4LC4A 2F7KA 4O1LA 4UBEA 1GQTA 1LIOA 4LBXA 4DU5A 3GBUA 4S1IA 2F02A 3NC9A 3RREA 4K8TA 4U7XA 3N1CA 1YGKA 3RQ5A 1UA4A 2DDWA 3RSFA 1LHPA 1ESQA 1EKKA 3RQ8A 3RS8A 1VM7A 3RU3A 3RU2A 2HW1A 1YHJA 5BYFA 1RKAA 1V1BA 2AWDA 3RSQA 1WYEA 3KEUA 3RSSA 1RFUA 3NC2A 2R3EA 2RBCA 4JKSA 4KADA 4N08A 4N09A 3W4SA 4C5JA 5F0ZA 1UB0A 2DDOA 2I6BA 3IH0A 3RO7A 2JG1A 3IQ0A 4K8CA 2I6AA 1RKSA 1RKDA 3UBOA 3K5WA 2FV7A 3HYOA 5EY7A 3RNOA 2O8NA 3RTDA 1RK2A 5C40A 5CM5A 3Q1YA 2QCVA 3RRJA 3RY7A 1GC5A 3RTBA 4PVVA 4B8RA 2V78A 2HLZA 3I3YA 1TZ6A 4XCKA 3RTEA 5B6AA 4B8SA 4KAHA 2AX3A 3B1RA 3RPZA 5BYCA 3LOOA 1JZTA 1C3QA 3NL5A 3RT9A 3PL2A 3UQ9A 3RTAA 5TQIA 3HICA 3BGKA 2JG5A 3NL6A 2PKMA 3DRWA 4E84A 4EUMA 1V1AA 2Q5RA 4E8WA 1JXHA 2R3BA 4X8FA 3UQEA 2C49A 2PKFA 3LJSA 3RQHA 2ABSA 2VARA 3RQ2A 4K9IA 3KTNA 3NBVA 2XTBA 2A9YA 2PKNA 3GO7A 2AA0A 4K8PA 4YWRA 4LCAA 4C5MA 3IE7A 1RFTA 1TYYA 3FHYA 3NL2A 3MBHA 3RM5A 3RPHA 4C5KA 1BX4A 2NWHA 5C41A 5F11A 5EYNA 2JGVA 3ROZA 1LIKA 4KALA 3VAQA 3RS9A 3HPDA 5C3ZA 1U2XA 4DC3A 3QA2A 1KYHA 3UQDA 3IN1A 4WJMA 3MBJA 3UMOA 4C5LA 3H49A 3B1OA 3B3LA 3UQ6A 3ROXA 2YXUA 3NBWA 2ABQA 4JKUA 4C5NA 2AB8A 4KANA 2AJPA 2YXTA 3LKIA 1VK4A 2AFBA 3RQ6A 4S1MA 4XDAA 1LHRA 3RSGA 3B1PA 3KD6A 4LBGA 3RRBA 5BYDA 4S1IB 3K9EA 5CGAA 3DZVA 4E69A 3FHXA 3KZHA 3GO6A 1JXIA 3ZS7A 1TD2A 1EKQA 4E8ZA 4E8YA 3NCAA 4JJPA 1TZ3A 3RRFA 4K9CA 1V19A 4EN4A 3H74A 2DG2A 1V1SA 2DCNA 3NL3A 4E3AA 1YGJA 3CQDA 3NM1A 1LIJA 5C3YA 3ROEA 1ESJA 4S1HA 1DGMA 2A9ZA 3RT7A 3RTCA 2AJRA 3Q92A 3RQQA 4K93A 4KBEA 3NM3A 3IBQA 4XF7A 2QHPA 1VI9A 1RFVA 3OTXA 2PKKA 3UMPA 3EWMA 1LIIA 4EBUA 4GM6A 2C4EA 3D3KA 4EOHA 3RO4A 4YL5A 3RQXA 3PZSA 2I5BA 5COJA 3RTGA 3BF5A 5TRWA 3B1QA 4K8KA 3IKHA 3D3JA 5CGEA 3ROGA 4XF6A 3JULA 3LHXA 3VASA 2DDMA 5BYEA 2HQQA 3B1NA
chains in the Genus database with same CATH superfamily
3SEFA 2GT1A 2Q8QA 1NVGA 4GM0A 4MUXA 4EG7A 3FGNA 4OJYA 4RGVA 4IHAA 2G0TA 4P81A 3LZCA 4URWR 4WK0B 1H1DA 3H17A 3D3WA 1ABFA 4F2HA 4I0WB 1M54A 3JAKB 2JHGA 4MPTA 5BOSA 5L95A 1R4AA 1AGXA 4HWPA 4BJ5A 5I9LA 4HPWA 4BP1A 2VAMA 5AXBA 5T5QA 1SKBA 2MR6A 1LBEA 3GUZA 2IIPA 1KY5A 5D8DA 2BN4A 3T54A 1JKJA 2NZJA 2QTBA 1XDWA 2IU3A 2QYHA 3EA0A 3L1VA 1U31A 3C5EA 4GHWA 3NL5A 3RAFC 4WK6A 3SSNA 3NXSA 1SXGA 3KEFA 1YQ9A 3NL6A 3CYFA 4HGZA 5CT4A 4OH1A 1RPTA 5H81A 4DNQA 4IOKA 3IJ5A 3OWOA 2VKQA 5DM60 4HEA6 4C04A 1PS0A 1PR6A 1EFPB 1U4OA 4U2FA 4CE6A 1CV2A 1N2CB 3OEED 1H9AA 1PFGA 5H3CA 1Y1QA 4PSAA 1T1JA 3A27A 3BXXA 3LQFA 3NBVA 3F3MA 2C57A 3GF4A 1CZHA 2EIHA 4MV9A 3G2OA 3ZY6A 3WGVA 4JI4B 3BF7A 4AY2A 4LY3A 5AVVA 3SX4A 3BHIA 4DQXA 3HYSA 3LBFA 2ZR9A 3PYLA 2GFIA 2AOTB 4ND6A 3NOQA 2NTEA 4AY5A 5JY1A 4BN0A 5CITA 5C3ZA 4DSNA 3VSBA 3A2NA 4GRAA 5IF9A 2H1SA 4X8LA 3WDMA 4LXHA 4OP3A 1Y6ZA 4YK7A 1SBHA 1ZINA 1F6DA 4TRNA 2OXIA 1E2DA 2GCNA 3R41A 4H6VA 4JB3A 4TXHA 3JARA 4M0LA 4DIKA 2BUCA 2IXGA 1YTUA 4PRLA 3K31A 2EATA 2GERA 4CW7A 1XROA 4LBYA 4UM5A 1M0TA 3N2IA 3UZUA 2H1FA 2XMRA 2YJZA 4IM7A 2XTNA 4KQKA 4CF6A 3F71A 4CV3A 1UDWA 2QX8A 4RPIA 5TXGA 1JJVA 4KR7A 1HSZA 2J32A 2W5UA 3A70A 5DTEA 2YXNA 4PEVA 3NCAA 1TF2A 3OLZA 4HDKA 2PS9A 1QIDA 3CF4G 4INAA 3STVA 1O8BA 1W48A 5DYNA 4DA0A 2WFLA 5B3LA 3CQDA 1P5ZB 5KDOA 4U5QA 1LKZA 4P58A 3C43A 1OX4A 4QDOA 1RABA 5EJ2A 4A2QA 3GFRA 2D2EA 1F8XA 3HBAA 4UE2A 4F3RA 5L6MB 2P9CA 2A9RA 3PNOA 1XEFA 3CWQA 1B74A 2HEIA 3CTMA 3NIGB 2Y77A 2ES4A 3IMKA 4FMDF 1XTJA 4ZHQA 4MP8A 3S27A 5JAPA 4JU9A 1W4CA 2DF8A 4JNKA 4EBFA 5IXJA 3NDJA 3MT7A 1ML4A 3ILHA 2UVQA 2EQ5A 5BNFA 3AGQA 4L8VA 3DHWC 4RWZA 1YVDA 3JWGA 3P2EA 1SCNE 4O4IA 3B70A 2QMOA 4LI3X 4UATA 4YFYA 5IASA 2OV1A 1YC5A 3C85A 4WCDA 3KL4A 2FUG1 2O3JA 4O8CA 5CGEA 1P2TA 2QV0A 3A04A 3ONNA 4V0OA 4ZI7A 3BMCB 4JVNA 4NXNB 2YRXA 4LMRA 5KEIA 4D9MA 1Q5PA 1LPOA 1I3KA 1RI2A 1QHSA 2AVDA 4K8OA 3SYMA 4JB8A 1P5HA 1RZRA 2EX0A 4KX5A 4JKIA 1L8QA 1PDOA 5C2JB 2H9IA 3RQ5A 3GAFA 4KQCA 5DK4A 3ZWCA 5MHTA 2Q0HA 5FI1B 5H4HA 1DG1G 1OZ0A 2HJWA 2VKTA 2G6TA 4R7GA 5DM70 1OT3A 3BFVA 3BM5A 5DNAA 1ZVVA 2WB4A 3N07A 2D6FA 3PEEA 2O4CA 2P27A 2CLEB 2O5RA 3HU5A 2WJ3A 3IH0A 4BNVA 2HXGA 4LC9A 4ZCRA 1ZIOA 2DR3A 4W1RA 1AO3A 1A97A 1C2TA 1C50A 2NNLD 5DV9A 2JLYA 1NR7A 4UW9A 3WY9A 4EB6A 3IXQA 3PP8A 4R54A 3KQUA 1CIPA 2XT9A 1NW6A 1TUGA 2NGRA 1RAEA 4FFBB 1T9AA 4PQEA 3E9MA 5EJIA 3V46A 1SVOA 1HE1C 1TM3E 1XNRB 3M0EA 3R5TA 2WR8A 4KV9A 4OXYA 2Z5GA 2ZATA 3LUKA 2VUTA 1R6BX 5FWDA 4NQZA 5IM5A 4CLEA 5LQKA 1UZNA 3DNMA 5E9JA 5KWSA 1TVKA 4FW8A 3PR2B 5TQIA 1XTIA 3NJRA 4M76B 2IHYA 2WWIA 2XZLA 4F4IA 1ZESA 3EPHA 2E5WA 2V7PA 1MVLA 1K8YB 4EY3A 1G20B 5TMBA 1OIVA 3UW1A 2C49A 3V7FA 3F8SA 1CF4A 3LKBA 5EHIA 2FOIA 3H9JA 1EVEA 3B7WA 3WC4A 4RJTA 4IY1A 4WZBB 621PA 2EW2A 3VH3A 4DRXA 5J2TA 1GQOA 1NBME 4HHEA 5FTJA 5K8LA 2ZVDA 2EFJA 3JQ8A 1AMUA 3IE7A 4ZYUA 3T9CA 2PNJA 5JU6A 1MX3A 2PJUA 1USWA 2KM1A 2PS1A 3RS9A 3VR2A 2FK7A 2RI0A 4A92A 4D98A 5LA6F 2PZBA 1X39A 3H83A 3IEUA 4GPD1 3HV2A 4ITRC 1KYHA 1CE8B 3PICA 3HN2A 4WXMA 3W6PA 1E0SA 3TD9A 1Q7CA 2H52A 4ARIA 4JLVA 4KOAA 4R40A 2AI1A 1C7FA 2QMQA 1Q1NA 5JNRA 5EESA 2MDTA 1PBTA 3FXAA 1KAEA 3ZTYA 4ZEMA 4ZAZA 4Y2PA 5KVCA 2GF9A 2R6JA 5CVVA 4Q1BA 3QE4A 3BAFA 5A5DA 4B3SB 4R1QA 3HU3A 3MGBA 2XDQB 1XTZA 4GPZA 4UHEA 1AV6A 3EY9A 4MW9A 3I8XA 3IEMA 2QM0A 1V3VA 5DI3A 1E6KA 2WIFA 3DXXA 2GGSA 1W85A 3JQ7A 3NXKA 3OIUA 4XGNA 3GN2A 5EFOA 1HMPA 2CD9A 2HLDA 2WHYA 2MIIA 3ZM5A 1Y9DA 3V2UA 1LJUA 3I62A 1E9FA 2CLDX 3LZ6A 4CDMA 5JSQA 2Q46A 2RHCA 2ZJ7A 2G5PA 5C8YB 3DSRA 1WMSA 4L4RA 5JYEA 1HT0A 3I76A 3BWXA 5AI0A 3TAXA 3B85A 1PZHA 3P7MA 1W94A 3OIVA 1RRKA 2CHQA 1QJ4A 1K4KA 1OD6A 3B89A 2YC4C 4AUKA 3ILVA 1T4GA 2A9PA 3FNEA 2PQMA 5B1YA 1B4DA 2YOHA 4EW1A 1JJFA 1ZD4A 5JXHA 2RGWA 3D3JA 4NE2A 4IWYA 1RC8A 1UXIA 1ZKDA 2VTDA 1XZEA 2B1RA 4M1KA 2OCLA 3LPLA 3N87A 3JU3A 1SD5A 2XSZA 2H7YA 4QF5A 4TLEA 2VPTA 3RFCA 1JYEA 3S2GA 4M8KA 4M6WA 5FO0A 3AWIA 4US1R 2QN9A 5D7NA 5DHRA 4FIZA 1DDGA 1T0PA 1YS9A 2GBFA 1C1DA 2MINB 2Z2ZA 3OICA 4B4UA 5KNDD 2O1EA 1FLVA 1JDUA 1KI3A 3RVQA 4DL9A 4XLZA 4KBFA 4F9FA 3TWOA 3WDKA 2CB9A 4LISA 3FMOB 3UV6A 1QK4A 1QTQA 4DUGD 5TS2A 2UXBB 1M1YA 5EXDA 2YV5A 3GEEA 3RBVA 5EY7A 2JFPA 4HFJA 1RU3A 1FUIA 3LLMA 1W0KD 3C3EA 4U2EA 3PQ2A 4BWYA 4AMVA 1K9VF 1Y7PA 2CZGA 3EB9A 2W8BA 1E6WA 2BBWA 2JJMA 3R3YA 4MK4A 3F78A 2D5AA 5DSTA 4B3BA 3GLFB 4L5BA 3RLIA 3PXBA 3LOOA 2HQ1A 1DKPA 4UKDA 1SXJA 1T9DA 1QWOA 1GL6A 4W6ZA 2VT2A 4I08A 2BHTA 2F3RA 3M6MD 1MORA 3OPNA 4KFUA 4F9GA 5A62A 3KJIA 1WXXA 4D8TA 3PNVA 4A0FA 2AF3C 1PFVA 2GA8A 3DBLA 1ZCFA 1G8JA 4GF5A 1ZXBA 3EIEA 4I55B 3TEJA 2AR9A 1QGOA 2FR0A 4DV0B 3I2GA 4PYMA 2PKXA 5F98A 1HI9A 1P9RA 2NYAA 2IEGA 1NMXA 1W4RA 4HWKA 4BNFA 1E6EA 4X1IB 4DLBA 1ZM9A 2Q21A 2FQYA 5HQ3A 1KQGA 2PWAA 1ACMA 2H4XA 2W70A 3V1KA 4B6GA 3B8HA 2C2BA 3FHYA 2DWUA 1MT0A 1SQ0A 1V35A 1X7ZA 2WRZA 2NUAB 6NULA 5FPKA 3WZMA 3UBTA 4IIGA 2PUGA 1C3OA 3NVMB 4Z7QB 1OU4A 3O2JA 1DC3A 2Y1CA 2C5LA 2FX3A 2W4QA 5CYGA 2G80A 1I5EA 4RVOA 1N5KA 3A06A 3NHBA 2P30A 5B57C 1RRVA 4Y6PA 5JNWA 1ISJA 5LZ9A 3N2LA 3EZ9A 4ADSG 4E46A 1XVTA 1BWSA 3BH7A 3L8GA 4H3HB 3OBIA 4QBHA 1FJHA 4RA9B 3CLUD 1YFLA 2F00A 5EJ6A 1AB5A 1F0YA 1SCJA 1YZGA 2OQRA 1OPRA 4M1ZA 3C3PA 5CM2Z 5AI4A 3TECE 3IOEA 3WJ7A 2M32A 4LBGA 3IHTA 1GQRA 2W6QA 1CUVA 1T2DA 3L40A 3L46A 4IXTA 4OA8A 3N8NA 4XOUA 3R75A 4NMXB 3KZHA 5J43A 3ORHA 2VJLA 1ZOSA 2XTMA 4KG7A 1ISFA 2OO3A 5SY6A 1TIKA 1V2HE 2R60A 1DEXA 2ET6A 3ISVA 4CG3A 1NE7A 3THYA 1LI7A 4DMMA 5IT5A 3KCQA 3W3AH 5CK5A 1YQUA 2ID4A 1VYHA 1DXQA 2FMKA 1LPNA 4WW0A 1XLTA 2FN7A 1M6HA 3IBCA 2R2AA 1NJ6A 2PX8A 4GKVA 2O2SA 1CUDA 3G1WA 1QP7A 3D6UA 3FN4A 1CVIA 4KE8A 1DXYA 3G5MA 3CSSA 3BCSA 3MT0A 1MU0A 1U3FA 5FDFA 3UK1A 5LIRA 3K0FA 2REXB 1YD7A 2VYQA 2PVPA 2ZS7A 2ZANA 3FKJA 2I87A 4MWDA 5BN5B 4YBZA 2Y1XA 3OQMA 2ZM6B 1EG7A 4P3XA 3Q9LA 4N8EA 2QX7A 2XUHA 2QZPA 1SHLA 5DCWA 3IOCA 2PUVA 1I4DD 2Y1KA 4COKA 1NNEA 1MABB 5JYDA 2WTMA 1BC5A 5FLKA 3HYCA 3DBHB 4LOLA 1NIJA 5TJ9A 4EIWA 3O8OB 1OPXA 1X87A 3EEQA 2V5VA 2QHXA 1BDMA 2O2GA 3IMFA 1ZH6A 2P5YA 4ENSA 5KC9A 4CUJA 3DLPX 3FPAA 3ZNPA 3WIEA 4S24A 4AF6A 5I51A 4M60A 1NATA 1PQUA 4X8HA 3CMCO 5FAXA 2A84A 2CMHA 4H7EA 2QZSA 1IK6A 3PL1A 4I14A 5K3FB 3VHXB 1H1LA 1VDMA 2WIGA 4GLLA 2BH2A 5KOHB 4EY7A 5DNCA 4ECEA 4MVJF 1RLJA 3S2EA 5JASA 3ITDA 3EDCA 1NTOA 4TVSA 5KQSA 2XNDD 4R71A 3CB2A 4YN3A 5KTNA 4MVYA 4BTVA 5NLLA 2XCTB 4EYGA 3QF4B 4ZOBA 4P3OA 1CYDA 1NLZA 2R1UA 2V5UA 3GVXA 1YKFA 1D8TA 4P53A 1EJ0A 2PGDA 1E3WB 3T3PB 3ULKA 4A5SA 2FPIA 1OFHA 3B78A 4F21A 2AFIA 5CJPA 5AW0A 5AJXA 4OB8A 1XSEA 2QNIA 3REQB 4MVJP 2Q5CA 2QLMA 4B7ZA 8ABPA 1C4XA 1NX9A 2HTFA 4ERNA 3LSTA 3NBUA 1UBEA 2AOVA 2QVYX 3SQMA 4CU2A 1YCFA 2D7JA 1SKYB 4JGIA 2XJ4A 1Q6YA 2FSVA 4Q6WA 4DE5A 4MKGA 3UXMA 4F96A 2H2FA 3FNQA 5AKEA 2JZOA 2EHJA 3SZOA 2J0QA 2F3SA 4PFKA 4FYYA 3H49A 1EX9A 1SCQA 2BGRA 2P2DA 3GJ6A 2QRUA 2NYVA 4RABA 2BONA 2BFPA 4XYMA 3U4MA 2QL7A 1MJFA 1U3VA 3B1YA 4LJ7A 1V37A 3U7EB 3ZE0B 2YFKA 2C03A 1XMXA 1WEHA 2IOYA 3D31A 2BW0A 1XHEA 3MWFA 3TQSA 3O8LA 1M5TA 1RAGA 5EQJB 1NGSA 3COSA 3U44B 4R8KA 3WWDA 3MINB 1OSNA 1JDJA 3GCWA 5JJ5A 2P2GA 2QDKA 3EA4A 4D42A 3AKZA 3H6HA 4DF3A 3H8WA 3KQOA 4I5EA 1YA6A 1ZYUA 2QENA 1F9AA 3UHOA 4AXBA 2D1YA 3FF1A 4UZEA 1RJEA 2D7DA 3NTLA 4P92A 1GLGA 1RYBA 4YQYA 2YXEA 4LVOA 3KT0A 1R5OA 4OAOA 4OQNA 4CM1A 3UV7A 4XQEA 4ZGGA 2QVLA 2I1LA 1JEYA 2RHGB 5CIQA 1DHRA 4V0KA 1VL0A 3L02A 2AFRA 3O4FA 3QX8A 3WLPA 2UZ0A 1WNFA 2HJHA 1Z7GA 1NR5A 2W2KB 4J16A 3ZQKA 3HUUA 2ZSAA 4OQ4A 4WXRA 4DA9A 1OVMA 3EUAA 1BHJA 1W78A 1QFSA 4AP5A 1CYEA 2YJ3A 1BVRA 4K6OA 3D5EA 5B58C 3RRYA 3R5XA 1C7JA 2YV4A 4PIVA 1C3LA 4G09A 5DNEA 1MX5A 2X5KO 4H4CA 1RE1A 4QBGB 5KTYA 2O7NA 2E4VA 4WJZA 1FFXB 1QMGA 2WKQA 3UMRA 4M0MA 4A2PA 2JIOA 4KR0A 1A9XA 2AXNA 2BFDB 3ASZA 2ASEA 4YPFA 4DAEA 1Z37A 2TRSB 1SOWA 5F52A 4CMKA 2XWQA 2XLCA 3ZY5A 5JAQA 1I5OA 1CUYA 2QA5A 1W5AA 1HNXB 3G5UA 2Q7XA 2ZS9A 5J2UB 3R5FA 1FLNA 3PFIA 4OI2A 4OUDB 2P2ZA 5K1ZA 1E8DA 3JWEA 1ODSA 4LZOA 3SEZA 1ZJWA 1DAKA 1X6VA 2XQFA 4PC6A 3C41J 2D0IA 4QVKA 2I6BA 1E2HA 2CVOA 1P2DA 2IPMA 3BB1A 1CTQA 1TUBA 1VJ0A 2QAJA 1G41A 3BXHA 4KUHA 1KL7A 4LPKA 4UBMA 3WICA 4C01A 4EHNA 4YMHA 2CNNA 2PGAA 3L49A 5CVTA 2LPMA 1OQAA 3T3HA 2VAXA 2IYZA 3I0ZA 4WHMA 5AVOA 1SUCA 4WLFA 2GN4A 1GNRA 1W35A 2H11A 3CVUA 3OFNA 1O94C 4OHZA 3SNKA 3TB6A 3WWZA 5JT1A 3RAGA 4LJSA 1K2WA 2HWYA 2I6XA 2QT9A 1J8VA 4DLKA 3PL2A 5EWJB 1P60A 5A6VA 3O03A 2IP2A 2NWQA 5JCPA 3ESQA 3TL3A 3R7AA 4KYIB 1TPYA 1UKCA 5HIIA 2DPMA 3SR4A 2OZVA 5F21A 4D3FA 5H9WA 3OM9A 1ACJA 2DPGA 2G76A 4MZDA 4X3OA 1J33A 2JLCA 2CHEA 2GTPA 3ONVA 3BXGA 3BVPA 2UUOA 4CR7A 3HYLA 4WFQA 3FTQA 4FWBA 4L08A 1XZDA 2RHLA 2CNOA 4QKQA 1L4KA 3N2KB 3FRHA 3O2NA 2JBHA 2X8JA 3JQFA 4OUKX 4QDKA 4W99A 4MUGA 4URXR 1HG1A 1G59A 1Q2XA 1VLMA 1PEDA 4Y1RB 1LIKA 3PTAA 5AKJA 4L0DA 4ZOQI 4GXQA 1CNEA 1IXYA 3E8XA 2O8DB 4Q4HA 3C4QA 3S8EA 4YIHA 2C9DA 1YJBA 1P7YA 2V7WA 4TUYB 5A4MS 3U1BA 3BE8A 2DETA 3WWEA 3B13B 3RJ9A 5JISA 3NJ8A 4H2DA 5FYQA 1O0BA 5DNWA 3MWDA 4LMPA 4ZZIA 3CXUA 1JIVA 1DAIA 1T8RA 4CM6A 1EBBA 1RT9A 1Q57A 3ASYA 3BZBA 3G9UA 4Y6LA 1V3QE 2R97A 4NCNA 4PLZA 1Q11A 5SYNA 5HUQA 2GPBA 3PS9A 3TQOA 1P2BA 3D3WB 4D0RA 4AKIA 3C1TA 3SP1A 4AJOA 5EKDA 1K7CA 3IPAA 4KQMA 5DLEA 2H07A 4U9IS 3EVBA 2PXXA 3MGCA 1BN7A 2IDZA 4KDCA 5ILGA 3EFOA 3AVQA 2LRHA 2VQ3A 2YZMA 1Y4UA 3M7IA 2PKKA 4JELA 5AH0A 2VG8A 5LIPA 1JKJB 2SKEA 4JLWA 2QTFA 2GAAA 4FD2A 5LR6A 1EVZA 4AM8A 4BNHA 1HUQA 2NTVA 1M8GA 2QIPA 3ZQUA 4DJTA 1A0OA 2VDVE 4J4BA 5A3RA 4EOHA 3G5LA 1KSJA 4OV6B 1EESA 3DJFA 3OQHA 3R0ZA 3ED1A 4L9SA 3P26A 1I0LA 1WCXA 4AVYA 3CT4A 1TDJA 1TMYA 5LQSA 4DV6B 4QBKA 3HRHA 3AUKA 1NV9A 4XGKA 2W4IA 3GJXC 4L0MA 1E98A 3TYXA 2WIJA 1HEIA 2CVHA 5E2BA 2BGJA 2OSBA 3CVJA 1RPNA 4ZI5A 3T7CA 3W9UA 4BPRA 1J70A 3IE1A 3VO2A 3CRVA 4D43A 3QY0A 3TUJC 1N36B 4NJOA 1YB4A 2FMXA 2LIPA 4GZLA 3F4LA 3PVCA 5LDGA 1D6JA 5EJEA 5HGXA 1YHJA 1BWPA 1NW5A 1JHZA 2ILVA 2FFRA 2LCFA 1F60A 4B2IA 2FHPA 4B6EA 3SF8A 5EOVA 1QRDA 2P6MA 1LDGA 4LRQA 1IQPA 4YP7A 2X23A 4IDGA 4N6GA 1KYQA 4M8LA 4HQFA 4TXNA 3QKIA 5JH7F 1AZLA 1T4CA 3QU2A 4B87A 1C9NA 4M7WA 3GR6A 4QBTA 3JARB 2PUHA 5IWAB 7YASA 1B7GO 1P8AA 1PEKE 3KG2A 4G67A 4M1MA 4A8PA 1XEAA 4I2VA 5IYZA 4PFQA 1VBNA 5A0FA 5D5QA 4CMCA 3AUJB 1R6DA 4KLZA 3MWGA 4C03A 4CT5A 2BMFA 1CSEE 1KRHA 4HX5A 4IKPA 5EGNA 5KJEA 3RE1A 4TL6A 4E4TA 4HDKB 1W46A 1XCBA 1NY6A 4B4OA 5ARBA 2KWIA 2O3RA 2WFLB 1WOMA 2PHZA 3ABRB 1EZ1A 1OX4B 1VPTA 1J0XO 3HA7A 3SQNA 4AT1A 2VAVA 1DJPA 1T9HA 2G88A 5DGTA 1I94B 3UPTA 4K9IA 3EGEA 3JZFA 121PA 1ZK3A 3I1JA 4QOIA 4W9MC 3HWSA 2ANCA 2I4NA 4LA4A 4ZHQB 3N0WA 4HFRA 2WVJA 2AA0A 1R0WA 2W2PA 2FSPA 3S8MA 5EWLA 4CG1A 1JHRA 1U1DA 1QV9A 3L8ZA 1DLIA 3LFHA 3DDNA 1D9XA 4KE9A 4OI0A 4LGMA 2OQIA 3DWEX 2BBTA 4JUFA 4O4IB 2IV3A 1Z4IA 3M6IA 1E4YA 3AMVA 4OOEA 5HKKA 4PG7A 1VLLA 1GG2A 3FNIA 1SVNA 3OCVA 4ZI7B 2J6IA 1TC1A 1OAOA 2X9LA 3HDHA 1BNCA 3S1LA 4E1VA 2PGLA 1M1NA 1DB3A 4AY3A 4GP6A 3GQBA 4ZTZB 2PZEA 4LHYA 4GYYA 3TK1A 3FCXA 2Q28A 2JGRA 5L3VA 1UPCA 2OZKA 3B3JA 3PQ7A 4C0JA 1XJ0A 3P9YA 1KOLA 3P4XA 3B12A 5I4BA 2GXSA 4DV2B 3P9RA 2CXXA 4YJGA 1O89A 1QX4A 4JH0A 1XVAA 2HEGA 3D2BA 4POAA 3ES9A 4MICA 4BB6A 3FNBA 1AUPA 2VTEA 1ZJ4A 1COZA 3ETLA 4HATA 5ALMA 4EF6A 4HVLA 3LLCA 5A4IS 4C0LA 3RQQA 1RBMA 2O0JA 2V7EA 3ZM6A 5DWQA 1ORRA 2C1XA 5T8KC 3P71T 4DPKA 4PPNA 4EB6B 5KQLA 3FHTA 3UFXA 4EO9A 5D6NA 2WHEA 3IP8A 4C6TA 1LV8A 4KWEA 1MIOA 4FFVA 5FV7A 1DVRA 2HREA 1KZYC 3DZBA 2DTEA 3H16A 3GJQA 3K9WA 5DXJA 1B93A 1IZ0A 1VJCA 1L4MA 1R64A 1TVKB 2PSHA 1ISSA 2WE7A 4IF4A 3FVWA 3OZBA 2LV8A 4IIXA 3K5IA 4RSHA 4WQMA 2QORA 3K0CC 3BGIA 1KK0A 3OLWA 3FWHA 3NUQA 3E22A 4HNSA 1E92A 2FW1A 2IYFA 4X6XA 3LQRA 2H1VA 3PHBE 4AS1A 1CZNA 3DTYA 1TNDA 3RHTA 2L2QA 1A7JA 4ONEA 5B58T 3J7TA 2YCLA 3CX7A 4B2PA 4BCDA 4UDNA 3DVQX 2CMFA 3K70C 2FP4A 2QPAA 5IC6A 4DRXB 5J2TB 3B1XA 3N1CA 4DMGA 4CL8A 3JQ8B 3RS0A 2NVWA 4Y6SA 1ISRA 5T4FA 1PE0A 1ENZA 3DZFA 5G2OA 4EGQA 3TZCA 3UH1A 5B1EA 3UWDA 3LUGA 3MGGA 1EXDA 1NPDA 1XF9A 1WVGA 2TMYA 3SS9X 4OHMA 3WBFA 2AMJA 5JAIA 2CEAA 3AUUA 1GZ5A 1AA6A 4JI6B 2FPOA 4U6NA 4ZC1A 2XGSA 1WDWB 3A11A 3KRTA 1HT1E 1OFTA 1TW3A 1DI0A 1YL7A 2C98A 2INGX 4M3NA 3MUEA 4Y2TA 3V7YA 2XB4A 4AO6A 4BO5A 4CQJA 3KKLA 2CFIA 4Y2GA 1KBQA 3WZLA 2I7TA 2VP0A 3F5DA 4NATA 3PPIA 5C51B 1QKJA 1VRWA 1QVAA 2FPUA 1ORWA 1BEUB 2C96A 4RL4A 4BAUA 1PCXA 4XJVA 3RT9A 1V41E 3QEMA 3MPUA 5KNBA 2B7BA 5CHEA 1D2GA 5DI3B 4K9PA 1QG2A 1UANA 1W85B 2EYUA 3JQ7B 5KTMA 3CA8A 1RXVA 5ECYA 3PF9A 4OBWA 4RJKA 1WV1A 3X1JA 4N8DA 4E5YA 3E82A 2J07A 5AESA 1KJ8A 1WZ2A 1PR1A 4MW6A 2V98A 4JB2A 5BUQA 3B2QA 5EC8A 5JOQA 1XMIA 3HP7A 4UTNA 4O02B 2FWNA 1GSOA 1QH8A 2YR0A 2NVBA 2YBDA 4FONA 2J31A 4HL6A 4XVHA 5FOSA 1G7TA 2JATA 1I7NA 5D51S 4U2DA 3UVEA 3EC2A 3NORA 5E3IA 4JI0B 4D9HA 1Y3DE 2A6PA 5BN4A 1XCMA 1SHUX 5AOBA 2RH5A 1YDMA 1GUFA 1JU9A 4H7PA 4L9AA 3ZKAA 1KQ3A 1VL8A 2PGXA 2Z6QA 3MUNA 4AYTA 4EYOA 1CXZA 3FIUA 1E0DA 1QIHA 3JAWA 3QZUA 4KSYA 1G55A 2VXYA 4C4SA 5GAJA 1H4TA 4BNDB 1UF9A 3DXFA 4YCDA 4R01A 1P3DA 1K0UA 1SNYA 2QAGA 2RARA 2VRWA 3EF0A 3P9NA 4M6WB 4XDAA 3LJKA 4GUDA 1ZRHA 5ELXA 1SBCA 1QAQA 5HGJA 1XXHA 1JPUA 2TMKA 3DWFA 1C1DB 1B14A 2WAXA 2AQIA 2HMSA 3QE2A 3ZWAA 1U2DA 4ZAWA 1M0SA 3FPHA 4JC4A 6CHYA 2FZVA 4P84A 1L7NA 5I7RA 1ARZA 5KJ6A 4Z1MD 2JH3A 2BOVA 1M1YB 1GPJA 4JC8A 1SGWA 3MLEA 4NCXA 2RKWA 3I9V1 5LZ5A 4CR6A 2XMSA 2ENUA 1M7HA 4E0BA 2H2HA 3NM3A 4NC9A 1XZPA 3SKYA 3IQIX 1YH3A 3ZH9B 4BX9A 2UZ3A 4Q7JB 2ZRLA 3FJOA 3NCHA 2OZEA 2O2YA 1GGMA 2W8BB 1E18A 3FFXA 3L6CA 3NHMA 1SXPA 3ZWXA 4EF5A 2GM5A 1I4LD 1UZLA 1B0AA 3HFSA 3U7HB 1JG3A 2GBLC 1EWQA 3MOIA 1BMQA 3PC8C 5HOQA 4MMZB 1SXJB 4MS3A 2CJXA 1LX6A 4GMFA 3DQPA 5EP1A 3TW8A 1XHFA 4RMJA 3B1QA 3U3DA 4ZMSA 1WKVA 1NAIA 4OGGA 2HJRA 5AVJA 1Q91A 2HA0A 2HLPA 2ZW9A 1M34A 2VH2A 3IV9A 5FAKA 2HR1A 1JEAA 4GXRA 1ZA1A 3B1ZA 4LC4A 5KKCA 2BZSA 1PZMA 3W2FA 4NH0A 2OYRA 1G5FA 1NW7A 4J0KA 2FZ5A 3BWCA 3DP7A 5E3JA 3T0GA 3WLNA 1QQ5A 5HQ3B 5K8CA 2AJBA 2VDKB 4CLXA 1YKSA 2IYPA 3WYAA 1Z06A 2GEKA 1VM6A 1X7ZB 1P1CA 4ZALA 3PNYA 1RJ9A 4N7JA 1C3OB 5DP2A 1YJAA 2PMBA 3A36A 3R20A 1DG9A 3MS4A 3BGOS 3WV5A 4ZAXA 2NVUA 4ZO4A 4DW8A 5EP3A 3RAEC 3RNOA 1SPBS 3M6AA 1P4GA 2IYAA 1XRLA 3TW6A 2Q3MA 1R8XA 3DJYA 4QXMA 4GFDA 1M2FA 5THXA 1S2LA 3FI0A 2JCGA 1SUWA 3B1RA 3GJ5A 3QG1A 4CIWA 4M49A 1V1MA 1O1YA 4D4HA 4IS2A 1P6UA 1LZLA 2M6SA 4UUMA 1GD1O 3ZY3A 2Z58A 3QKSA 4NYIR 3THYB 4PBRA 3B1VA 3RRZA 1P31A 3FFWA 1SBYA 1XCOA 3K15A 4NFYA 3RG8A 3KQKA 4J4TA 4J0DA 1RRMA 1EBUA 3H6KA 4G8BA 4GOND 4Y8VA 2ZB2A 4EAQA 1J9EA 1JZQA 3PFCA 1QR2A 3KLPX 2ZSEA 1IN5A 1U9CA 3H3FA 2V65A 3IT3A 3Q5EA 3WWOA 1IOVA 4GNRA 1U3GA 3OWHA 3PWSA 2EWVA 3LWDA 4BWGA 4MJ7A 2G8LA 1BMFA 1CUFA 4BFLA 1MW9X 2H1WA 5JLAA 1C1XA 4KAFA 4LOHA 3E84A 5HSGA 2UUCB 4GSKA 4IWNA 1M6VA 1UBFA 3DULA 5AKGA 2IUUA 3K0FB 3NB0A 3MTAA 1IWPB 2D8AA 2QGNA 3CM0A 5L3RA 3S2UA 2A9JA 1B43A 1ZW6A 4PU0A 5JCXA 3UJ7A 2G67A 4CKBA 3DBVO 4M1YA 2FN4A 2ODPA 4MDFA 4AP6A 3R7SA 4B33A 2YXTA 1SCAA 3OFSA 2B9VA 2WQ6A 3WSWA 2RB5A 2F8TA 1SC4A 4FN4A 4HAWA 2YRWA 2BDEA 2PXAA 2DT8A 2X8AA 1FU8A 3DOCA 3KOOA 5DCLA 1NDHA 1Q7GA 1EUZA 3MBOA 4BMYA 1DJLA 2LZ0A 3PXUA 2X58A 1GKYA 2HK9A 2O2IA 4J03A 1N32B 4M7PA 4MW2A 1H2RS 3NKVA 4PZEA 4FQ7A 3JQDA 4Z9YA 3OEHD 4DIUA 4UFOA 1FMJA 1H1LB 4IAOA 3SLRA 5JO0A 4DC0A 2CUKA 2W2OA 1V7QA 3OU6A 2XYHA 3RVKA 2XECA 1NG1A 2BWJA 4MWEA 3HBFA 4DCCA 1V6CA 4FI3F 4JJGA 4TLBA 4C43A 1GNTA 3NC1C 3TIFA 4KQWA 4GR4A 1BJRE 4J0HA 4EBUA 2PRYA 4MROA 3VR6D 3HHPA 3HUEA 4IX1A 5E4YA 2VSQA 1NJ2A 3Q11A 4DA7A 2FPIB 1JQAA 3L05A 3EJ6A 2AFIB 4MHSA 4MWGA 4RVFA 2CXQA 3O4RA 3U13A 4B40A 4TMXA 2ICAA 4PX9A 1GUYA 2Q9CA 4B4WA 4OKIA 5EXPA 2NXJA 3T9BA 3ZBTA 1BX1A 2JKZA 5JV5A 2F67A 1QO7A 2BSAA 2PMDA 3DO6A 3H0EA 4JVLA 4L0CA 4X91A 3ZYZA 3F2IA 2F7KA 3EQ6A 5D2CA 1HQCA 3KDPA 3JQBA 4U7XA 2GD6A 2PR2A 2W83A 2QXTA 5B6PA 4O08A 2QP4A 5ALXA 4LEIA 1RYNA 5B1SA 4MDYA 4TT3A 1KY2A 2EGHA 2TECE 3HJBA 3F46A 4MCJA 1ANKA 4E5DA 1H8EA 2WT9A 2AK3A 2VJAA 3EFBA 4PYLA 2ATXA 1E77A 3ZV5A 5SZHB 4JT2A 3I52A 2WTXA 3NVAA 2OCGA 4GMXA 4OQFA 1NVXQ 3PPWA 3S5JA 1W30A 3CRNA 1HX7A 2MJLA 1FXWF 3PUZA 4YGXB 2J5KA 1E8NA 1PJTA 1EVYA 2QRVA 1HXHA 1VCNA 1LZKA 4JOQA 3LHKA 3COVA 3TNLA 1BGXT 2VPWA 1PX0A 4TVOA 1KZ1A 1XMPA 4YCNA 3IA7A 4MHOA 4EBBA 3BB3A 1OBOA 1RPAA 1EGHA 2ZBGA 3KE8A 1MTZA 5TQ0A 3TX2A 1NU8A 3UJDA 4J1TA 3O3CA 4BO1A 5L4SA 5B3KA 5LQAA 3BSFA 3ENQA 3OBBA 4XTCS 1QZZA 4Z9XA 3IR7A 1CBUA 2O2JA 1F17A 1MG0A 1XDUA 4OK6A 3C48A 4LYDA 1JEYB 5B2ZA 2GN2A 2VSYA 3DE5X 2IUYA 4WFIA 2DPHA 5AHRA 2KLHA 2GTHA 2J4FA 1C80A 1JSZA 1GNLA 2ZYVX 3R9KA 2WF9A 3CF4A 3PX3A 5KHAA 4C30A 2CCJA 5HCUA 3M1YA 3L5KA 4ZEVA 1J8MF 4G56A 3SJUA 1FK8A 1YHZA 1RWQA 1TM7E 2PZLA 1ENOA 4BC1A 1PS8A 1UJNA 2QRZA 3A8TA 1OH7A 4EKGA 1C1HA 4EGCB 1IXKA 3CISA 2VTVA 4PHGA 1VYVA 3DMTA 3LCCA 2RCNA 1A9XB 4P4GA 2WM3A 1TFRA 3KOUA 3H5RA 4YCLA 4LHEA 2W98A 4I19A 1II9A 1L6IA 3D8BA 4FPXA 3E9EA 2R86A 4QAQA 4QXOA 5KAPA 1XP5A 4DPLA 3B9BA 4YUYA 2FCRA 3MTIA 2VSFA 2XADA 1LTHR 1G3MA 1YZYA 5DTQA 5H1YA 2J3KA 1ZITA 2L0XA 4GM4A 2X1LA 4RYDA 2FPSA 1YFZA 2OM6A 1C7ZA 1A8QA 1M2WA 5FKJA 2JRCA 1GDHA 3OEWA 1N2EA 2QX6A 1F20A 4PZYA 3NBYC 5HKBA 2VWHA 1AV7A 1WO8A 3RIYA 2WVGA 3SYRA 1TUBB 1X94A 2CKDA 3H5VA 1SD1A 1AK9A 3UCXA 2A4KA 2ZRAA 3NWJA 4NV0A 2GWRA 3D7SA 5L7WA 1AXGA 1Q1AA 1CC1S 2MSCB 4RD1A 3LZDA 1YE8A 4CWAA 1M8FA 1NJ1A 1W1IA 3EDRA 2XVZA 3EXHA 4GLBA 2GXAA 1QFZA 3REOA 5C53B 1BXRA 1V8OA 3D3QA 5C34B 3GMDA 4HI0E 2EQAA 3KWLA 1QP4A 4EHHA 1E58A 4HAUA 1FZTA 1EXWA 1MJGM 4R8MA 1C1YA 4ITVA 4JP5A 3H13A 3RVBA 3EEOA 4QPCA 2X77A 4NX2A 3VA7A 1FFEA 1SVIA 3WBKA 5AVWA 1V25A 1PS9A 2X3UA 4MV8A 4Q7KA 4FHZA 4A6DA 1SVMA 3PQFA 3M5WA 3PQ8A 1AVTA 4MR7A 4PGHA 2FRDC 5BSEA 2VTBA 1JDVA 3NC9A 4Z3OA 1CEYA 4JWTA 2R6R1 2ZT6A 1UOPA 1OH6A 1SUEA 3RSFA 4EKDA 2AK2A 2X5XA 4MA0A 3AVWA 2DH5A 2Q0QA 3KQVA 3L7KA 2H5IA 3QTTA 2X8JB 1PZFA 2XMQA 2I3BA 3W5HA 2NSYA 4INOA 3FTFA 4DDKA 1FFYA 2F1OA 4IDAA 1EB8A 3E7DA 1W4LA 2OWEA 4Q4HB 1FDRA 1CHDA 2IQIA 1GAQA 2XAUA 3LOUA 5EQTA 1YRHA 5CG1A 3CRQA 1UIMA 2WJHA 2QW1A 3TNFA 3U4QA 4BUZA 4Z3KA 3AK4A 3MWDB 5T57A 1BE1A 2A86A 3CJRA 4BQRA 3E1GA 1L7VC 3A3KA 5HF8A 1LFAA 2AIRA 1NWHA 2CF5A 4IV0A 3TXYA 1P72A 1P2GA 3VZPA 2BSQA 3ESCA 4LWOA 3GZ4A 1V3TA 4KXVA 1AKYA 2I7DA 5AHWA 4GL4A 2IJGX 4IXWA 5DXAA 3HVUA 1KMQA 5I7SA 5KWJA 4TWZA 2VORA 2LXNA 4NPAA 1EX1A 2H85A 3DNFA 5AI8A 3IIEA 2ASVA 3CPSA 3IHKA 3KB8A 3PJDA 2QRKA 3MAGA 3USZA 5LQCA 3K3PA 3ZWWA 3NYWA 2RGDA 1Z5WA 4L5JA 2CZCA 4KYTA 4E08A 4IOLA 1N4DA 4ZN6A 4K8PA 5SYMA 4KQJA 4P93A 3RF6A 3ZHUA 4TROA 1E7YA 3I05A 2JLRA 4REQA 5AHKA 4BGVA 1UJ5A 4LJ8A 5FBHA 3QA2A 1UP4A 2HTEA 4IP0A 5J63A 4NHEA 4TTQA 2P3QA 1DDOA 3DEKA 4H17A 4PX3A 3ZL8A 3X1XA 1KI9A 4XGQA 2MWMA 3O4IA 4DQLA 2HYIC 4X90A 4S1MA 1DUIA 1ZK2A 5ALPA 3X0DA 1FUUA 4N65A 1RM5A 5AOVA 4BFUA 2FWMX 4OIMA 3FHJA 4EG0A 2OO7A 3V8QA 2GDZA 4LTDA 3LAWA 4AQYB 2BJHA 5K3AA 4ISBA 3ZLVA 3IYLW 1JG4A 4AJEA 4EUFA 4L51A 4MW4A 4R4JA 3SF8B 4GICA 3ZIDA 1RHQA 2GFHA 3N59A 2D1RA 2FLWA 4MW0A 1VL6A 1MD9A 1W6UA 1HYQA 5CYPA 3HRKA 4M0PA 1BZYA 1L3CA 2H4YA 1T4CB 3WTCA 4AROA 4BASA 5CB0A 3IVXA 1MW8X 4HPJB 1VDZA 5DTJA 2ZIGA 5IYZB 1JQ3A 2HQBA 2O2ZA 1F6BA 1GAWA 1PFUA 2V96A 3GWGA 4F9TA 4FWTA 2F3TA 2IQ5A 2JZNA 5JE8A 3VPAA 3F5SA 2JI6A 3N2YA 1K5GA 3O82A 5TGZA 4TLLB 1P0CA 2UYYA 2D1SA 3QLVA 4TYQA 5LMNB 5AW9A 4GRDA 1DQSA 3KHSA 4ZPJA 1E6UA 4RX1A 3FR7A 1TUEA 4V2IA 2R8OA 3K73O 4Y1FA 4EG4A 1T29A 3KHUA 1O5IA 4FYPA 4MP3A 1UBRS 2WSYB 1R2QA 3VC1A 2Q7OE 3FKSD 3CUUA 5FFFA 1FMCA 2AZMA 5E7QA 5B1DA 3IODA 5K0LA 3ETCA 3HB1A 5EWLB 4S1WA 3U26A 1T2VA 1NJSA 5EEGA 4DTCA 3N86A 3TMAA 1XALA 1RQ7A 3U62A 3TSOA 1A2QA 5G0UA 3W1EA 2QMHA 1AHNA 4FMPA 4FOLA 1VMIA 4BVJA 1VPLA 4MR9A 4E6PA 3NEPX 3VO8A 4X7BA 2RAUA 1FUEA 2B25A 5U1PA 3WNDA 4C4YA 3MS2A 4PPGA 5SY4A 4IJMA 3D6MA 1IAQA 1M1NB 2ADFA 1EE1A 3I2FA 2NSJA 3GQBB 3FCCA 4M54A 2H2GA 4RESA 4UVHA 5AMXA 2ACWA 1MRZA 4UHBA 1DMSA 1XLUA 4FINA 1KVTA 3A9RA 1ZGGA 4KX3A 1NRJB 3FZGA 3AUTA 4B6SA 2CXNA 1Y7LA 1JMYA 5JNUA 1ESNA 2V7XA 3PPVA 4YJGB 1K68A 2ECPA 3AR9A 3GFFA 3MJTA 2IEIA 4ED9A 5K8TA 3HICA 4DUYB 2B3DA 4MYHA 3JYLA 3C3MA 1UJMA 3H3XA 5JO9A 2DCUA 4KODA 5IXSA 3OM0A 1JDBB 2FWRA 3IVCA 4HDCA 4N9QA 4TGLA 1QHEA 4DIDA 1PQWA 5J4KA 4L15A 1N2ZA 3F9RA 3HP1A 1H4QA 2GLTA 2OHIA 4P7JA 5IH7A 4Y6RA 2LP4Y 1E7RA 3UFXB 4FLMA 4UNRA 5KYTA 4YXFA 5L51A 2OHFA 2PG3A 4KYVA 2CFTA 3RM5A 2QX9A 3EMVA 3IBTA 1MIOB 1OZHA 5CVEA 4GI3A 2VWQA 1CUSA 1YNOA 3QEOA 3K7EA 3L7CA 3B3QA 4LYYA 4W1PA 3TS1A 4CMAA 1PQPA 2XNSA 1ZC3A 1ZCZA 1C3VA 2P65A 1LH0A 2FE1A 2XTAA 1RFGE 3E22B 3JRWA 4GPEA 4WOKA 5HWSA 2NO5A 3KX2A 3LVQE 3D2CA 2NO6A 1Q22A 5I8PA 4PGFA 4BL5A 4NV3A 3O95A 2AGVA 2XUKA 3GLGE 2E5LB 2MYUA 5J3JA 2DJIA 2FP4B 4DQVA 1P3Y1 1OH5A 4YUVA 1JXIA 1T25A 4LHVA 3OLYA 5GJWC 4DXHA 1O4VA 4EFDA 5CDGA 4K9CA 4QU8A 4NV1A 4X60A 5E7JA 1QP0A 5LJIA 1IZYA 1QDLB 2JFGA 3E7XA 5BSFA 1SOUA 2ISSD 5EJGA 5H4GA 4LZAA 3RUIA 2B2NA 2BEVA 1PP4A 3V8NA 2BH9A 4BQOA 2IYYA 4R1MA 1C8VB 2R87A 1DRWA 4FGUA 2QQGA 1NUQA 3RVPA 3GYGA 5BY2A 1DRJA 1K4MA 1XA0A 3FNRA 3KAJA 4OMFG 3SZUA 1F38A 3GJ7A 1KYZA 1JN0A 3MCZA 1G4UR 5AHXA 1KTVA 1Z5OA 3LRXA 3MWEA 1WNTA 3M49A 1WUIS 4D9IA 1V7PC 4DG9A 4DMFA 2VCEA 3WAGA 3ETHA 3GYBA 3PC3A 3QEMB 1R5JA 1U1FA 1R18A 2ONZA 2X86A 1T3LA 2OO5A 3LLVA 3J81k 3BIXA 4KPYA 3H5NA 1LRLA 2VF7A 5K51A 5EMMA 3IEVA 2EKPA 1YQTA 4FW9A 5LMCA 3UKJA 2OG1A 1ATZA 1WUYA 1V26A 4HLDA 3B1NA 3O31A 1E1NA 3N8HA 1I7PA 2R6AA 3HP4A 1REQA 3SKXA 3DMYA 1I2CA 2OV8A 4OL9A 2G06A 1FP4A 1UIRA 3MD9A 1F2DA 1FXUA 2JIZD 3DOHA 2EZ4A 4O4HF 5E1MA 1CZRA 1QH8B 1H85A 1PWEA 4L73A 8ATCA 2X2FA 2CYAA 1BRTA 1HE2A 1XKQA 1GRCA 2ZRCA 4IJ6A 4UHJA 4L4XA 3MMXA 5BN4B 1T9ZA 4D26A 1N2OA 4X63A 4PG4A 3R3HA 4S1VA 5FTKA 4PX5A 4BRUA 2DXIA 3AVUA 2YWDA 4Y9SA 1VSVA 2W6IA 2Y4NA 3JAWB 3WHLA 2B78A 4YQFA 1OGYA 2ZJ3A 1GITA 3HZOA 1NUSA 1ZUD1 3N74A 3VYWA 2HLZA 1ADBA 2QAGB 2XSZD 3A1EA 2O8EA 1Q19A 3W06A 1NW9B 2WUGA 4AIIA 2OQVA 1XXHB 3JWJA 1V2GA 3C6BA 2TMGA 3BH0A 3JCZA 2FXVA 4O4JA 4EJSA 4ZOLF 3P32A 3PUVA 5DOZA 4H0FA 5CB4F 2VCHA 3PDCA 3TQCA 4FB4A 1E79A 3GRPA 2Q4DA 2AJTA 3RVLA 5FRDA 2HD4A 1R0XA 3GCXA 1I6WA 1T8UA 3LT5A 1IOZA 4GO1A 4PZUA 4RF5A 5FOWA 3SIPA 2RG7A 1YQXA 3QFHA 3HYNA 4S04A 3BX1A 5CFZA 5FOVA 1XYGA 3GAMA 4RE6A 2CYBA 2G9QA 1YE3A 2JJ1A 1F8UA 5E1OA 4L57A 4BQQA 3CUKA 1PN3A 1L5FA 2QB5A 3F73A 1N0HA 2AG1A 1CNFA 3VBEA 1V4NA 5ILQA 1LQUA 2IP4A 2PMKA 4D45A 3MBHA 3H1FA 3GN1A 3R74A 1XP8A 3WWYA 4AK9A 3BMOA 1UFQA 1Y5RA 2C1EA 2C58A 4ID9A 4LX0A 2BTOA 4MS3B 1O94D 3OOJA 2CVQA 2WFMA 3MJ4A 1WABA 5JI2E 1KR5A 3TW8B 5CCBA 4GMGA 5LWHA 4RTMA 3OM1A 5LQMA 2H4JA 3RVRA 2X6RA 1B1AA 3ASUA 1VG9B 2ZI6A 4LY9A 3ZDRA 3ZWMA 5FNVF 1DTSA 1M34B 1XQYA 1MC4A 3INGA 3OQ6A 5KYGA 3LTNC 2ZXFA 4O1MA 1PD0A 3OE4A 4GP9A 1ORVA 2E1RA 2YYYA 3RC1A 5JI3E 4EARA 1I7QB 3FOFC 2WHRA 3N28A 3ENZA 2O57A 3TZ6A 4CGZA 1IRXA 5TRTA 3QUTA 4OYLA 1P4JA 4U6QA 4DABA 3C2QA 3UGQA 2XUPA 1MXHA 1F8FA 1T1EA 1ZJZA 1E7MA 4IDHA 3AR3A 1RJ9B 4RK5A 3A1UA 2H2AA 4WGGA 4XARA 5ALHA 3T5AA 3PEFA 3M1LA 1CB7A 4CG2A 3OKAA 1NYTA 5F64A 4R83A 3IQFA 4JYCA 3GLRA 3UJ6A 5AT1A 1D6NA 2WA2A 4LRUA 2NVUB 4LNAA 1P8JA 2C5AA 4HG2A 3COPA 4JC5A 4PLYA 2WD7A 3BA1A 1KFCB 4QREA 4X1OA 4ZA2A 3ZZTA 1R00A 4KPEC 1VYUA 2KJQA 4ALLA 4IDFA 3HKDA 1ZOPA 1E6MA 3OQVA 5L40A 4CKCA 3ONFA 2WAOA 4D97A 4F04A 3HUFA 3LHSA 4LKRA 1V1MB 1DV2A 1QFYA 4YL5A 1QGED 2OPBA 5TY0A 1JG1A 3QKSB 4LK2A 1SIBE 4B8ZA 2QUBA 5G1PA 2W2QA 4Q1FA 3ZK9A 3DMDA 2VQ6A 5CT9A 4TV8F 2IP1A 3RVJA 1Y9ZA 1T9GR 3W2IA 2QPOA 2XWJI 1ZUNA 2N9UA 3D4LA 2ZUTA 3TTYA 3EH1A 3EUEA 3VVCA 4QDIA 3AFIA 1Y3FE 3U6BA 1U2TA 1K3UB 1Z75A 2AN3A 3B52X 5T6MA 4OGFA 4B32A 2P8JA 3C8UA 4CM8A 4CRWB 1Q0PA 1P81A 4ACAA 2VZ8A 4AURA 4B4KA 3LQYA 1C1XB 3O2QB 4MGZR 4Z9FA 4L8GA 4ZVQA 5EZSA 1ZVJA 4UC0A 1M6VB 4DWJA 1GTVA 5ABPA 5I3ZA 1Z0DA 2BEKA 3I61A 1IWBB 3HJTA 2V7QA 1XRMA 3PNSA 4JR1A 3GLSA 3SZLA 2QTHA 3IMEA 4CKBB 4G0VA 3COZA 1Z0UA 4J2OA 2QCVA 3PPYA 4LFCB 2J3EA 2A9OA 1XB2A 3B6JA 3HLTA 4RWEA 5LBTA 4YJFA 4DDTA 3CUSA 3OCUA 5BOVA 1HZJA 3NFRA 1FSSA 2EFDB 3ANYB 4OHBA 3OZDA 2DUUA 4UDXX 5IMBA 1L5GB 5JJKA 2J48A 3WRYA 4DCGA 2HHCA 2QP3A 3DBRA 3N0VA 3PDWA 3COJA 4EMTA 1P80A 2OLEA 1VFNA 4HMPA 1A2BA 3KVNA 5MN5A 3NANA 1P2VA 5IUNC 4PZDA 3ZHOA 1POXA 4PNPA 5KQMA 5IBQA 1DV1A 1P9OA 1GPUA 1KSHA 1L4YA 2O05A 1C0EA 4FGSA 3FLEA 1CCWA 1XMVA 1KEVA 3CBGA 3CEJA 3K20A 4XTRA 3T1QA 4BBZA 2WNHA 4H08A 3VH2A 1A96A 1VKRA 2FUNB 3FCEA 1U2QA 5DRTA 1GA4A 2FZ4A 5F33A 3PCTA 3OX4A 1R27A 2J0EA 1WCWA 3LFTA 1AS2A 3O74A 3TOCA 2IYWA 1ELOA 2I6SA 2V74B 5J59A 3B5JA 2NT3A 3RJMA 5MGBA 4FFOA 4YLYA 3UNXA 2IHZA 5IF3A 1IN8A 2R96A 3HACA 3EGXA 4JDPA 4UUQA 4ACBA 5L3QA 4A0RA 1II0A 4GQIA 4NZPA 4RVHA 4FMCB 4JL5A 2YWGA 1KPHA 3X2EA 2C78A 1GARA 2B1JA 3UWPA 4H1WA 1YUMA 5E3HA 1R16A 3IR5A 3F6CA 5GY7A 4LQDA 4B4VA 1BE8A 1IOLA 5KI6A 5A4DA 3D0QA 3MHPA 3H9UA 4MAFA 1B16A 3Q3VA 4MP6A 1JEEA 1CDOA 1TO2E 3U2QA 5MF6A 5DIFA 1YZNA 2PKQO 3RUFA 4F84A 1ORIA 1NR1A 5IU6A 4R8SA 1TD2A 4MTLA 5TF0A 1JMKC 1I13A 2FW8A 2VUSA 4BQNA 4O2AA 2DWOA 1QB7A 4F6RA 1QRRA 3K8YA 5DYWA 5IHXA 1G3QA 1PHPA 4BEBA 3TR5A 4D9NA 1GCUA 3DC2A 4FC7A 4HZUA 2BAGA 1H6AA 3HDVA 3RK1A 1TM5E 2CHUA 1BOFA 1GG8A 2QN7A 4FMBB 3Q8KA 2HN9A 4X7MA 4EUSA 3D02A 4RU1A 1KAQA 1L4UA 5L3SA 2QRVB 3PU6A 2VZ0A 1ZPDA 4XDZA 5HBGA 3WDLA 2V6MA 1J9GA 1H0SA 4JDUA 2JCYA 4L9RA 5IN4A 1XF1A 1C7EA 1JBQA 3HCAA 1UPBA 3VOSA 2X5OA 3BXEA 1KU0A 3S4YA 1QZTA 1RXYA 3C6QA 3IURA 2UKDA 2J3DA 1QIJA 2YQ4A 4YRFA 5TQ0B 1UOOA 1Q83A 2ZKIA 3AF3A 3OCJA 3QUQA 5DK6A 3ZGYA 2AQ8A 4PZZA 3MPOA 4R9NA 4RIGA 1FX0A 1K97A 3SICE 1W6RA 1M2JA 1TKCA 4DDVA 4B75A 4B6RA 1T15A 2V6FA 1XD9A 4DJAA 1UBHS 2ZB3A 4JODA 4OHKA 5HVNA 1FSZA 1ZH8A 4CYMA 1NW4A 4G9BA 2AM1A 3GD5A 4ALMA 2BYTA 4V0QA 2WJYA 4MYTA 2R7NA 4Q3OA 2AZXA 3GBUA 3NIFB 3ECAA 2QM3A 3WA6A 2ATVA 3NRBA 1HQDA 4Q12A 4KO1S 2D54A 4H31A 4C7XA 4DCVA 5JBNA 3CE6A 1VM7A 4L5AA 2VK4A 2NXCA 3KEUA 2G83A 3RSSA 1RXCA 2IZ5A 4FLFA 4GOXA 4XB2A 3AFMA 3UMFA 3ZXIA 2VTKA 4XYLA 4HDNA 2V0CA 2WWYA 3DVRX 4ZRDA 3RO7A 2CUZA 3QLEA 5DOVA 4HVAA 1XEXA 4ZVTA 2DEUA 1L5OA 4TRMA 3FSEA 4JQCA 5F4BA 1A9TA 2RHRA 2XITA 3LUAA 3L1UA 3H2SA 2JI9A 2B35A 2YWEA 5LVAA 1L1QA 1CRPA 4GBMA 4P2BA 1A7KA 1H05A 4CQMD 4DMHA 3TBHA 5JEEA 2PFKA 4DDMA 1GQ2A 1MJ5A 3IIJA 4KH1A 2HQSA 4WGFA 3K70D 3ABOB 3P2YA 5AJTA 2C2XA 1W0JA 3LKZA 3B1JA 5F1YA 1BMTA 5BNZA 5JXGA 3HGMA 1EQAA 5FTNA 3GRFA 2FU5C 5DXFA 5TSDA 1YR2A 3KZMA 2H4HA 4JA0A 3S99A 4W9NC 3BTOA 5CVJA 3OG9A 1F4LA 2QVCA 5CGQB 4E2WA 4U8GA 1R4NA 2OXFA 4JYPA 4G8DA 2NXNA 4Q7MB 1TZKA 1U02A 1GA1A 3MCTA 3IILA 3OPMA 1FDSA 3IPXA 3KZVA 5HFAA 2YWCA 3KDSE 4TWRA 3EXHB 3VNRA 5LZ7A 3O3OB 3GEPA 5J1SB 3HA5A 1HEYA 1BXRB 1ZDMA 1D1QA 4KLRA 3AHGA 1ZMTA 4QBFA 4AKEA 2CZQA 2V03A 3PTZA 5AYVA 3GT7A 1VHQA 1VBFA 2BFCA 4KP7A 4GEKA 4M9RA 4Q9DA 5DRYA 3DFFA 1JI3A 2VHEA 4JENA 4BUJA 1Q1EA 4WFJA 4MS4A 4K0RA 2QQFA 1UQRA 4DC1A 1BH2A 1NBWB 3FE2A 3VR1A 1NVBA 2GF0A 1T2EA 5B2EA 3L8DA 4MR7B 4PQGA 1WSBA 1XDZA 3NDBB 3IKVA 1WUKS 2YL2A 2VTBB 3JV7A 4KVFA 4EG1A 3MW8A 5C46F 2B20A 2W93A 3AHFA 4OFWA 5GJCA 5A4KA 4K81B 4XAQA 4FOOA 1F2UA 1HC7A 1LK5A 2YZKA 1LK7A 2VWGA 4WVFA 2WM8A 4QUAA 3QOFA 3NL3A 2PLAA 2VNIA 3K8OE 4IIYA 3A6EA 5AICA 1NFFA 5F7ZA 4RVCA 3TLKA 4ARSA 1DOAA 3RTCA 2O2HA 4KRYA 2HHLA 3TD2A 3FGOA 4KRFA 1DIHA 3NUGA 4MR8A 5T6BA 4TKVA 3ED5A 4MO2A 3INRA 1FTGA 3O84A 3PEWA 2IT1A 1J4AA 4BLWA 3U4QB 2YIJA 1WLYA 1YVUA 3H2IA 1QHNA 3HVJA 4BMSA 5IVKA 3UMPA 2R6GA 2Y27A 1J2YA 1E3JA 1NNI1 4J2TA 1CY8A 2OG2A 3ZV4A 1YV9A 4C2BA 5TVKA 5A05A 3L7MA 4YS6A 2ACEA 1VECA 3JQ9A 2RHTA 1ZA2A 2YVLA 1ZK1A 2X6QA 4CMHA 1U7UA 3P52A 3LBIA 4MI6A 3A4LA 3TRIA 1I2AA 2CK3D 2QJOA 1SU7A 1EK0A 1Z18A 1UC4B 4HSEA 1FFCA 3EIUA 3AFHA 4W8GA 4E7OA 2B4QA 3HZZA 4FDVA 3SDBA 1K5HA 5JVDA 2OBLA 3PQ4A 5BQOA 2DAPA 4ISCA 4OG2A 2GO1A 3OKCA 3SF0A 4C9BA 1K7EB 2AZTA 1Z4MA 3DA8A 4GGMX 4JOSA 1X13A 4A3SA 4FHDA 1EPUA 1OXBB 2FE4A 2HMAA 4FR0A 4OQLA 1XNHA 3FHLA 2IVFA 1DQZA 4AI6A 4REQB 1C7IA 3VAZA 8MHTA 3NM6B 1JV2B 2EZTA 2VHZA 3F5FA 4TMWA 4ZV9A 4R0VA 1M9NA 1O7JA 4RHCA 3G9TA 1ZMXA 4YNBA 2JLAA 2ZXUA 1TFUA 4J0QA 3D8HA 2CWWA 3GAAA 1TYDE 2IBMA 2HNKA 3CZMA 4IIUA 4LS3A 4BQEA 1BCSA 3ANXA 3VYUB 4XCKA 1UBKS 1WMEA 3LIIA 1PF7E 1RKQA 2VUIB 2GCGA 3QA3E 1KZHA 3LUDA 1KYYA 3TLGA 2O5EA 1WG8A 4KIUA 4L8FA 4LDPA 2X0DA 3MJVA 1NLFA 1YZLA 4HEHA 1H6CA 5AKZA 2C31A 4TTTS 4KXWA 3DZJA 4CLHA 5KU1A 3A6JA 5H9VA 4DLLA 4F5YA 5KHLB 2QS9A 3LX6A 4EQ6A 1QH9A 3LJSA 3V4PB 1G3UA 5L7YA 1DC8A 2ZPTX 4KR2A 2X3YA 5KYVA 3H4IA 1MCZA 1NYLA 1QX3A 1VTKA 1W2HA 4MRAA 1EEHA 3H2YA 5HTKA 2ZZNA 3PR3A 4RFLA 3OIGA 1LSJA 4I55F 1JHMA 1TC2A 1S2MA 3N7AA 2FPWA 2FWAA 1CP3A 1E5DA 3LVBA 2L82A 5AUNB 3IA2A 3LKVA 4EG6A 3CJQA 2HRRA 2Z8YM 3HH8A 3R44A 1LFDB 1M6YA 1LWOA 1CNMA 4H3VA 4MCAA 4YX9A 5F3WB 4Q1AA 3U7QB 3WO0A 1SB9A 2WLTA 2JCBA 5DZSA 4BQPA 3JPYA 1ZD3A 1DS6A 1N0WA 2HGSA 2PO7A 3CB4A 1Z0SA 1FB5A 3M3DA 3JD0A 4KFTA 3FLMA 5FOUA 4R31A 4EAAA 1A4RA 1ORTA 4JLPA 3I58A 1U81A 5BQ5A 5LXTA 5CIYA 2AG5A 5E6SA 4L4ZA 4V38A 1E1KA 1CR0A 2PZGA 1WMBA 4YJ3A 1Y3CE 2QD5A 4YV7A 3GGSA 1TIBA 3CRMA 3O0TA 1IN6A 4UE6A 4EABA 3T1TA 1MB0A 2JNWA 1T2NA 1JALA 4WNYA 3L0ZA 3PRKE 5K0GA 2OXEA 4MR9B 3FYUC 1LLQA 3D4NA 3D1VA 2ZRQA 5DLYA 1DJNA 1HBJA 1RQ2A 4C6SA 5HKKD 3ZNNA 4QOSA 2KYRA 3OPVA 1UKZA 2D5IA 3ICWA 2ZRGA 3EQZA 2P4HX 4UNIA 1QPZA 2RC6A 2DPLA 4HF7A 4M89A 3CW9A 1ZGBA 3S40A 3T7AA 2NADA 1MDFA 3C6YA 4XVRA 4DSUA 4HYYA 5F4ZA 4H1UA 3B7PA 3T5DA 2IZ6A 3BF5A 2DQ4A 2FETA 1V95A 1UBOS 1FNSA 4NCHA 2ZUFA 1SELA 4L2IA 1M6NA 2QRLA 4JJ7A 2D62A 3QEKA 4PLPA 4Q19A 1Y98A 4QLBA 4GZ5A 4NLLA 2G7MC 4CF3A 2R7MA 3MM4A 4A1OA 3DOUA 4F2GA 2AJPA 2ZETA 4MEJA 1RRPA 1YDFA 2MMCA 4HNUA 4DJEC 4B48A 1DCFA 1WE2A 4NICA 5E0KB 1BKDR 2AFHE 3AY3A 3I39X 3MAAC 4FFDA 4I1SA 4OP2A 4PXYA 3RU3A 1KQFA 4CZ2A 3RQ8A 1NY5A 1JA0A 4PG6A 1D2HA 3E9RA 3MF4A 3PHIA 2QI9F 3EYWA 4PPFA 4EWLA 1SUDA 3UN1A 1OKKD 1K8QA 2IEYA 3LNTA 4MH0R 4PZLA 1QAMA 1CZKA 4PV7A 4BYGA 1BOOA 3HXQA 2DUNA 1IVYA 4YXWA 1MX9A 5A7FA 4DLPA 2P9YA 4YT2A 2GPTA 1RM4A 5I7FA 2W48A 3AI2A 1KI6A 3HA2A 4ZYXA 1BN6A 3QBTA 4PZAA 4BMXA 1UFRA 1W0CA 2JK0A 1LTKA 2YY6A 1DAFA 1JA9A 3ICOA 3L8HA 4J91A 4ARAA 4YPOA 4UVGA 4NI5A 1DKOA 2A0XA 1EE2A 2ZG6A 3G9XA 4B3CA 2B30A 4I4IA 2PMCA 3OQBA 3D1JA 1UOEA 1G19A 1ZVQA 4QWWA 1G6HA 1R37A 2QSJA 3DAFA 2XJ9A 1L2TA 3TZHA 5FV4A 3NBMA 2I1VB 4YIKA 3MTEA 3TN7A 2XODA 3V4OA 1NVVR 4ZAGA 2BEVB 4QNMA 3WKAA 4ZTUB 1X3SA 3D7NA 3PGA1 3HWX1 3L77A 4LBVA 3LC7O 4QUIA 4GYKA 2DFLA 2JKVA 3BRSA 1PSDA 4QUJA 2X8BA 5FCDA 2WQZA 1F5SA 4MVJE 4N0QA 4RF2A 4RV9A 1PR5A 3MWEB 2B98A 4HQLA 4BPBA 5FBQB 2QY9A 3IQWA 5DNUA 2B4TO 3DUFA 4KNVA 4P4TA 2C5GA 3DKPA 1QQTA 4D96A 2C2WA 1PZEA 1G8MA 4DC3A 3TQIA 1S2GA 1L4GA 5CG2A 1EP3B 1NXXA 4BNKA 1Z7YA 4PE5B 3RNLA 4F45A 1W87A 3LCUA 3DOIA 3O38A 3GPDG 4I2NA 4TQGA 2QG4A 4AG5A 2VH1A 3MSCA 2DWCA 4HNAA 3A4YA 5FBRB 1REQB 2G6BA 3EIWA 3FW1A 4PLGA 4F97A 1GEGA 1YR8A 2BI8A 4UXIA 3MJFA 2IKQA 1FP4B 2RGAA 4PRZA 4Z9BA 1YDWA 4I9GA 3G59A 3U0VA 4I4TA 1J42A 1KBZA 4MQEA 4NQRA 4JXKA 1GGVA 3M89A 1RHUA 3ZWPA 4E3AA 3AETA 1KYTA 3M4ZA 1OFUX 1UT8A 2K7ZA 1IN1A 3GBVA 1YA4A 4XB1A 4MQUA 2JEYA 4UHDA 2OP1A 4Q3NA 4Q9HA 3CVVA 4EYKA 5D1NA 1NXTA 3TLJA 3TEMA 1X80B 4D79A 3A1SA 2JLQA 3IP9A 2XUOA 1GLNA 2EBFX 4JYAB 3WOHA 2O8EB 1C3EA 3G8CA 4IRXA 3UJ8A 3RIMA 2O1WA 3GI1A 5G3YA 1BCRA 1CVRA 3D3KA 4O4JB 4XQ9A 4EJSB 1O95C 1QVVA 1R9NA 1I30A 1QDEA 2BD0A 3QP9A 1KE2A 5IDXA 2FI1A 4RJIA 3DMGA 4LZLA 4V39A 3QVSA 4N54A 1EHCA 5AXAA 1J2TA 4MVJG 2Q5QA 3F7NA 3KVRA 1S1MA 2LUOA 4FE4A 2YWFA 2ARKA 3L7BA 1KZGB 3X1YA 1RLOA 5BYKA 5EJAA 4HVTA 2BZ0A 4B09A 3BGWA 3EZ7A 4ZJYA 2XQGA 2BM9A 5EZ6B 4FOPA 1NPYA 1R1DA 2X40A 5JD6A 2XEXA 2BL4A 2PZJA 2YYAA 4XFKA 5DM2A 3VPHA 5L7TA 2HMWA 5C1DA 2D1FA 3FWKA 4A1FA 2JCVA 5DT2A 4MKZA 2QD3A 2YVUA 1D6MA 3BMOB 1P5RA 4LRSB 4E4RA 3PCXA 3HPQA 3VQTA 1IK4A 1RXIA 5D3QA 4QPNA 1RIFA 1ZHHA 4JASB 1EJBA 3P97A 3HXOA 3TSCA 5LLDA 1IJEA 1TI7A 4RYLA 1GCGA 5AK4A 3M3PA 2SICE 2RH8A 5J2UF 3PJRA 5AI5A 3RARA 1TO6A 1Q1BA 4C0XA 1ISIA 4ESEA 1WQ1R 4ZU1X 3U17A 5AHOA 1RYHA 2R79A 1L4HA 2FPXA 1G4HA 1JDZA 1S02A 5LP6F 1Q74A 1TYEB 1F12A 1A9YA 2R4QA 1GP2A 1U8UA 2C2YA 4EGSA 2VNKA 3VYRB 2XMZA 1D2NA 4M86A 5SICE 3WA7A 2BBOA 1YJ5A 3EQ9A 4JCOA 3FJ1A 4QXRA 2Y92A 4EPRA 3THWA 2UUBB 3CNQS 4WEQA 2Z5FA 2Y1WA 3IDQA 3NKFA 3PC7A 3ZD6A 1IZ8A 4KIGA 4F06A 1KSFX 2Q3JA 3FOZA 2F55A 2WD7B 1S2IA 2C00A 4F1KA 3QQ5A 2R7LA 1OWLA 2I2BA 2OZPA 2WM9B 1A5AB 1WULS 3HKDB 2R9VA 3H1PA 3IAAA 4OREX 4WLNA 1CUHA 2ATCA 2F4NA 2NZYA 3CURA 8AT1A 4R9SA 4CKCB 1VJ5A 2OUKA 2H9AA 1RHRA 1WZNA 2AEMA 2WUWE 1A3CA 3HVKA 1KDVA 3BWBA 3FROA 4G6ZA 3S29A 5KOJA 1EWKA 1Q0QA 4W7HA 5C81A 1TTHA 2XUJA 1BX4A 4OFBA 1F14A 4GBJA 5AJYA 2V6GA 3NW9A 3P8ZA 3ZU6A 3CEMA 1XNGA 4UHHA 1ZUNB 1GM5A 1DFGA 3KNZA 4UUBA 4DQ0A 3KD6A 2X13A 2HI0A 4UVEA 2GJ8A 4CM8B 5AO9A 3F96A 1VJGA 1KWKA 3J80A 2PA3A 3BERA 4FFWA 3RUHA 5JRDS 2FUEA 3C74A 3JQRA 1XVUA 3AVXA 1CUWA 1X1QA 2K2WA 1WF6A 1BO6A 1HYHA 3DLTA 4H6XA 4OQEA 4XZ3A 4GMKA 4E2FA 5C7IO 2XOXA 3STHA 3TL2A 1WSWA 3ZX5A 2R00A 1Z35A 2AN9A 4RULA 1XMSA 2DUWA 4QPPA 1RWWA 3W8DA 1E89A 1EHYA 2AMFA 1QB8A 1SY7A 1E9VA 2C8JA 4JYMA 3VYTB 2IXAA 4B6FA 4DG5A 2O52A 5TMDA 4F6CA 4UXHA 1W581 5EIBC 5IUJC 3JR7A 3A4NA 4Q9AA 4IYJA 1N33B 4IQGA 1Z7WA 3HN6A 4NCKA 3N58A 1BKSB 4YJFB 3RU9A 3SNHA 4G26A 1H8HA 1Q1GA 2OKGA 1X1SA 4X61A 2C8LA 1DIGA 2XUAA 4NEHB 2YVQA 5ALDA 5KNBH 5J23A 3ZVKA 1PWHA 2G8NA 1FTNA 1WBJB 3I9V6 4FILA 2ZI3A 3DBRB 1NM5C 2WA1A 3P2KA 3G0DA 1FNBA 1EJ6A 2RKBA 2V7BA 4HB3A 4Q0MA 4E88A 4IWXA 4UMVA 5CAEA 3U4AA 5KZMB 4RCVA 1NG9A 2RH9B 3GVCA 1LSSA 1CLEA 3JVUA 1VLQA 3HJNA 5FPTA 4AY4A 4H9GA 3EZNA 3NALA 4YRTA 1KOFA 3AJEA 3TOVA 3OPXA 1AH2A 4C13A 2FP3A 3S1AA 4RQBA 1EVIA 2QGZA 5CDTA 4EGAA 1MOZA 2DZDA 4U3JA 1QWSA 1QC5A 5T4HA 2TSYB 1QUEA 1K6MA 2P3LA 1C0IA 2ZUCA 3KM0A 1KVUA 3NBXX 4HAZA 4DHEA 3W8RA 1WTAA 1GSHA 3FVTA 4KGVA 4G37A 4QO7A 3RHZA 1CEXA 3KSUA 4UM9B 4KADA 1B26A 2P79A 4OSPA 3U7JA 3EGXB 1MHTA 1KRXA 4FQ5A 4LVNA 4X44A 4U9HS 1ZQ1A 3G89A 4FBGA 5DNVA 1Z6GA 1ZIYA 1Y7HA 5F35A 3FPFA 4LNUA 4Y6QA 1K6JA 4EVQA 3BD9A 1RMTA 5CNJA 3WK7A 5C40A 1DAHA 2NZWA 3FCYA 2CE2X 2GNOA 2B34A 5I4KA 1MB4A 1MA3A 5JSUA 2O8BA 4AD8A 1WUHS 2Y0CA 5CFMA 1XQ9A 5SZKB 4YRMA 1JMVA 2JAUA 3H8SA 2OBYA 4XR9A 2PIDA 3MB5A 3TGWA 5M34A 3QSGA 1MO4A 2CNWA 2I3DA 2BC9A 1QTIA 3D59A 1D07A 2W11A 3QG5A 4O2AB 4TT3D 1DIRA 1U0EA 1D1TA 2W6PA 3CZ4A 3LBHA 3VTZA 3TD6A 3LX5A 4BFCA 1KH2A 1QIGA 3EWAA 4HZUB 4LSMA 1G6Q1 1VSTA 4FFLA 4YR7A 2G70A 1KH1A 1P4SA 2XI4A 5TV2A 4WXYB 4ENWA 1HDEA 4NZYA 1CDEA 2O7VA 3TOZA 3PIIA 2Q1TA 5L3SB 1IQ0A 1HORA 4EMSA 4JBYA 1ZRNA 1ZR2A 2VHYA 5JJCA 2RONA 4Z4CA 2C2OA 3T1HB 2FG7C 2WI8A 1G5RA 2V4MA 4GZ6A 3P9KA 3ZC3A 3MN1A 4WLOA 1N5MA 5DEIA 3ZY4A 4YBRA 4AG3A 4X41A 1WVIA 4ZHQF 4ZJUA 2VP9A 3G7UA 4S3MA 1B42A 1FX0B 2PWBA 1E2IA 1HDRA 1PFWA 1Z82A 4BGEA 4TYNA 3B60A 4HH3C 1YE5A 3HDTA 3W5UA 1U9YA 1IQUA 4QOEA 3W9YA 3CZ9A 1VK4A 3RQ6A 2HY7A 3O83A 4O4IF 1TX4B 3Q7SA 3MRVA 4OGLA 1W1WA 2P68A 4FYVA 4UUPA 1YACA 4DBVO 1Z0AA 3K1JA 4F8JA 3GLVA 3K9EA 4ZI7F 1A9ZA 2W9XA 4KK3A 5ERXA 3FCAA 1USIA 2J0SA 2C9BA 1GYQA 3KZOA 3H1GA 2YINC 1G17A 2GZ3A 1G60A 3V9AA 4G0MA 2DG2A 2A5FA 4RDIA 4ZC8A 3DM9B 4B4DA 1R74A 3AEQA 4PSKA 1YGJA 1FF9A 2YDXA 5CYOA 4AICA 2ISQA 3ORFA 4HDNB 8ADHA 3UK0A 2HAEA 2YASA 5BSHA 2J6CA 3GLIE 1QLWA 1XEXB 4DKJA 2CLHB 3D4OA 1DWPA 2HBYA 4MYCA 3GH3A 1MH9A 5IDYA 3EVFA 1R9GA 4ZD6A 3U7QA 2A5GA 3W6UA 1HT3A 1JFTA 2XV1A 2Y67A 2XA2A 5T4BA 1H6BA 2FVXA 4M21A 4J2HA 5IC4A 4EL5A 3BMNA 1ABBA 3VOTA 1E4VA 1FRNA 1LJ8A 1HKHA 3OEEA 2XW6A 1V5EA 3C7KA 2J08A 4Q3EA 3TIIA 4C78A 3PWKA 1J24A 1DINA 1QYRA 3UENA 2IBTA 5A3JA 4Z4QA 1YUNA 3EOAI 1U11A 4LJAA 2AN4A 3FTPA 3DFKA 5KPDA 1R4NB 1QE0A 3BRQA 5C4GB 3V7UA 2TYSB 1VZ3A 3DEFA 4CXMA 5HPYB 4I66A 2VQEB 2AKYA 5KINB 4DV7B 3IQXA 2JLBA 2XOEA 5FL7A 4IJVA 3WLIA 2A1IA 4P7FA 1J8QA 1ND6A 1QU2A 2ZE8A 2RDMA 3TZKA 2X7HA 2I22A 4JAVC 4U7HA 2I2WA 4HQOA 5J2TF 4H59A 5HF5A 2BFCB 3BZWA 4K8CA 1LBSA 5BQPA 1GA6A 2JFZA 5I5GA 3AU9A 3KJNA 4PLWA 5KWEA 4UREA 1IY8A 4MS4B 2H1OA 1BA3A 1GG9A 3GA7A 3OT4A 4RTJA 5FHRA 3H0CA 3WTBA 2HC9A 5CEEA 3DEJA 1UFVA 4FYHA 2O3SA 3PV0A 4N03A 3K1YA 1PTJA 5KKNB 1P7CA 4ZTBA 3SYKA 5E7IA 1XPRA 3JY6A 1RCFA 3GFVA 3ROQA 4CODB 5ER6A 1F2UB 3FOBA 5HTOA 1E94E 3T94A 1W5TA 4QSHA 4R7TA 1Z29A 2RGNC 2C59A 3KUXA 3QY9A 5CFNA 1Z62A 4D9CA 5AOAA 4X94A 5TX7A 4CL2A 1PYOA 2ZE5A 4RKRA 4MR8B 3RQHA 1J0BA 3KTOA 4GR5A 4TKVB 4UEKA 4W9RA 4PG8A 4UEWA 1JPNA 4OHCA 4XYEA 1FFGA 2DMRA 4HS9A 4BC0A 1PV2A 4GLJA 4OQPA 1VG8A 2DT5A 3C3CA 4Z7JA 2BTQA 1J1ZA 1EK2A 3E9NA 2ZRJA 1RRGA 1U2GC 3FTCA 4FDMA 1JBWA 2WC1A 1QRTA 1YRBA 2ZOSA 2NWHA 1QOZA 2OXRA 3FDJA 2MTBA 4MO9A 4JGBA 2WU8A 3O4GA 2YW2A 1TKRA 3FPBA 4LGVA 3RIXA 4GT1A 2X4DA 3OPYI 3M2PA 1V9CA 1KIAA 2ALJA 2WP0A 4P7KA 4PONA 2Q50A 2PTHA 3IXMA 1GPLA 4MUHA 1Y8ZA 2ACVA 5JCOA 1SQSA 2GFQA 2JD1A 2RG1A 2ZYWX 2BGNA 5JVDB 5ADVA 2GEBA 1Z17A 4PNZA 2V7UA 1FBTA 4RFSB 4PC3A 1IZ7A 1IG0A 2A5YB 1CJCA 2B21A 2I6TA 3L5OA 4XUCA 2AFVA 3ADPA 3L8MA 1CRQA 2NW6A 3R0IA 2DQKA 4QQFA 1V45E 1HDZA 2OGTA 4YAEA 5LL6P 3K2BA 1UT6A 3LUHA 4MWOA 4YRSA 1O97D 3GJ0A 1R0SA 2VDOB 4FBLA 1G2OA 1Q15A 2OMKA 1XWFA 3FFBA 1WW8A 2ZUSA 3LNCA 4N5IX 4PM4A 4BTEA 4IMJB 1XLWA 4DVJA 5HZHA 4LHWA 1G8AA 3VTKA 1CUJA 3AFNA 3GEHA 2IV7A 4FCCA 3QPCA 4S05A 1YQQA 3ROMA 1BCSB 4MQLA 1E99A 1FP1D 2DHDA 2Z5VA 3GRCA 3NGXA 4TLCA 4YP5A 3BXZA 5HS6A 3O8CA 2OORA 3OT1A 1JQJC 1RKXA 4PIMA 3TLGB 2CCKA 4E7PA 3N2ZB 4KH0A 1RRFA 2O6HA 4LYHA 5CRIA 3RANA 2ERXA 3T3GA 4ESHA 3ZI4A 3GLGA 1HA3A 3F6YA 3IHLA 3NDPA 2GHTA 4XVUA 2SECE 1IY0A 4JSYA 1OLXA 5CDFE 2OPHA 1PT8A 1K1EA 2IZOA 2ONKA 2QQ0A 1A4UA 2JHFA 1NBMD 2DWPA 3ONEA 1EE9A 4MXDA 2V9PA 2YY7A 1JDPA 4PWYA 4UHFA 2GMWA 2QYOA 3ELUA 4NIMA 4M53A 2WUFA 3RH0A 1UPUA 5IBRA 4EQ6B 2WG1A 5LZ8A 4BE4A 3D9QX 2DB3A 3BBPA 3WNVA 1GTRA 1Z2OX 2H2DA 3QIVA 3FG9A 3I04M 4R1UA 2ZJ5A 2XKAA 1KDYA 2EKDA 4D2IA 4JV5B 3HFRA 4WKGA 5DSXA 3K6JA 2ZWPA 5BYFA 2C2HA 3I6BA 1LSOA 1DXHA 2GRAA 3AB3A 1T91A 3L0IB 4LJ9A 3MHTA 1MAWA 3EMKA 4YQZA 4HADA 2Q8PA 4PZ9A 1MV8A 4XIGS 2G09A 3NHWA 4ER5A 1J5XA 2PE5A 1Z56C 2FPKA 4MQ6A 4BV8A 4DZTA 4EKIA 3PHJA 3LT2A 1NKSA 2JFVA 2FDCA 1XZMA 2JIQA 2ZIAA 4RA6A 2J5BA 3FTEA 3WQHA 2V78A 1AUQA 4MV5A 1TA9A 4MWSA 5LXTB 5FOTA 2Q7DA 3VMFA 1GVHA 2C7OA 1NBIA 5E6SB 2HLNA 4BB9A 1MJNA 1C14A 1JG2A 4MIEA 2H0AA 5FIUA 1TYAE 2RI1A 2ZSUA 4YJ3B 2DSTA 2ZWAA 5K0EA 3IJPA 1VP9A 2FNAA 1Z5PA 2W2NA 1T1IA 2CW5A 3KHKA 5LBIA 1W5FA 3BXOA 4B81A 5KYKA 4R2IA 2JGMA 2ZT7A 1U8CB 3MZ0A 4KITB 2VF8A 5J47A 3WGIA 4MKRA 4OK3A 2GJKA 4RZXA 5CLGA 4U7TB 5TQ2A 2VARA 2G5TA 3DMPA 1D0IA 1X7GA 1U65A 1N8TA 2ZYHA 3KJZA 4N7MA 2VYNA 3IQDB 4LY6A 5C8VA 1P91A 4O6VA 5KAMA 2OV3A 4G0OA 4JCCA 4FX2A 4M99A 4OXQA 5CA0A 4F38A 2ZITA 1IXSB 3QKTA 3WXBA 4WJLA 5B7PA 2Z6UA 2FZEA 2Y0DA 3FYTA 2YWBA 4EHKA 2A94A 4LY0A 5E7MA 4YY3B 2R8RA 4FE7A 1U9ZA