1VQOH

The structure of ccpmn bound to the large ribosomal subunit haloarcula marismortui
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
171
structure length
160
Chain Sequence
b'KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIDSSPAGNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 39
structure length 160
sequence length 171
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 1vqoH00
3CC4H 1YJNH 1VQPH 1YJWH 1K73J 3G6EH 2OTLH 1VQMH 3CC7H 3DLLJ 3CPWH 3CCVH 3PIOJ 1KC8J 1Q82J 2ZJPJ 1K8AJ 5GAHN 5DM7J 4WF9J 2ZJQJ 4UY8M 5AN9F 1M90J 4WFAJ 1N8RJ 2QEXH 3CCSH 3CCLH 5GAEN 5JVGJ 3G71H 4WFNJ 3CCMH 5JVHJ 3CC2H 3OW2H 1VQ9H 1YIJH 2ZJRJ 1VQ7H 3CCEH 3CXCH 1YITH 2PA2A 3PIPJ 1YJ9H 1KD1J 3CF5J 1NJIJ 4IO9J 3CCJH 4IOAJ 1W2BH 5GADN 1YI2H 1VQ5H 1VQNH 5MLCO 3CD6H 2QA4H 1VQ4H 1WKIA 3G4SH 1Q86J 1QVGH 5H1SO 4WCEJ 1Q7YJ 3J7ZM 4WFBJ 1VQOH 1K9MJ 3I55H 1QVFH 3CCUH 1VQKH 3CCQH 1Q81J 4U67J 1VQLH 5DM6J 1S72H 5GAGN 3CMAH 1JJ2H 2OTJH 1KQSH 3CMEH 3I56H 1M1KJ 3CCRH 1YHQH 5HL7J 1VQ8H 1Y69K 4IOCJ 1VQ6H
chains in the Genus database with same CATH superfamily
4I9AA 2I1OA 3C2EA 1YTEA 3CC4H 4USAA 1VQPH 3SR6C 3C2VA 1YJWH 1K73J 1QPRA 3NVWC 3NVYC 3G6EH 2OTLH 1VQMH 3CC7H 3DLLJ 3CPWH 4AP8A 3CCVH 4YYYA 3PIOJ 1SB3A 3BIIE 1KC8J 2Q5WE 1Q82J 4EADA 3L4PA 2ZJPJ 5EP8A 1RM6A 1K8AJ 4LHMA 5GAHN 5AYZA 5DM7J 2QIEA 2JBMA 3C2OA 4WF9J 2B7NA 2W3SB 1N5XA 2ZJQJ 5HULA 4UY8M 5AN9F 1M90J 1N63B 2B7QA 3ETRC 4WFAJ 1O4UA 2QEXH 1N8RJ 4GA5A 3CCSH 3CCLH 4KWWA 5GAEN 2B7PA 5JVGJ 3EUB4 5EY3A 3G71H 3NVZC 4WFNJ 2W3RB 3CCMH 1YTKA 5JVHJ 3AN1A 4IOCJ 1FFVB 3CC2H 1V97A 3L0GA 1N61B 3OW2H 1VQ9H 3FAHA 1YIJH 5MPOC 2ZJRJ 1JRPB 3NRZC 1VQ7H 2I14A 3CCEH 3CXCH 3B9JC 1FFUB 1YITH 2PA2A 4GA4A 3PIPJ 1YJ9H 1KD1J 3CF5J 1FM0E 1NVJA 1YTDA 1NVIE 1NJIJ 3NVVC 4IO9J 1DGJA 2W54B 3CCJH 4IOAJ 1BRWA 1N62B 3C2RA 5GADN 1YI2H 1W2BH 1VQ5H 3FC4A 1VQNH 5MLCO 3CD6H 3C2FA 2QA4H 1N60B 1N5WB 3AMZA 2E3TA 1VQ4H 3TQVA 1WKIA 1WYGA 4XR5A 3G4SH 4US8A 1Q86J 2WP4A 1QVGH 4X46A 5H1SO 3NS1C 4WCEJ 4ZOHA 1Q7YJ 3GNNA 3AM9A 4WFBJ 2TPTA 3J7ZM 1VQOH 1FIQC 1K9MJ 1Y69K 1ZXIB 1AZYA 4GA6A 3RPFA 2DSJA 2WK6A 3I55H 1UOUA 1QVFH 1QAPA 3CCUH 1QPOA 1VQKH 2W55B 3CCQH 1Q81J 4U67J 1VQLH 5DM6J 1VLBA 3H5QA 3WO0A 1S72H 1QPQA 1FO4A 1QPNA 3WNZA 5GAGN 3CMAH 1JJ2H 2J0FA 1VDVA 4KWVA 2OTJH 1X1OA 1JROB 1KQSH 5AYYA 3CMEH 3PAJA 4C7ZA 5HUOA 3VMMA 4C80A 1FMAE 3I56H 3CCRH 1M1KJ 1SIJA 4EAFA 2WK5A 4YEKA 5HUPA 4C7YA 1YHQH 5HL7J 1VQ8H 3WO1A 1OTPA 5AYXA 1YJNH 4US9A 2OMDA 1VQ6H
chains in the Genus database with same CATH topology
3CC4H 1YJNH 1VQPH 1YJWH 1K73J 3G6EH 2OTLH 1VQMH 3CC7H 3DLLJ 3CPWH 3CCVH 3PIOJ 1KC8J 1Q82J 2ZJPJ 1K8AJ 5GAHN 5DM7J 4WF9J 2ZJQJ 4UY8M 5AN9F 1M90J 4WFAJ 1N8RJ 2QEXH 3CCSH 3CCLH 5GAEN 5JVGJ 3G71H 4WFNJ 3CCMH 5JVHJ 3CC2H 3OW2H 1VQ9H 1YIJH 2ZJRJ 1VQ7H 3CCEH 3CXCH 1YITH 2PA2A 3PIPJ 1YJ9H 1KD1J 3CF5J 1NJIJ 4IO9J 3CCJH 4IOAJ 1W2BH 5GADN 1YI2H 1VQ5H 1VQNH 5MLCO 3CD6H 2QA4H 1VQ4H 1WKIA 3G4SH 1Q86J 1QVGH 5H1SO 4WCEJ 1Q7YJ 3J7ZM 4WFBJ 1VQOH 1K9MJ 3I55H 1QVFH 3CCUH 1VQKH 3CCQH 1Q81J 4U67J 1VQLH 5DM6J 1S72H 5GAGN 3CMAH 1JJ2H 2OTJH 1KQSH 3CMEH 3I56H 1M1KJ 3CCRH 1YHQH 5HL7J 1VQ8H 1Y69K 4IOCJ 1VQ6H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC4 H;  1YJN H;  1VQP H;  1YJW H;  1K73 J;  3G6E H;  2OTL H;  1VQM H;  3CC7 H;  3DLL J;  3CPW H;  3CCV H;  3PIO J;  1KC8 J;  1Q82 J;  2ZJP J;  1K8A J;  5GAH N;  5DM7 J;  4WF9 J;  2ZJQ J;  4UY8 M;  5AN9 F;  1M90 J;  4WFA J;  1N8R J;  2QEX H;  3CCS H;  3CCL H;  5GAE N;  5JVG J;  3G71 H;  4WFN J;  3CCM H;  5JVH J;  3CC2 H;  3OW2 H;  1VQ9 H;  1YIJ H;  2ZJR J;  1VQ7 H;  3CCE H;  3CXC H;  1YIT H;  2PA2 A;  3PIP J;  1YJ9 H;  1KD1 J;  3CF5 J;  1NJI J;  4IO9 J;  3CCJ H;  4IOA J;  1W2B H;  5GAD N;  1YI2 H;  1VQ5 H;  1VQN H;  5MLC O;  3CD6 H;  2QA4 H;  1VQ4 H;  1WKI A;  3G4S H;  1Q86 J;  1QVG H;  5H1S O;  4WCE J;  1Q7Y J;  3J7Z M;  4WFB J;  1VQO H;  1K9M J;  3I55 H;  1QVF H;  3CCU H;  1VQK H;  3CCQ H;  1Q81 J;  4U67 J;  1VQL H;  5DM6 J;  1S72 H;  5GAG N;  3CMA H;  1JJ2 H;  2OTJ H;  1KQS H;  3CME H;  3I56 H;  1M1K J;  3CCR H;  1YHQ H;  5HL7 J;  1VQ8 H;  1Y69 K;  4IOC J;  1VQ6 H; 
#chains in the Genus database with same CATH topology
 4I9A A;  2I1O A;  3C2E A;  1YTE A;  3CC4 H;  4USA A;  1VQP H;  3SR6 C;  3C2V A;  1YJW H;  1K73 J;  1QPR A;  3NVW C;  3NVY C;  3G6E H;  2OTL H;  1VQM H;  3CC7 H;  3DLL J;  3CPW H;  4AP8 A;  3CCV H;  4YYY A;  3PIO J;  1SB3 A;  3BII E;  1KC8 J;  2Q5W E;  1Q82 J;  4EAD A;  3L4P A;  2ZJP J;  5EP8 A;  1RM6 A;  1K8A J;  4LHM A;  5GAH N;  5AYZ A;  5DM7 J;  2QIE A;  2JBM A;  3C2O A;  4WF9 J;  2B7N A;  2W3S B;  1N5X A;  2ZJQ J;  5HUL A;  4UY8 M;  5AN9 F;  1M90 J;  1N63 B;  2B7Q A;  3ETR C;  4WFA J;  1O4U A;  2QEX H;  1N8R J;  4GA5 A;  3CCS H;  3CCL H;  4KWW A;  5GAE N;  2B7P A;  5JVG J;  3EUB 4;  5EY3 A;  3G71 H;  3NVZ C;  4WFN J;  2W3R B;  3CCM H;  1YTK A;  5JVH J;  3AN1 A;  4IOC J;  1FFV B;  3CC2 H;  1V97 A;  3L0G A;  1N61 B;  3OW2 H;  1VQ9 H;  3FAH A;  1YIJ H;  5MPO C;  2ZJR J;  1JRP B;  3NRZ C;  1VQ7 H;  2I14 A;  3CCE H;  3CXC H;  3B9J C;  1FFU B;  1YIT H;  2PA2 A;  4GA4 A;  3PIP J;  1YJ9 H;  1KD1 J;  3CF5 J;  1FM0 E;  1NVJ A;  1YTD A;  1NVI E;  1NJI J;  3NVV C;  4IO9 J;  1DGJ A;  2W54 B;  3CCJ H;  4IOA J;  1BRW A;  1N62 B;  3C2R A;  5GAD N;  1YI2 H;  1W2B H;  1VQ5 H;  3FC4 A;  1VQN H;  5MLC O;  3CD6 H;  3C2F A;  2QA4 H;  1N60 B;  1N5W B;  3AMZ A;  2E3T A;  1VQ4 H;  3TQV A;  1WKI A;  1WYG A;  4XR5 A;  3G4S H;  4US8 A;  1Q86 J;  2WP4 A;  1QVG H;  4X46 A;  5H1S O;  3NS1 C;  4WCE J;  4ZOH A;  1Q7Y J;  3GNN A;  3AM9 A;  4WFB J;  2TPT A;  3J7Z M;  1VQO H;  1FIQ C;  1K9M J;  1Y69 K;  1ZXI B;  1AZY A;  4GA6 A;  3RPF A;  2DSJ A;  2WK6 A;  3I55 H;  1UOU A;  1QVF H;  1QAP A;  3CCU H;  1QPO A;  1VQK H;  2W55 B;  3CCQ H;  1Q81 J;  4U67 J;  1VQL H;  5DM6 J;  1VLB A;  3H5Q A;  3WO0 A;  1S72 H;  1QPQ A;  1FO4 A;  1QPN A;  3WNZ A;  5GAG N;  3CMA H;  1JJ2 H;  2J0F A;  1VDV A;  4KWV A;  2OTJ H;  1X1O A;  1JRO B;  1KQS H;  5AYY A;  3CME H;  3PAJ A;  4C7Z A;  5HUO A;  3VMM A;  4C80 A;  1FMA E;  3I56 H;  3CCR H;  1M1K J;  1SIJ A;  4EAF A;  2WK5 A;  4YEK A;  5HUP A;  4C7Y A;  1YHQ H;  5HL7 J;  1VQ8 H;  3WO1 A;  1OTP A;  5AYX A;  1YJN H;  4US9 A;  2OMD A;  1VQ6 H; 
#chains in the Genus database with same CATH homology
 3CC4 H;  1YJN H;  1VQP H;  1YJW H;  1K73 J;  3G6E H;  2OTL H;  1VQM H;  3CC7 H;  3DLL J;  3CPW H;  3CCV H;  3PIO J;  1KC8 J;  1Q82 J;  2ZJP J;  1K8A J;  5GAH N;  5DM7 J;  4WF9 J;  2ZJQ J;  4UY8 M;  5AN9 F;  1M90 J;  4WFA J;  1N8R J;  2QEX H;  3CCS H;  3CCL H;  5GAE N;  5JVG J;  3G71 H;  4WFN J;  3CCM H;  5JVH J;  3CC2 H;  3OW2 H;  1VQ9 H;  1YIJ H;  2ZJR J;  1VQ7 H;  3CCE H;  3CXC H;  1YIT H;  2PA2 A;  3PIP J;  1YJ9 H;  1KD1 J;  3CF5 J;  1NJI J;  4IO9 J;  3CCJ H;  4IOA J;  1W2B H;  5GAD N;  1YI2 H;  1VQ5 H;  1VQN H;  5MLC O;  3CD6 H;  2QA4 H;  1VQ4 H;  1WKI A;  3G4S H;  1Q86 J;  1QVG H;  5H1S O;  4WCE J;  1Q7Y J;  3J7Z M;  4WFB J;  1VQO H;  1K9M J;  3I55 H;  1QVF H;  3CCU H;  1VQK H;  3CCQ H;  1Q81 J;  4U67 J;  1VQL H;  5DM6 J;  1S72 H;  5GAG N;  3CMA H;  1JJ2 H;  2OTJ H;  1KQS H;  3CME H;  3I56 H;  1M1K J;  3CCR H;  1YHQ H;  5HL7 J;  1VQ8 H;  1Y69 K;  4IOC J;  1VQ6 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...