5HUOA

Crystal structure of nadc deletion mutant in c2221 space group
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
283
structure length
283
Chain Sequence
TDLTPFQIDDTLKAALREDVHSEDYSTNAIFDHHGQAKVSLFAKEAGVLAGLTVFQRVFTLFDEVTFQNPHQFKDGDRLTSGDLVLEIIGSVRSLLTCERVALNFLQHLSGIASMTAAYVEALGDDRIKVFDTRKTTPNLRLFEKYAVRVGGGYNHRFNLSDAIMLKDNHIAAVGSVQKAIAQARAYAPFVKMVEVEVESLAAAEEAAAAGVDIIMLDNMSLEQIEQAITLIAGRSRIECSGNIDMTTISRFRGLAIDYVSSGSLTHSAKSLDFSMKGLTYLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nicotinate-nucleotide diphosphorylase (Carboxylating)
publication title Streptococcus pyogenes quinolinate-salvage pathway-structural and functional studies of quinolinate phosphoribosyl transferase and NH3 -dependent NAD(+) synthetase.
pubmed doi rcsb
source organism Streptococcus pyogenes ga06023
molecule tags Transferase
total genus 90
structure length 283
sequence length 283
chains with identical sequence B, C, E, F, H
ec nomenclature ec 2.4.2.19: Nicotinate-nucleotide diphosphorylase (carboxylating).
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01729 QRPTase_C Quinolinate phosphoribosyl transferase, C-terminal domain
A PF02749 QRPTase_N Quinolinate phosphoribosyl transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5huoA02
3.90.1170.20 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Quinolinate phosphoribosyl transferase, N-terminal domain 5huoA01
5D30A 3PR2A 4FF7A 4IPIA 5C54A 3PAJA 4Y8FA 2J9YA 3RF9A 3GDMA 3W74A 3DHDA 2ZZ1A 3GNDA 3L0GA 4XTDA 2ZTKA 3KVKA 3W22A 3NPUA 4UTWA 3MP3A 3W9ZA 4O53A 2EKCA 1WDWA 2KZHA 3OVQA 5DBTA 5I3FA 1C9DA 3FS2A 3LB0A 1KM3A 3LV5A 1GVFA 3IRDA 4Z1DA 1F74A 3PBYA 4LW7A 1B4KA 3WK2A 3KFTA 5TQLA 3ZS4A 5EPDA 2JK2A 1EP3A 2J24A 4ZZ9A 1TREA 4WXYA 2CLFA 5HMSA 4AHPA 1KFKA 3I7QA 3W23A 1O94A 1SFJA 3Q37A 1SZNA 2LLEA 4UTKA 1G67A 4HIBA 1W54A 3NQ7A 1W31A 3TFXA 2Z0IA 4NXKA 4C1LA 4DQWA 1UB3A 5F2MA 1TJPA 3O15A 2BSLA 3GDKA 2ABAA 1LP6A 5EA9A 1C8VA 2Y61A 1GT8A 3QPYA 3UWQA 4K8HA 3C2RA 4IXHA 4MOZA 1WXJA 1R47A 4JTUA 2NXIA 2OT1A 2WO5A 1F76A 3ZR4A 1JJKA 2RKXA 7TIMA 1VCVA 4UTWC 5AYYA 4ZQOA 3G22A 3AO0A 4JY8A 1GVSA 3ABSA 3PC0A 2RDWA 3O05A 3PG8A 4XUGA 4JN6A 5DY2A 2ZYFA 2ZRWA 3UWZA 5L9FA 5I3IA 1TV8A 2V0TA 1EUNA 1ME7A 4KKXA 1LROA 2CLMA 1KM1A 2FQIA 3M6YA 4GUJA 1SW0A 3WK0A 2A5HA 2A7RA 4UR8A 5GVJA 3TU9A 3BLEA 4UMCA 3I7SA 3CWOX 4TR9A 3DFOA 2Y6ZA 3ABRA 4NJJA 5D2YA 1AW5A 1R2SA 3CC1A 4JTIA 3BG3A 1GWJA 4IX0A 3PBUA 2GJLA 2ZA2A 1AL7A 1M7OA 2ZZ4A 1YADA 3R13A 3QSRA 3TAKA 4DF0A 5BMWA 1S5WA 3TSBA 1Z41A 1FWWA 4NNAA 4MZ8A 4NZFA 1KFBA 5D2VA 4RK8A 3UXAA 2A7NA 3L5AA 4LVBA 3QMSA 1SO3A 3NL2A 5EMUA 4NJKA 1NFBA 3BPWA 3IEBA 3W7NA 3W7GA 3CIWA 4BK9A 3HPXA 1O95A 2FB2A 2QCGA 3W1AA 4Y6GA 1Z42A 5AYXA 1W5QA 2V2DA 4UC5A 4UTLA 2ZCGA 2WNQA 1LOLA 4HPXA 2V9DA 3L68A 3GR8A 4ZQPA 3YPIA 4BI5A 4GUGA 2PURA 1R46A 3PULA 5DXXA 2QF7A 1Q6LA 2ZZ3A 3P81A 5DELA 1TV7A 3I68A 4RXGA 3LGEA 4NZJA 3AJXA 4LS1A 3DKLA 1WV2A 1HO4A 3GDTA 3OEXA 3UWYA 3LCFA 1QPNA 4NU7A 5BW6A 1VQTA 2FTPA 4DBDA 4O14A 1EWEA 1OK6A 2H8ZA 5BNKA 5A5WA 3MMTA 1IIHA 1XXXA 2RFGA 2E5BA 5LNRA 3HG5A 1XFBA 2X1UA 2CW6A 1VJIA 3MUXA 4K37A 3TQVA 3DFQA 1R2RA 2GJNA 2NZLA 1CI1A 5FF0A 2UV8G 4O1DA 1JR1A 2VEMA 1NVMA 3W2NA 2H8XA 4ZQMA 3BW4A 2QCNA 2Y85A 1IIGA 3EX4A 3O16A 5E1QA 3NL5A 3FA5A 4JTKA 4PL2A 1UUMA 4O0ZA 4ICNA 4BI7A 1RQBA 2CZFA 3LDVA 4DPQA 1LLWA 1Q45A 1VZWA 3SW6A 3OBKA 2B7QA 3FKKA 4HN4A 3UY7A 4AB4A 5HWMA 1SPQA 3LHZA 5D02A 3C8FA 3QMTA 4W9TA 3MBFA 4OT7A 1VRDA 3DFSA 1IXPA 3NM1A 4ML9A 2WSQA 2ZRXA 6TIMA 3QM3A 2VOMA 3RU6A 3S1WA 5TIMA 3NOEA 4O12A 1XUUA 2OMAA 1MEIA 3F1QA 3W83A 3W1XA 3HG4A 3MJYA 2Z1BA 2HS8A 3S1VA 5FEZA 3TFCA 3DH7A 4MJMA 1K7EA 4HHPA 1YXCA 4MJZA 1SW7A 4LOCA 4WQ6A 4KWWA 1A5SA 3CEUA 2I14A 4UFMA 3SGUA 1DBTA 2QCMA 4UR7A 4MY9A 1N55A 4DO6A 3DENA 1F7BA 2W6RA 3MW7A 4O10A 5CSSA 2VFDA 1ZAHA 3S0CA 5L6UA 3M5YA 4A3UA 1T8XA 1WAUA 1G7UA 3GVGA 4O1AA 3D0CA 1LLZA 1H7NA 4TMBA 4AH7A 5A8GA 2C16A 1X1OA 1VYRA 4YMZA 4S2CA 3NL6A 4K38A 3P5YA 1BTMA 1OABA 3GAYA 4LVGA 1J5TA 4LVDA 4O50A 2V2CA 3SR7A 3HGJA 2NUXA 3NZ1A 5HR6A 2VEPA 4LC8A 3IIVA 1W3TA 2EF9A 1HL2A 3TK7A 1KM0A 1GQNA 1IXNA 4ORMA 5U4NA 3BGJA 1VLWA 3M16A 4Q4KA 3EWBX 1F05A 3LV6A 3BARA 2CLEA 3JRKA 4LVFA 3Q94A 2YX0A 4POCA 3W7JA 3CM4A 5CPNA 2X1RA 3CT7A 2WV8A 1JCLA 2V82A 4NNBA 3W2UA 5C2XA 3STFA 1S5TA 4Z0JA 4Z08A 4DXVA 2WNZA 2O7QA 3HGSA 3DFNA 1JRBA 4MZ1A 2VFIA 2C3ZA 5D03A 4XKYA 3UWVA 3QH2A 3N9RA 1D9EA 2TRSA 1L6YA 1QPQA 3BGGA 4JD4A 4MZYA 3P80A 3SY5A 5HUPA 1BWKA 1ZNNA 2Q8LA 3M41A 4QAIA 4WY0F 5ABTA 3LHTA 3QQ1A 8TIMA 4M6VA 4UTUA 1QWGA 2FPVA 3PSVA 3M44A 2RH9A 3NPXA 4JGDA 4DBEA 2A6NA 5AN7A 4O28A 2R91A 4ADUA 1A53A 3W88A 4QITA 4K7VA 4IMEA 4DO5A 4IUOA 5FF7A 2RHGA 2CLLA 4LS2A 5CGQA 1OX4A 3TCEA 5AHMA 3M5ZA 4O57A 1Q6RA 1VPXA 5DY3A 3EX6A 2QKFA 2VXNA 2I9EA 3GLCA 4R33A 3ZWTA 1GG1A 3ATYA 4O19A 3NQMA 4UNLA 1ZCOA 1LCOA 4FNRA 1XBXA 3U8GA 1PV8A 5G5IA 2B7OA 2NWRA 3NQ2A 2W79A 4X9SA 5I3HA 1KM5A 3W6YA 2A21A 1ME9A 3S1UA 3EB2A 4M7TA 1KTNA 1YDVA 4ZQCA 2QCHA 3UWUA 5H2ZA 5LGZA 2FIQA 1DQWA 5IM51 3LOTA 1KV5A 1YDOA 3HBLA 5K4ZA 5LNUA 4D2JA 3G0XA 2Y88A 1R2TA 1THFD 3L21A 1QO5A 4OV9A 4PC8A 5G4EA 1YPFA 2NX1A 1M7PA 3K30A 1DJQA 4KFOA 3NQCA 1OFRA 4U4MA 4ADSA 2E6AA 2G95A 3M5VA 2YSWA 2E68A 5F1VA 5AHIA 1H5YA 1JUKA 4JEQA 1HO1A 4E2BA 1B3OA 3LHWA 1NEYA 3WFAA 2C1HA 1DOSA 2NLIA 3NZRA 3GYEA 4YCOA 1U83A 3IIOA 3NYZA 3S9YA 1L2UA 2G97A 1TTJA 3LCLA 3MP4A 1C29A 1YPIA 4AHOA 4N9DA 5TBOA 2A4AA 1EPXA 1OJXA 1B9BA 5LGXA 3S42A 5FEWA 4JR5A 1EP2A 3HPSA 5F2GA 2G96A 5K9DA 2YW4A 2ZFAA 4IMFA 3KRUA 2Q3OA 3CTLA 3L9CA 4OGZA 2G5WA 3TX9A 2IQTA 1MO0A 4AHQA 4KFNA 3KX6A 1GJPA 1TQJA 3L5LA 3GXNA 1JVNA 3TNOA 2XN1A 1VHNA 3HMJG 3HG2A 1FCQA 2NV1A 3QSTA 3M7WA 4JTTA 3STCA 2YFOA 1K8ZA 2CU0A 1XBVA 3CEPA 4M6PA 4QM1A 2J88A 4FX8A 1ICPA 1QOPA 1IXOA 1VHCA 1KBJA 3EX1A 4CQAA 3GKAA 1G6CA 1G7VA 1OF8A 4O16A 2DJLA 1TPC1 4FNSA 4HPJA 2A7PA 1WX0A 2ABBA 2DU2A 3KXQA 1ZALA 5CKSA 4FIRA 1OYCA 4N9BA 5HULA 3NR0A 4NNCA 4BI6A 2YYUA 5HWJA 3QPZA 1FWRA 1PS9A 3TQ0A 3C2FA 2QEZA 4X22A 3BLFA 4EF9A 1SUXA 4JTFA 2NXHA 3PB2A 3MHFA 4H6KA 3G3DA 3NQEA 1X1ZA 1SW3A 2ZRYA 5C55A 2NX9A 4MIMA 4O17A 2QAFA 2QAPA 1WBHA 1U5JA 2FB3A 2J27A 1W5MA 3CQ0A 3GXTA 3PF3A 3M43A 1JCNA 1UUOA 2QDHA 2VFGA 3S5YA 4UUIA 1GG0A 1OK4A 5DXYA 1YYAA 1AMKA 3NXFA 3UQNA 3TA6A 4O1BA 2C19A 2VFHA 3P7YA 4ZVJA 5KZEA 4E38A 1LYXA 1TTPA 2ZA1A 3LXBA 1W5PA 3W1NA 2P1FA 3C6CA 1AK5A 2AAMA 4CNPA 1JCMP 1QPRA 3WK1A 3H54A 4GXMA 3ANYA 3JR2A 3KHJA 1AG1O 3TJXA 1H62A 2V5LA 3W7LA 2HSAA 2V2HA 3FYPA 3LERA 3S8HA 5CPLA 2ZZ6A 1TPDA 1TMHA 2QJIA 2VENA 3CHVA 4Y90A 1KFCA 3DXIA 1TPVA 3VI2A 1F6PA 2OT0A 4HNTA 4AWSA 1M5WA 3W87A 3EKLA 1J2WA 3TMLA 3SSJA 5AB3A 2NXGA 1UJPA 3A23A 4UNKA 1I2NA 3UPBA 4IGHA 1G69A 4H3DA 4UTMA 3W7DA 1XC4A 2A1YA 4UIOA 2WOQA 2ZZ7A 1KFEA 2JKPA 4DEFA 2QUTA 4K8EA 3W73A 2Y70A 3BO9A 2YW3A 3Q58A 4JICA 3TUUA 1UASA 4QIUA 3C3NA 2V30A 4TX9A 2FFCA 1NF0A 3NGJA 4GC4A 2C0AA 3UZ5A 3W2JA 1KFLA 3KOFA 3G1FA 3R89A 1HFBA 1LDCA 4GBUA 1FCVA 4I7UA 2PE4A 2ZA3A 1OFBA 2B7NA 2Y89A 3INPA 3S1XA 4JTLA 5D2WA 3HQ1A 4GUFA 4LT9A 4NJGA 1MEWA 3M9YA 3E96A 4N02A 3RFAA 3BW2A 3SECA 1S5VA 1IXQA 1LRNA 4K36A 3TJLA 4ZQNA 1JQVA 1Q3NA 3PY2A 5LKYA 3QMRA 5D38A 3KRSA 1LBLA 1TV5A 1KM4A 2CLHA 1PE1A 1ICQA 4GWEA 3SJ3A 1PCWA 1FXPA 4UFLA 3G1HA 2GQ8A 2TPSA 5SWUA 1ZFJA 3KVMA 3DFTA 3LBCA 4AMAA 3TSMA 3C4UA 1I8JA 4JIQA 4MY8A 4XKYB 3DKJA 3W72A 1MXSA 3HO8A 2A0NA 4PL1A 1T0OA 1FDZA 2Z2UA 1SR9A 3BV4A 3IVTA 4ALDA 3OIXA 2C13A 3R5EA 4CLMA 5AC6A 1RVGA 6ALDA 3QW4B 5D09A 1W3IA 3TMQA 3FFSA 3PWAA 1E51A 3EKZA 3W1RA 4AXKA 5AFDA 2YPIA 2VKZG 1SSGA 5E93A 3F03K 4N9EA 3TQKA 4FIQA 3PVFA 1DL3A 1OX4B 3G3MA 1XKYA 2D73A 3A22A 2OZ0A 1XL9A 1NAL1 3W84A 4DF1A 2F84A 5FEXA 2TMDA 3LHYA 4RV8A 4WY0B 4O8RA 1VCGA 3FOKA 3GIYA 1GTEA 4YCPA 3W3OA 4CQ9A 5H91A 1LTDA 1I2QA 4XZ9A 2WNNA 2ZRVA 3QF0A 3PBVA 4UFHA 5KITA 3GDRA 1JCYA 3IVUA 3UXDA 4CNOA 2ZZ2A 2B0MA 1K02A 5BMXA 3E12A 4N6FA 3LX9A 5HR7A 1H7OA 4JS3A 5LHEA 1SZGA 4QNEA 1H63A 5FF3A 1H7WA 3L5MA 5G1YA 4Q32A 2R8WA 2TYSA 4IJBA 2ZTJA 1F6KA 4LWWA 5D05A 1UCWA 1TYGA 1DVJA 1KTCA 4HSOA 3NPWA 3F4WA 2JGYA 5LSMA 5C5YA 3MHGA 4XQ6A 2GUUA 1KM6A 4LUJA 2ZRUA 4TMCA 3UWWA 3B0PA 3NDOA 2DORA 3P60A 3VE9A 5F4WA 1OX6A 1GVQA 2YDAA 4GFSA 4N4QA 4JTGA 1ICSA 2CLOA 3PUDA 5AC7A 3RK8A 5F4XA 3S6DA 3LHUA 3EWZA 3W1UA 3LCHA 5KSWA 1PHQA 3FLUA 5AHEA 1PHWA 2H3DA 4FNUA 3STEA 4UFKA 4MKNA 2CWNA 3NG3A 3OVRA 1TB3A 3NO5A 5DCDA 3UYCA 1VCFA 3LRLA 3B03A 4WOQA 2Q8ZA 4LNYA 4DPPA 3E49A 3A21A 3WJYA 4AAJA 3LTYA 2CFFA 3WJWA 4JYDA 4ZQRA 1L6WA 1V7YA 3GX9A 1TCDA 2ALDA 1JCXA 4I7WA 3W7OA 2DZWA 3W1PA 4MUZA 4XBKA 1OFOA 5D2XA 5K4XA 5EBUA 1ML1A 3O06A 4JTEA 2PRLA 4NJHA 1SZFA 5AHFA 1HTIA 5EYWA 3DFPA 5J5DA 3W2KA 5HJLA 4N2YA 1Z44A 3EWWA 3HIJA 4UMBA 5K3VA 4FNTA 1WA3A 2GVGA 2EAWA 4O1CA 2XFWA 3IIXA 3LXCA 4IMCA 5CZJA 4R53A 4YXGA 4P61A 3O63A 3QW3A 3WJXA 3T7VA 1VH7A 3C2OA 3LBMA 3MYPA 5IBXA 3FJ6A 4H4IA 3ABOA 2ATSA 1KLZA 1X6UA 3MI2A 2J9XA 3EWUA 3BVJA 5FF4A 1KW1A 4RLIA 1YXYA 4Z0SA 1TPH1 1NSJA 3HJZA 3W76A 1TTIA 3MBDA 3DAQA 1F73A 1LOSA 4GUHA 1G4PA 3B8DA 3DZ1A 4JX5A 3THAA 5EL1A 4IWWA 4KFPA 2E5CA 1IF2A 1TJRA 4NX5A 2NWSA 1YDNA 4ONVA 3ATZA 2HTMA 1H61A 3WK3A 5AHNA 1KLYA 1VS1A 2ZRZA 3IGXA 1S3HA 3HGRA 5CG7A 2VC6A 3DI0A 3NAVA 3I65A 4O18A 3N73A 4AVFA 5G1TA 2BLEA 1EUAA 5MHBA 2ISVA 5HQEA 1FX6A 1XDLA 1Q6QA 1DQXA 4RXFA 2C15A 3W7EA 3G0UA 3VNDA 4I7VA 3FIGA 1XCFA 3KVJA 4RKAA 4O54A 5CPMA 5D04C 1KA9F 2NV2A 3TSDA 5IBXC 3W1LA 3MI6A 3V1PA 5LZLA 3CLMA 2GVJA 3O8AA 3GB6A 2WKJA 1W5NA 3S5OA 1ZJIA 1BKSA 3W7CA 1EP1A 4UTTA 4FX6M 1TRDA 4JIPA 4IPJA 4JX4A 2OX1A 1RPXA 4DF2A 3THQA 1LRTA 4PH6A 3PSWA 4O0KA 1QAPA 3B05A 2V5BA 1XI3A 4N9CA 1O60A 4XBSA 3TE9A 4FO4A 1TPB1 4L4LA 1P0KA 4IMDA 2HS6A 2WQPA 5K9XA 3SFKA 4JDYA 5EY5A 1GVRA 2HMCA 1SSDA 1XM3A 1RV8A 4UFIA 1MEHA 3NQ8A 4Z1AA 3C0JA 2X1SA 2C18A 2DJXA 4PFMA 2E5DA 1G4EA 1UBSA 3BW3A 4JY9A 4YL2A 3W71A 1GZGA 1YTEA 2DP3A 2B4GA 3N34A 3TW6A 1FY6A 3MHUA 2QCEA 4A22A 1ZHAA 1HUVA 4LC6A 3O6DA 4TO8A 3E0IA 1H1ZA 4Q33A 3UNDA 3W07A 5HWNA 1D3GA 2BTMA 4XWUA 1I2PA 3NVTA 1BEUA 5FI8A 5I3GA 2Y7GA 2Q3RA 2F7FA 1H51A 3RLVA 3M1ZA 2GOUA 3EXTA 3UZJA 4NT0A 1QCWA 3W7IA 4LUIA 2DZXA 4UTTC 4HT3A 3QZEA 4OU1A 4HNUA 3CPRA 5KINA 3MWAA 1DJNA 1XUZA 3IIZA 3M5XA 2WPBA 3T78A 5F4SA 3R8RA 5D37A 4R34A 2Y62A 3T44A 2X2GA 3I6RA 4PCFA 4JNMA 3W85A 1DKWA 3U6WA 5BRBA 5C6MA 4M19A 2YXGA 3M47A 4JX6A 5FESA 2X1TA 1M6JA 2QR6A 2E77A 4HKPA 1K3UA 1FDYA 4GRSA 4O11A 5KMYA 4PTNA 1T99A 1OHLA 3QRHA 5LHFA 1KFJA 1FWTA 1H60A 2VEIA 4CQ8A 1QFEA 4GE8A 1JQXA 2OCZA 4RZ4A 1O5XA 2PCQA 1Q6OA 3TV8A 1LORA 1A5BA 3FEMA 4TIMA 4QJ1A 5KTLA 3T55A 1ZENA 3I7RA 3HB9A 3W86A 3B0VC 2GQ9A 3NQAA 4BF9A 3HGOA 3IIPA 5CSRA 2Y7EA 1PVNA 2NUYA 1GEQA 1K8XA 1OFQA 4GNJA 4UMAA 3P67A 4AEOA 1ME8A 2OJPA 1F2JA 1PCKA 1RQHA 2X30A 3A5VA 1TPWA 3CU2A 2CLKA 3G1AA 1SO6A 4FB7A 3B4UA 3HF3A 1ADOA 3GR7A 5DLCA 1TSIA 3LLFA 1K03A 2QCDA 3WJSA 2VFFA 4OQVA 2JKEA 2R14A 3C61A 4HNVA 2H6RA 3O07A 4CCDA 4S1FA 4MFDA 5KZDA 4RX0A 3KAOA 3SI9A 4FXSA 2Y63A 3H55A 1GYLA 2QCFA 1A5CA 4OE7A 3NQDA 2A6LA 3EEGA 3PB0A 1LBMA 3HPZA 3G1YA 1WBJA 3TXVA 4ZMGA 3GNNA 4EIVA 5DCEA 3NEVA 5U7SA 4OHQA 3W2MA 2CZDA 1H7XA 4DO4A 1N7KA 4X2RA 3P8IA 1IGSA 3TROA 1RQEA 3DHFA 2CZEA 1WYIA 2WJZA 3EX2A 3G1SA 5HINA 5I3KA 2DZUA 3P82A 4JXCA 1B4EA 4LU0A 3NQFA 5LNWA 3Q2DA 1SU5A 5AOUA 1MSSA 4QQ3A 1ONRA 3W1MA 3MI3A 4MFEA 2YYTA 1XBZA 3TXZA 1Y0EA 2R94A 3ABQA 3WJZA 5CPOA 2Z6JA 2FJKA 3KVLA 1KTBA 2GPTA 3ZWSA 3EWYA 3BLIA 4E0CA 1P1XA 3ELFA 3DI1A 3QQ0A 4E2DA 1SO4A 3IGUA 4NXSA 1PL9A 3H53A 4A2SA 4EVZA 1X8FA 3DU0A 2ISSA 2JKAA 1VGAA 2ZZ5A 4AF0A 1JUEA 5LNSA 4UCGA 4MYAA 3PBWA 4BR1A 3GKFA 3TH6A 1SZEA 5FF2A 3NA8A 1KM2A 4IQLA 4ADTA 5I3JA 3FYOA 4NQ1A 1WOAA 3USBA 4LTSA 1I2OA 1G4TA 1VYPX 3RLUA 2VEKA 4CCEA 3C2EA 1JUBA 3BG9A 2DZPA 3PG9A 2BZNA 2XN0A 4K7YA 2H90A 4M5PA 5G2WA 1OX5A 3LCWA 1QDSA 1FCUA 3LRMA 3PS7A 1W56A 4LS0A 1W1ZA 1OFPA 1DHPA 1TRIA 3N9SA 1QO2A 5K9CA 3W75A 4MYXA 5K7JA 3OVPA 1QPOA 4Z1BA 4WJEA 2NX3A 4G1KA 2W0UA 5K2ZA 3UY8A 3CB8A 1FWSA 4JTHA 3P74A 4OV4A 1KBIA 4O13A 3C52A 5F2IA 2P10A 1H50A 1H7PA 2VELA 3A9IA 4FEZA 4WXZA 5AC8A 3TR2A 3LI0A 4JYEA 5LNVA 1TPFA 1CX9A 3VKJA 4NX0A 2H3BA 5G2HA 1Z48A 2E09A 3L66A 4MLJA 5F2LA 1LM1A 4AWUA 1OFDA 2QJHA 3PUEA 4M6QA 2GVLA 3E02A 2I1OA 3G8EA 2J6XA 3IVSA 3W1TA 2B7PA 1L6SA 3LI1A 1AW2A 3RMJA 4O52A 1W37A 3EWXA 1LZOA 1VYSX 1TIMA 2JGQA 3QC3A 5D33A 4AWTA 3S5ZA 1I45A 4U28A 4EF8A 2YZRA 3ZFHA 3A24A 3QFEA 1LBFA 2J9ZA 3P8JA 1JCJA 4UFJA 3NPVA 4QISA 2BX7A 2Z6IA 2XN2A 3G0SA 1I2RA 1WOBA 3G1VA 5G4WA 3TIMA 1LOQA 3B0UX 4UTJA 2CZ5A 1W8SA 3HOJA 1K7FA 3C2VA 2O7SA 2YR1A 4GUIA 3GXPA 4P2VA 3GAKA 3F4NA 4O4VA 4RZ6A 2PRHA 2DZSA 1TQXA 3NNTA 3UD6A 1V5XA 1B57A 4IX2A 3W1QA 3EX3A 5CZ0A 3OA3A 2A2IA 5KZMA 3VCRA 1HG3A 1FCBA 4WZHA 2ATMA 3G24A 4MLRA 4PEKA 3A5FA 1TO3A 3TKFA 4K6AA 2RDUA 3RNDA 4JTSA 1EEPA 4S2BA 5AYZA 3NQ6A 3MO7A 1CW2A 2Y7FA 3G18A 1SQ7A 1VC4A 1FQ0A 4TU1A 3G1DA 1O5KA 3W70A 1JULA 4JYFA 4QNWA 4EWND 3B04A 4ORIA 2YFNA 1ALDA 3W7RA 3V75A 3W2LA 1X7FA 2V81A 1QNVA 4WX2A 1DV7A 3R12A 3TW7A 1J4EA 2EGZA 3STGA 4RZ5A 3KRZA 1GVOA 4BWLA 3LHVA 2TSYA 2C6QA 4FX7A 2WSRA 2QCLA 1P5BA 3L0KA 5J5RA 1EIXA 3JS3A 3O1NA 1DORA 2QUVA 2QUUA 1K8YA 3NQVA 1EA0A 2AGKA 3C56A 4FNPA 1YLVA 3LRKA 1LRQA 4LRSA 4WOZA 4I9AA 3OHIA 3HG3A 1XDMA 1KV8A 3LXAA 4RCXA 1GPWA 3MP5A 4YLWA 4A29A 3R2GA 5HUOA 3PM6A 3W7PA 4IXXA 5DN1A 1BWLA 3N3MA 2NUWA 1F5ZA 1GYNA 1OFEA 4O15A 4N6EA 4OBTA 4CCCA 4MVAA 1TTQA 2FLIA 1OF6A 3GZ3A 5AHLA 4B5NA 1L9WA 4GJ1A 3GDLA 4UTIA 3N14A 2DZVA 3QEZA 1YXDA 4FNQA 1W5OA 2BXVA 3L65A 4PA8A 2CLIA 3SGZA 1NF7A 4LRTA 1TPEA 3LCXA 4OWGA 3DBPA 3L0NA 1N8FA 2QCDB 2P0OA 1EB3A 1OYAA 2WSYA 3NM3A 3B06A 4Z1CA 2E6DA 2A85A 5G2IA 2YGYA 4A21A 2QCCA 3G1XA 1OG0A 2VFEA 1FUYA 2V8ZA 3UPWA 4R7JA 4BWLC 1FDJA 3W7QA 4XTIA 3U2OA 3W7KA 2QDGA 3O6CA 1T96A 1H1YA 4FXRA 4HNNA 3LCGA 1ZY9A 5DCBA 2EHHA 5CZTA 1W3NA 2YCEA 3GK0A 1AL8A 3MYOA 2AQWA 2RDTA 1WQ5A 2PC4A 4WY0A 4LV9A 1QOQA 5D32A 3SZ8A 1A5AA 2Y7DA 2ISWA 4M7SA 5D2TA 2E1DA 4PODA 1VR6A 1OVDA 4BFAA 3NQGA 3L67A 1A50A 3N2MA 4LVAA 3N2XA 1TPUA 3VE7A 2E6FA 3EXSA 4MPQA 2GQAA 4K39A 1MZHA 4ZL1A 1RR2A 1VLIA 4JDBA 1O4UA 3BK0A 3EXRA 5F1UA 3CIXA 5E0KA 3OG3A 3FJLA 3VFLA 5EKYA 5BOOA 3CWNA 4UXDA 3T40A 2ZDRA 1I4NA 1OYBA 3W7HA 4LY8A 1ZAIA 1GOXA 1EWDA 4QSHA 1YTDA 5CZSA 3QJAA 3P61A 3NL3A 3P84A 3G8RA 2C14A 4DELA 2E6YA 1XBYA 4AF0B 3IV3A 1K7XA 4RJEA 4YWIA 1SO5A 4HSNA 4WD0A 4UTHA 3M0ZA 3SIZA 3FKRA 4O4WA 3LCIA 1FWNA 4WUIA 1JRCA 2FPTA 3P62A 3L2IA 4RR4A 3LLDA 3TAOA 1GTHA 5DBUA 4NJIA 1EX5A 3W7MA 1AW1A 2ZBTA 3TC6A 4JTJA 5T26A 1QR7A 2FDSA 1PIIA 1SFLA 2JBMA 2EPHA 1FXQA 4CNNA 1YTKA 1G4SA 2ZQ0A 4L4MA 5FEPA 3DGRA 4LV4A 1P0NA 4J9JA 3BG5A 4C1KA 4Y96A 1OFAA 1RD5A 1RZMA 3E9AA 3TC7A 2BWGA 1FBAA 4KWVA 1R30A 3S5NA 1P4CA 4A2RA 2FPYA 4IMGA 3IGSA 4Y9AA 1ZAJA 2PRMA 1D3HA 4EOUA 4FHAA 1QMLA 4NUWA 2DZTA 4X3ZA 3N19B 4MY1A 3LTSA 1H7RA 3QYQA 3PUOA 4NVTA 2X16A 5HNRA 4N4PA 2QJGA 3TDFA 3T4CA 3LM7A 3P5ZA 1W0MA 3LTPA 3O6YX 4IOTA
chains in the Genus database with same CATH superfamily
3PR2A 1FOBA 3PAJA 2J9YA 3GDMA 4XAYA 3L0GA 2ZTKA 4GYFA 3KVKA 1NWSA 3W22A 2HJPA 3W9ZA 3H4GA 2G0WA 2BHYA 1TMLA 2IKHA 1C9DA 2QV5A 3FS2A 1K8CA 2Q71A 3LB0A 3C0SA 3IRDA 3LV5A 1F74A 3BOLA 1XGEA 3WK2A 3KFTA 5TQLA 3V4BA 2JK2A 4JQ3A 4E3TA 4WXYA 5HMSA 4FXFA 1ODZA 4L1WA 1O94A 3BCDA 4UTKA 1W54A 2WW5A 3TFXA 1SJCA 4ZEPA 3K4AA 5F2MA 5REQA 2AL2B 4PUMA 5LXEA 3HM7A 5EA9A 1V6UA 1EJVC 2QW5A 3AXMA 1W2PA 2WYSA 5M5DA 4A3HA 4E4FA 3H2AA 2RKXA 4NASA 1VCVA 2J25A 2WZEA 4XO6A 1XX1A 3IJLA 4F8XA 1GVSA 1HX0A 3ABSA 3FSUA 5EFDA 2P76A 3O05A 3UJRA 1W2BH 2RGMA 4IGSA 5I3IA 2V0TA 4US9A 2FZMA 3H7UA 1Y65A 5A8MA 4AX6A 2J7EA 2A7RA 3AUOA 3TU9A 5C0QA 4TR9A 4D6JA 3BV7A 3DFOA 3MB9A 4L61A 3ITOA 2Y6ZA 5D2YA 2HV5A 5I2UA 4DXXA 1E1EA 1CXEA 4INFA 3PZQA 2WK2A 3SCUA 1R5YA 5BMWA 1ZTVA 4B15A 3TSBA 1FWWA 4MZ8A 4NZFA 3VVGA 4C1NB 3PPHA 1V7AA 2AKMA 3GTXA 3BLLA 3UXAA 3PWIA 2A7NA 3WIJA 1NDWA 1SO3A 2CERA 1C8QA 3CJPA 3O0KA 3BPWA 1WZLA 3W7NA 3AUJA 1VJSA 4BK9A 1X7IA 1B90A 3DN5A 1P6BA 4Y6GA 2C8NA 4HNCA 3ZT5A 4UTLA 2NQZA 2WNQA 4W88A 2HXTA 3DFHA 4BI5A 2PURA 3PULA 5DXXA 5RUBA 4ZO9A 2WAGA 2HDJA 1Q6LA 3N2BA 2GGJA 4ZOHA 3S6TA 3I68A 3W38A 3WBAA 2ZXDA 3OZPA 4CNUA 4HOWA 1ADSA 3GW0A 1QPNA 2DSWA 5BW6A 3CC7H 4O14A 5A8QA 4NKCA 2OSWA 4Q6XA 3V3WA 4LY4A 1J10A 1IIHA 1TZ9A 3UG5A 5LNRA 3LM3A 2CW6A 1LWJA 4K37A 2G3FA 4DM2A 1R2RA 2GJNA 4J5NA 1MDLA 2DFAA 4O1DA 3KCJA 3BW4A 4E6MA 2Y85A 4MB4A 1S5MA 3DHUA 4HZ6A 3XIMA 3GIPA 3KP0A 1E71M 5EGRA 4JTKA 4ICNA 3B8VA 4HU4A 1N8IA 2FHFA 2Z00A 4DPQA 3S83A 3ES8A 3URAA 3Q4DA 3EDKA 2B7QA 3WDPP 4HN4A 4AB4A 4RL3A 4XZHA 3H4XA 1XWYA 2DW7A 4WEVX 3WO0A 4JQ2A 3ARZA 2OTLH 4FK9A 4GQQA 4L6OA 1OIFA 1CGWA 1NOFA 1XH2A 3NZGA 1SVDA 4MM1A 5H8UA 4O12A 1HGWA 2OMAA 1XLKA 3CB3A 3F1QA 3W83A 3W1XA 2PWUA 3CV6A 3HG4A 3MJYA 1YJNH 3WLQA 4IP4A 3RJXA 4MJZA 1MW3A 4B16A 3PPFA 4LOCA 4KWWA 3LPPA 5DMYA 1DBTA 3E2VA 1UR8A 1E5NA 2QCMA 2J62A 4GY7A 1UROA 2YA2A 3PUGA 2PDUA 2R1KA 5TF0A 1UWUA 1V8EA 1BWVA 2CHOA 1ENUA 1WAUA 1G7UA 3GVGA 3UA4A 5CC7A 1ZBKA 1Q6CA 3UR8A 1FM0E 5LXXA 3I3DA 1VYRA 3EOSA 2J7HA 2VRJA 1BTMA 1ITUA 3P5YA 1H3GA 3L4ZA 4LVDA 2V2CA 3A9BA 4W7VA 3RX4A 2QYGA 1Q6FA 5DANA 1KM0A 1GQNA 1VFTA 3BGJA 3GIQA 3BJSA 2ANUA 1XD0A 3WBWA 4LVFA 1R3RA 3ICJA 2YX0A 3SEPA 3W7JA 1EGVA 2X1RA 3W81A 3C5QA 2F2HA 3H22A 5C2XA 3AS3A 3RJYA 2VCCA 1XLFA 5DRIA 2ZC8A 2BVDA 4YYYA 1U22A 4QJ3B 1R87A 4MJ4A 4DXVA 1TKKA 4MZ1A 2KX9A 4E2VA 1J9YA 4F48A 3E0LA 4JD4A 3APTA 3SY5A 4F2TA 3T8LA 4AP8A 3PPGA 2Q8LA 4WY0F 3QQ1A 4M6VA 1WPCA 5HK4A 3VOIA 4MNLA 4ERIA 2RH9A 3S2LA 3EMQA 1WE5A 3W88A 3CQKA 1XCWA 2PEVA 4W8LA 4Q8UA 4LS2A 1OX4A 3PTMA 2J77A 5AHMA 1VPXA 1JAKA 3EX6A 1OIMA 3EA2A 2GZXA 2I9EA 4NL1A 3GLCA 3GU9A 5HBFA 4R33A 4EAYA 3VGFA 1GG1A 1REQA 4O19A 3NQMA 2PFHA 1XBXA 4MJ2A 2OEMA 3E6EA 2QJNA 3NSXA 3UU0A 4ZQCA 1BXBA 2QCHA 4LUTA 1A5KC 1DQWA 1KRMA 1EGMA 3FAHA 1KV5A 1YDOA 2UY5A 3ZXWA 4A3QA 2PTWA 7TAAA 1AD4A 2Y88A 4NG3A 3VFCA 2OZ8A 3SUWA 1QO5A 2WM0A 3CYVA 4PC8A 1SR0A 2PP0A 4UQ9A 1CZ1A 4MADA 5HNUA 3KBNA 1DJQA 2OZ3A 4GA6A 5MKGA 2PGFA 4DLFA 4HTYA 4DWSD 2BGSA 2E6AA 2YSWA 2E68A 1KKRA 5AHIA 1JUKA 4JEQA 3R79A 4E2BA 2PC8A 4AXNA 1MDRA 1NEYA 3WFAA 2OYMA 4LYPA 1NDYA 4JL1A 5LIUX 2W3ZA 1E6PA 2WSPA 3RN6A 3GYEA 3OPSA 1PWMA 2D69A 5ECVA 4YCOA 1U83A 4ACYA 1AVAA 1JZ3A 3GDBA 1L2UA 2G97A 1RY0A 5FSDC 2WLZA 3L4UA 1C29A 1UMYA 4ASTA 4AHOA 4N9DA 5TBOA 3RPFA 3WD4A 4DZHA 3S42A 5FEWA 2PF0A 1RCXB 3WSUA 2G96A 5K9DA 1J0KA 1DJZA 3HA1A 3F5JA 3CHDA 4JTQA 4KFNA 3L5LA 4O0QA 3OBAA 4H8HA 3N1AA 4Q4OA 4RZBA 3BURA 1W3LA 3RG6A 4JTTA 2YFOA 1UUQA 1F07A 4QM1A 2X0HA 2J88A 4TV5A 1BFNA 1QOPA 1KBJA 3CZEA 4CQDA 1XH0A 4KPLA 4AVOA 2DJLA 4HPJA 4DJEC 1BVWA 1WX0A 2DU2A 3KXQA 1CB7B 4FIRA 1UD8A 1HJVA 3VGEA 5M03A 3KWXA 1R3TA 2WJDA 5HULA 2J7FA 4BI6A 3AISA 2H9AA 4J7RA 3WMBA 1NFGA 3QPZA 1PS9A 3HQOA 5HNNA 4HMNA 3C2FA 4B2DA 5EMMA 3BLFA 6ENLA 4CD8A 3BL3A 4JTFA 2NXHA 1R3YA 3G3DA 3CBWA 4GA8A 4ZBCA 1SW3A 4DM1A 3UCDA 4GYKA 4GVIA 3FGCA 4Q8NA 3PNZA 2QAFA 2QAPA 4DWSB 3GXTA 1ITXA 5CPSA 3M43A 1UUOA 2XH0A 1N61B 2VFGA 4EAFA 1FP9A 4WJ8A 1M9HA 3WQEA 5LA0A 3POHA 5DXYA 4HA3A 2Q02A 2Y5JA 3NXFA 5AY7A 3UQNA 1A5OC 2WQDA 4O1BA 2C19A 3ECQA 1IHIA 1PZ2A 1JDEA 5C70A 1W5PA 4F0HA 2R1NA 1X97A 3C6CA 4JNZA 3QN3A 1U5VA 4C6DA 2P50A 1JXKA 4FXJA 1DWHM 4GXMA 3SDOA 1XLJA 3KBWA 3NSMA 3WQ8A 3GXIA 3TYBA 4M6UA 2O55A 2V2HA 3LERA 3S8HA 5CPLA 5JVGJ 1TPDA 2VENA 4EWJA 2OTJH 1RP9A 2WVVB 7A3HA 4L4OA 1IWPA 2XVNA 3EPMA 3VI2A 2OT0A 3DIPA 3PZVA 4I5UA 7ENLA 4HNTA 4AWSA 3W87A 3QXBA 4IIGA 3SSJA 2E25A 4AC1X 3GVVA 4LQ1A 1UJPA 4NAFB 3AJ7A 4RDZA 1A5MC 4H3DA 1FWJC 1EC9A 4US5A 4PRWA 2WOQA 3K8MA 2JKPA 3S6OA 4DEFA 4X0VA 3W73A 2YOCA 2QZRA 5C9ZA 3Q58A 3C3NA 5CG0A 1MRAA 5IOBA 4GC4A 3W2JA 1Q81J 4BS0A 4H00A 1RHCA 5BCAA 2CLPA 4GBUA 1OFBA 1TUFA 2DT0A 1L6FA 1X39A 3CC4H 2NT1A 3D47A 4GUFA 1MEWA 3QOMA 3D3FA 4AISA 3SECA 2EG8A 4V15A 1S5VA 1IXQA 1LRNA 2AGTA 3R6IA 2B81A 4DX3A 1DQUA 1Q3NA 5LKYA 3AAMA 1KM4A 2CLHA 3UXLA 3SJ3A 1PCWA 3UCQA 4KMQA 2DUXA 3G1HA 4AU0A 1N63B 3M0XA 5I07A 3DFTA 5CLWA 4JIQA 1AJ0A 4XKYB 3W72A 1MXSA 3VMNA 3HO8A 1T0OA 4EANA 1X6LA 3BV4A 5AVNA 4LCQA 4YEKA 5ABFA 1SFTA 5A6LA 3AYTA 3CGTA 4MHBA 4GVHA 3TMQA 1ZBVA 1XIDA 2YPIA 2OGYA 1HKWA 1JZ6A 2IPGA 1XKYA 1GZ1A 4B4FA 2D73A 2HBXA 3WDIA 3NQBA 1NAL1 4W87A 3WH6A 1UPMB 2WKLA 5I00A 3MCOA 4MNMA 4XSLA 4DZIA 3OYZA 3I6TA 3CUHA 4RDVA 1LTDA 4ZGYA 3UXDA 2CKSA 1C7SA 1QJWA 2B0MA 1K02A 5I23A 3E12A 2NQ9A 3EAUA 5AZ1A 4HOXA 3NS1C 5FF3A 1E1CB 1H7WA 3L5MA 5G1YA 4QG9A 2G4JA 1DVJA 1KTCA 1VFSA 3WH7A 3NPWA 3WD1A 3F4WA 5C5YA 3LYEA 1TV4A 3LZ5A 1KM6A 1V0MA 3MO4A 3PTQA 4LUJA 1QHPA 1DJIA 1PZ1A 4TMCA 3UWWA 3ZR6A 3B0PA 3P60A 4HCDA 4Q8MA 4KETA 3NVDA 4ENLA 4JIRA 5AC7A 5F4XA 3S6DA 3TYDA 1WB0A 2QXWA 3W1UA 1BTCA 3VTRA 3IK2A 2P3EA 4DZAA 4HZ8A 1PHWA 3ME3A 4M1BA 1JIBA 1HKJA 3CYJA 4S3KA 3STEA 2EXOA 3TYCA 1KWKA 3L4VA 3L4XA 3MWCA 3UYCA 1VCFA 1WAWA 1UYQA 3LRLA 1GUVA 1E73M 1H4PA 1VBGA 3EB4A 3KBVA 4DPPA 4HU8A 3A21A 2DPEA 3ZYZA 3H2CA 4EXAA 1L6WA 4HK5A 2IPJA 2ALDA 4PMNA 4Z17A 2DZWA 3HPFA 5XINA 4L6HA 5DT5A 4ZOBA 1HJWA 1ML1A 1XLCA 5G4HC 3N6HA 1SZFA 3AI0A 4MWAD 4H2HA 6CGTA 5BWFA 2XGIA 1BG9A 3U7VA 1KR0A 3AMCA 3J7HA 3W02A 3WBEA 1Z44A 1X1NA 4FNTA 2OGJA 1WKIA 2XFWA 2PODA 1X96A 4R53A 4PBGA 3O63A 1XISA 3T7VA 3LBMA 4RNJA 1X6UA 3OLGA 3BVJA 5FF4A 4KCTA 1YXYA 2C71A 1YE6A 1PBGA 4OIFA 3W76A 3TR9A 1VIWA 3RM4A 2VDGA 3N25A 4AD2A 4M3PA 2PDPA 2GQ3A 3DAQA 4C5ZA 3JZUA 1OT2A 3DZ1A 5EL1A 4IWWA 2E5CA 5FL0A 2HTMA 2YCIX 4YVPA 1PZ3A 4GHRA 3LK6A 5AHNA 3C0QA 1XS2A 3GZAA 1JF6A 1EZWA 3DI0A 2XGZA 3I65A 4G6CA 4O18A 4AVFA 2G50A 2OQHA 1TV3A 4LUSA 5MHBA 1UD5A 2WMKA 3CD6H 3UZXA 4WFNJ 2O56A 3PBMA 1EOMA 1MUMA 2BOFX 3KVJA 4YVXA 3WLRA 3EDEA 2ZX7A 4KS0A 5CPMA 1S2VA 3GVQA 3WBYA 4GI6A 4MWAB 1EO7A 3V1PA 4MNKA 3CLMA 3O8AA 3A6OA 3GB6A 2WKJA 4MGGA 1CPUA 3S5OA 1QK0A 3S2NA 1BKSA 3M0VA 1BSIA 1TWZA 1JDFA 2X41A 2UY4A 1EP1A 1HJXA 2E40A 4IPJA 3WDQA 4DF2A 3THQA 1LRTA 1A0DA 4PH6A 2P88A 4O0KA 2WNWA 1JG9A 3BC9A 4N9CA 1O60A 2QIIA 1BVZA 3FX4A 1P0KA 2E1WA 3OVGA 3SFKA 4JDYA 1GVRA 4LBRA 1SSDA 1PX8A 2CHRA 1RV8A 4D6IA 1FH8A 2VGFA 2FTYA 3CCEH 1MEHA 3AZTA 5FJTA 4RW5A 4DUOA 3VIHA 2WZMA 3SM0A 4PFMA 4YS1A 1VQ4H 4J3UA 1YTEA 3N15A 2B4GA 1E9ZB 1UKQA 3RLHA 4PN2A 1FY6A 1HUVA 4LC6A 2YJQA 4HTBA 3UNDA 3GYCA 1PKMA 1OC7A 2Q3RA 4GXPA 2XJ7A 5JBEA 2Z7KA 3M1ZA 1JI2A 2F38A 4JFUA 3UJEA 3AXIA 2XISA 3ONCA 4H7CA 4HNUA 2VUNA 4S39A 3CUXA 5GJMA 3IIZA 3M5XA 1YIXA 1V02A 1EQCA 3T44A 5C6MA 4AZCA 4HHMA 2FVMA 5D9MA 4DBWA 3OO2A 5DEZA 3RPMA 1M6JA 2QR6A 1XFCA 1T40A 1FDYA 5KMYA 3QKEA 3AWNA 4AZ5A 2X8RA 1FWTA 1H60A 3OBEA 2VEIA 1ZJBA 2BNJA 4GG9A 2WJFA 4KIRA 5A6SA 2YL9A 4YN5A 1EF2A 1BKHA 1AJZA 1CNVA 2P5NA 3I7RA 3MDUA 3ZVHB 1JGIA 4I5XA 4FR1A 3OQ8A 4BF9A 3HGOA 4XUYA 1PXGA 4FR6A 3LMYA 4H7ZA 5CAHA 3AMZA 4L65A 1KD1J 4IFKA 1K8XA 4AEOA 1F2JA 1XIMA 3UGRA 1XYAA 3G1AA 2YBUA 1SO6A 3LU2A 1EXPA 3T0TA 4TX6A 3TJ4A 5CSYA 4HA1A 2QCDA 3VDHA 1XQLA 2L5HA 4OQVA 3ITGA 3O07A 3F2BA 4MFDA 2C91A 2W63A 4BEQA 3MCMA 3VNZA 3SI9A 3ARPA 1K4HA 3H55A 1GYLA 3GWQA 1XLBA 1Y5WA 3QHMA 1XLGA 4AIEA 4OE7A 3CMAH 2PDMA 2E9LA 4GH3A 4PCNA 3TXVA 3GNNA 2YL5A 3BQ6A 4FALA 1R86A 4ZOCA 1P43A 5A6TC 4A8LA 1RLCL 1N7KA 1IZKA 3K4WA 4X2RA 4F9DA 9XIMA 1OM0A 2DSVA 1RQEA 2CZEA 1WYIA 2WJZA 5I3KA 1UD4A 4YTTA 1CLVA 5LNWA 3Q2DA 1EYWA 4OECA 2OB3A 3FK4A 4PMRA 1X8CA 3TXZA 2PGRA 2R94A 1TWIA 4GQ0A 5HQLA 3WJZA 3VAVA 3KVLA 1CECA 2GPTA 3ZWSA 4E0CA 2QT3A 4FS9A 4PEEA 3KDNA 3QQ0A 1SO4A 2J7CA 1PL9A 3H53A 4EVZA 3RYSA 4C7FA 1DWGM 3OTRA 3ZLFA 1I6NA 1Z7AA 1W9UA 5A2CA 4DJED 5LNSA 4UCGA 4HK7A 1DPMA 3PBWA 3O9NA 1CYGA 3TH6A 3ZLGA 4ADTA 8CGTA 3USBA 1I2OA 3CCVH 4RE3A 2DSUA 4ZO8A 4CEUC 4JCLA 4QLKA 4KEUA 4CCEA 2WM1A 3LD5A 1JUBA 3QGAC 2WWDA 3BG9A 1OSEA 4R85A 3STPA 4K7YA 5G2WA 1QDSA 4IPPA 1W56A 3AS2A 5TAOA 2ZE0A 1TRIA 3N9SA 4OKDA 2DEPA 1IT0A 3ERPA 1WKFA 2HROA 1EX1A 4YPJA 4MB1A 1GVEA 1QPOA 3EGJA 2WMIA 4Z1BA 2FGZA 2ZVIA 1M7XA 2NX3A 2QDEA 1FKWA 1UA7A 1BRLB 2W0UA 2ZICA 5K2ZA 1RBLA 3LNMA 1V97A 1FWSA 3KWSA 1UOUA 3P74A 4OV4A 1KBIA 4O13A 2PS2A 2VELA 1V3LA 3A9IA 2F6XA 5DM6J 3PTDA 5AC8A 3NO3A 4ZTYA 1HJSA 5G2HA 1BQGA 4YHEA 1CWYA 1X98A 3PZGA 4MLJA 4P8WA 2VC9A 3N17A 1XLAA 1LM1A 4AWUA 1MI3A 3CASA 3EMZA 2GVLA 4DAFA 3E02A 2J6XA 3W24A 4W8AA 1VD6A 3VZZA 3RMJA 1W37A 5D33A 1K6AA 3BAWA 2ZXAA 3CHFA 1I45A 2YZRA 3ARVA 2PGWA 3K2GA 1A5UA 3WNZA 3QV7A 4B5WA 1UZ4A 4JQAA 4YU1A 4QISA 3CXCH 4GZEA 4WDUA 5GAGN 3VMPA 5T8GA 1WOBA 3G1VA 2GSEA 3SUVA 1LOQA 4AZIA 1SGJA 3IAQA 3B0UX 5F7UA 3HOJA 5A3HA 3C2VA 1J93A 2YR1A 3MSGA 1AQHA 2YIHA 3DDMA 4O4VA 2DZSA 1YBQA 3UR2A 1TQXA 3NNTA 3SFWA 3W1QA 1TJ2A 3OA3A 1HG3A 4YYCA 2GGGA 2ATMA 3AIRA 1RH9A 2D1ZA 2D3LA 4AUBA 1NWTA 3NQ6A 3MO7A 2WVVA 1MRQA 3CCUH 2VD8A 4JTDA 2A3EA 4ATWA 4CN1A 3UT0A 4S3FA 3W70A 2RJHA 3RIKA 3N29A 1ZS2A 1R8LA 5M3WA 1JULA 4NAFA 1W9DM 2YFNA 1LL6A 3CHEA 1F4AA 4IG2A 2R9RA 3W2LA 2EPLX 2WK6A 4C65A 4QQUA 4WX2A 3R12A 1UWSA 2VZVA 2GWNA 4RZ5A 1KQZA 1GVOA 3QR3A 2XWDA 3GXFA 2VZSA 2C6QA 4FX7A 2ZKMX 5J5RA 2GUBA 3B8UA 5BXPA 5I6SA 3O1NA 2QUVA 5BXTA 4OFCA 2QUUA 1K8YA 2OXNA 3HU7A 4AX7A 2AGKA 3C56A 4FNPA 2G3MA 4P8UA 3OHIA 3EPOA 1EGZA 1XJBA 5ABGA 2IKIA 3MP5A 4YLWA 1YX1A 3COTA 3VIFA 2DIEA 4WVXA 3GD6A 1S1PA 5JUVA 3WLJA 4QG6A 1F5ZA 4O15A 4D6CA 3R1ZA 4CCCA 4MVAA 3PTKA 4RW3A 3VMMA 1CGUA 2VDIA 4Y9NA 3LGDA 2NVCA 1YXDA 2HNEA 2W91A 1W5OA 2BXVA 1VB9A 4GYJA 4PA8A 3KE0A 3T0BA 4DAIA 1F6YA 2BS9A 3CAKA 4EX4A 3EEZA 3L0NA 2P0OA 3E3HA 2E6DA 4XB3A 2A85A 4E8DA 5G2IA 3SQLA 4A21A 2RDXA 4ZE4A 3FJNA 2HVMA 2VFEA 1FUYA 4R7JA 2QPUA 3W7QA 4IT1A 3U2OA 2Y1HA 3IJQA 2PLMA 1Q13A 1WXZA 3N4EA 3VNYA 4AD1A 2QDGA 1KRAC 4D8ZA 3O6CA 3F5LA 1H1YA 2YA1A 4FXRA 1KC8J 2EHHA 5CZTA 1W3NA 4L80A 3GK0A 3CLWA 1WQ5A 2PC4A 4UQCA 2Y5EA 3W6LA 3BQ5A 3SZ8A 2WCAA 5CJMA 1NWRA 2JALA 2E1DA 2ZIDA 4PODA 1OWQA 4BFAA 3L67A 2VT0A 3G1RA 1H0IA 4D1JA 3ZT7A 3N2XA 4I5RA 5E0CA 4YTUA 3WO8A 1UR2A 3EXSA 2GQAA 3HMCA 5GADN 4K39A 4LALA 3AOFA 4JDBA 1XRTA 2E28A 1UZDA 5E0KA 1R3WA 1VKFA 5EKYA 4H1ZA 3QGVA 5BOOA 2GYIA 4YIWA 5DFAA 3W7HA 1ISYA 1GOXA 5IHSA 5HNTA 1YTDA 5CZSA 1K9EA 4YJ5A 2ZWZA 3P61A 3MS8A 4JN7A 4S3GA 2HE8A 4DELA 1Q6DA 4F0LA 4RJEA 1ZP3A 4DB7A 3S3GA 1F8MA 4WD0A 3SIZA 4MKSA 4UOQA 3WLMA 4B5VA 3UW6A 1QNOA 1LUCA 1GTHA 2WHLA 2W66A 1AW1A 4H9MA 2INEA 2ZBTA 4PMZA 3TC6A 4JTJA 4EP8C 1NVIE 4MB5A 5T26A 2FDSA 1SFLA 2JBMA 4E4PA 1UQZA 1FXQA 2EPHA 4CNNA 2INZA 4QS5A 2VZOA 2ZQ0A 4L4MA 1FTXA 2DT2A 5FEPA 3DGRA 1C9WA 2FZNA 1XH1A 4J1OA 4EPEC 1OFAA 1ZJAA 2FFIA 3E9AA 3VK5A 2W3SB 2E9BA 2BWGA 4C90A 3C0LA 4XZBA 2FPYA 3IGSA 4H9TA 4U3CA 1PIGA 3GVWA 2PDXA 3ZM8A 2X7WA 1H7RA 3QYQA 3PUOA 4J40A 2X16A 4B9ZA 1NQKA 5HNRA 2PDYA 1V6YA 3P5ZA 4IIHA 3PANA 4IOTA 2DVUA 3WLTA 1B31A 4PUUA 4GKLA 3C3UA 4FF7A 3W74A 1GGOA 2HPMA 1R3SA 3GTNA 2HBVA 4NRRA 1TV2A 3QR1A 1Q4WA 4GFIA 1HVXA 4O53A 3ITLA 1Q82J 3GG1A 3GUGA 3OVQA 4HCHA 5I3FA 1QI0A 1FIQC 2O9TA 4S3DA 2OX4A 4Z1DA 2PTYA 4I3GA 1JNDA 4RNHA 2DY3A 2WMHA 4MAVA 4QXIA 4PMOA 3WX7A 1EP3A 2J24A 3TA9A 1TREA 1R6WA 2Y8KA 3W23A 1C92A 4E3VA 4AY1A 3EOEA 5JVHJ 4DXKA 4HIBA 1IR1A 1UD6A 2Z0IA 4NXKA 3PJWA 5CLTA 1UB3A 1K70A 3T9PA 3WH8A 4URIA 3GDKA 7REQA 2ABAA 2DUZA 1LP6A 2VNCA 1GT8A 3QPYA 1Q7ZA 1WXJA 4JTUA 2ZVRA 1F8IA 3VIIA 2FZ8A 2OT1A 1F76A 3MKKA 3ZR4A 3BLOA 2WBGA 1UD2A 4GLEA 4X60A 7TIMA 4U5IA 4I6VA 3WLKX 4F3HA 3SSZA 5AYYA 4LANA 1LQ2A 3A4XA 1YQ2A 3AO0A 4JY8A 4W85A 1PWLA 3PG8A 4KCVA 4KT2A 2UBPC 3MTWA 2FMOA 3TTEA 5DY2A 2YB4A 3KS6A 3PWGA 3QBUA 5A8PA 2C1GA 1EUNA 2QA4H 5TD4A 2CLMA 2PUZA 2FQIA 2VHLA 1DXFA 1SW0A 3R25A 3HN3A 3WK0A 1EA9C 4UR8A 1MFUA 4UMCA 3P93A 3I7SA 3CWOX 4JEJA 1TR1A 3ABRA 1AW5A 1R2SA 3SRKA 1F3WA 1GWJA 3T2OA 2JIWA 4GA5A 4DRSA 3HFYA 4ROQA 1YADA 1IEXA 3R13A 5GNXA 3QSRA 4LBUA 3TAKA 4E5TA 4NRSA 4RK8A 3LMZA 3L5AA 4LVBA 1TA3A 1DWAM 4C80A 1BGGA 3GO2A 2ZC1A 1FFQA 5EMUA 1EL3A 4KGLA 4I8DA 3U5YA 3W7GA 1V3MA 3HPXA 4S3EA 1O95A 4O1FA 4XAFA 1CLKA 2FB2A 3R0KA 4FLSA 2V2DA 3RLGA 1E0UA 4UC5A 1TE1A 2ZCGA 4HPXA 3GR8A 3O6AA 4XX6A 4ZQPA 3YPIA 1KQSH 4GUGA 5HMEA 1TJ1A 1JFHA 3Q65A 1KNWA 2QF7A 4QBXA 4C6OA 1K1DA 1N5WB 3JU2A 3AJXA 3WDHA 3E1F1 1N82A 3OEXA 5A95A 4NU7A 1VQTA 3A3WA 3DFYA 4X2PA 2FTWA 3OU8A 1KR1A 2H8ZA 5BNKA 2C0HA 3I4EA 4GC3A 3CL6A 3TJIA 3MUXA 5M17A 2A3BA 3NVYC 3TQVA 1BVNP 2D0HA 1UKOA 1CI1A 1L0PA 5JBFA 2WC4A 5DQPA 1JROB 3W2NA 3GHSA 2H8XA 3KTXA 2J4GA 3TTQA 1VEPA 3KM8A 3VIPA 4MNJA 1IIGA 4LNCA 3EX4A 3O16A 1VDVA 2TPTA 4PL2A 1UUMA 4BI7A 3AWOA 1GQIA 2GDVA 3HFTA 3LDVA 1HKKA 3UXIA 1W1YA 3L7RA 3BUVA 1XICA 4H9ZA 3FKKA 3UY7A 4CQBA 3KLKA 5HWMA 1SPQA 1WNOA 3CPUA 4PB4A 4W9TA 3HPAA 3DHPA 4OT7A 1VRDA 4HHLA 3AHTA 3DFSA 1CGXA 4ML9A 3H5QA 1FH9A 4ZB2A 3CL8A 3KL0A 2VOMA 3RU6A 3GC4A 3NDZA 1AZYA 3TLQA 4AEFA 1YW1A 3P6LA 5D9OA 3UFYA 2NW0A 4M8UA 4P7NA 1MEIA 2CITA 1XSKA 2BXZA 4W84A 5FEZA 4U31A 3MV11 3TFCA 1GHSA 4MJMA 1YXCA 1J18A 4QR6A 3WD0A 4YTQA 5LYRA 5EMJA 1ISWA 4REQB 2I14A 3E74A 1SB3A 2PF8A 1N55A 3L4TA 2W6RA 4O10A 5CSSA 2VFDA 1ZAHA 1BYDA 4ZB0A 3FY1A 1VLBA 4PSPA 3UNTA 2EEXA 1H11A 3KHDA 1H7NA 1HP4A 4TMBA 4AH7A 1B0IA 1E6NA 4Z42C 1X1OA 1O1HA 4YMZA 4NSBA 4K38A 2OODA 4IGNA 3NUKA 3OQEA 2GDQA 3N9KA 2NUXA 3PJUA 1P0DA 4LC8A 4O8AA 2POZA 3B3DA 2EF9A 2ZJQJ 3TK7A 1IXNA 1BLIA 4QJ4B 3WNOA 1E6RA 3BARA 3W00A 1H41A 2CLEA 1V93A 3Q94A 4POCA 9CGTA 4WGHA 4QCEA 2D24A 2WV8A 1JCLA 1TUXA 2V82A 3W2UA 4D8AA 2CBIA 5CH9A 5BYWA 2E8YA 2WXDM 1HL9A 3SCOA 3QR0A 1UBPC 4MKVA 4D6GA 3CO8A 1T6MA 1KB3A 2J79A 1SJDA 2O7QA 1HT6A 3DFNA 1JRBA 3N18A 2C3ZA 4P7QA 2TAAA 3UWVA 1HNYA 3TZFA 1D9EA 2TRSA 4ZR8A 4JTAA 3D3AA 4MZYA 5HOSA 4QGCA 1TWSA 5HUPA 3A13A 1PIFA 4FZIA 1ZNNA 3LHTA 3AMKA 2ZJRJ 5REQB 8TIMA 4UTUA 2EG6A 2XFRA 1J79A 2IMRA 4GISA 4H8NA 5AN7A 2R91A 4ADUA 1A53A 4EADA 1SFSA 2P8CA 3URNA 4QITA 4K7VA 4FA3A 2VGBA 3TQPA 1O66A 4HGXA 5FF7A 3U3HA 3GRIA 1PEZA 5CGQA 3TYAA 2FGBA 5BRQA 3TCEA 2G3IA 1Q6RA 3B8WA 4P7RA 4NIRA 2D22A 4MTVA 2VXNA 3SB0A 5BZAA 4IMAA 4UNLA 1LCOA 4FNRA 5E6ZA 5M2FX 3MUAA 3NQ2A 4X9SA 4PMVA 2QF8A 1KM5A 2A21A 3W29A 4RNIA 1RSCA 1VFOA 1W1A1 3LOTA 1JZ5A 1CDGA 5K4ZA 5FL1A 2QUMA 3G0XA 2D2GA 2DZBA 1THFD 3L21A 4PUEA 4ICCX 1LT8A 2XPKA 5G4EA 1YPFA 2RGLA 8RUCA 3K8KA 4DJEA 4XZLX 1EHAA 3NQCA 1EOKA 3TOYA 4U4MA 4ADSA 2QHAA 3PZOA 2AQVA 4HA4A 1VBJA 5F1VA 1EBGA 1E9LA 3N6QA 3GVRA 4DHGA 3T42A 3GR4A 4HCLA 1DOSA 2NLIA 5LIYX 1S2WA 5A94A 3CPWH 3IIOA 1C91A 3E2RA 1JD9A 3UVIA 2PDKA 1TTJA 3LCLA 1XIFA 3MP4A 4N42A 1DIEA 1POJA 2A4AA 4HU0A 3CPGA 1RM6A 2R82A 1KFWA 5CXPA 1FVPA 1EP2A 3HPSA 4QRNA 3S2CA 1ONEA 4IMFA 3KRUA 2HNHA 1VFFA 3CK5A 2IQTA 2XU2A 4AHQA 3WH9A 1RBAA 1XGDA 3E0VA 3PPCA 3QY7A 3RO8A 1GJPA 1RD6A 1TQJA 4XD5A 4ECLA 3GXNA 1JVNA 3EDDA 3TNOA 2XN1A 1FCQA 3GU1A 2NV1A 3M7WA 1K8ZA 3CEPA 4FX8A 2JEQA 2A3HA 4PTDA 1IXOA 2OKOA 3HQPA 3OLEA 4US8A 3DC8A 3CCSH 3PZTA 5CKSA 4N9BA 2F8QA 1J96A 4P8XA 2Y4SA 4TOQA 3U7BA 3ZZ1A 5HWJA 1FWRA 1Q7MA 1SUXA 4NYYA 3ZLHA 3DBNA 3PB2A 2YCLB 3NGFA 3CZ8A 1L6GA 1X1ZA 4AD5A 2PDHA 3WDRA 4ZCWA 2ZRYA 2NX9A 3BLKA 2QMJA 4PUKA 5FCZA 2R1MA 1U5JA 2J27A 5JXQA 3CQ0A 3AICA 3PF3A 1OZMA 1JCNA 4H19A 1EO5A 1O5QA 3EZ4A 4GMEA 4BHYA 2BFGA 4V27A 4MAZA 1ZBCA 1GG0A 4UY8M 1PKLA 1GQJA 3ZSTA 1HZYA 4ZVJA 4UBPC 1LYXA 3CV2A 3LXBA 1FHDA 3S9IA 5GAEN 1AK5A 3TCSA 1DIKA 2J75A 2PLKA 1UH2A 5A1AA 1E6XM 3H54A 2WK5A 2P0IA 3JR2A 3KHJA 1AG1O 3V0TA 1HJQA 2W5FA 1H62A 4GZ7A 3ZJ7A 1KXVA 2HSAA 3FYPA 3MQTA 2FDMA 3FA3A 4ZODA 2PP3A 1W1VA 5JIPA 1TMHA 2QJIA 5A6AA 1CENA 4UOJA 3FCPA 2A3AA 1GONA 1WKEA 3WD3A 2ON3A 3IPWA 3SUSA 1L2QA 3CIVA 3Q67A 3E2QA 3UPBA 3AYSA 1G69A 5I78A 4UTMA 2IQ0A 1HQTA 3N11A 1W9PA 2QUTA 3KUMA 3MKCA 4K8EA 2Y70A 2YW3A 1XYBA 3TUUA 1UASA 3I55H 2V30A 4TX9A 2ACUA 2FFCA 1CXIA 1U30A 1OGSA 5PTDA 1UKTA 3NGJA 4B3ZA 1OG6A 1KFLA 1ITQA 3CMGA 3R89A 3T2QA 3ARSA 2UY2A 2ZUMA 2PE4A 3INPA 5A2AA 2PDBA 2CBUA 3HQ1A 3XINA 4NJGA 4KWSA 2F6KA 1M03A 3CO4A 4DLMA 1FWHC 3LPFA 4ZQNA 1JQVA 3QMRA 5D38A 5CBBA 1TV5A 4GZIA 2G3NA 3CTTA 2E3TA 1PE1A 2YL8A 3AFBA 1ICQA 1K77A 4GWEA 1I9CB 4J4KA 4IISA 5AYIA 2GQ8A 5SWUA 1I8JA 4NI3A 3SCQA 2VX7A 1EJSC 2Z2UA 5HJYA 1GOOA 2PDWA 4H2CA 4UQAA 1S39A 2DQXA 2AKZA 3ZQ9A 4GQRA 3R5EA 2EPMX 1HVQA 4CLMA 1RVGA 1B3ZA 1DIOA 1W3IA 3KL3A 3PWAA 4WRHA 3S5SA 3EKZA 3W1RA 3V0SA 1UJQA 5AFDA 2DZAA 3PZIA 5E93A 2ONEA 4N9EA 1W3KA 4FIQA 1OX4B 3G3MA 4PMXA 1F3EA 4ZE5A 1C3FA 2OZ0A 4R9OA 3W84A 4DF1A 3B9EA 3LHYA 4RV8A 1VCGA 3GE7A 1MUWA 3GIYA 4YCPA 3W3OA 5CEWA 1REQB 4W89A 3PK7A 4XZ9A 4H9UA 4U67J 5KITA 3GDRA 1JCYA 3IVUA 3PZUA 5IDIA 2ZZ2A 4N6FA 4J3WA 5HR7A 1KO0A 4JS3A 5LHEA 4QNEA 4LUTB 3ANUA 2J47A 3H21A 2JF6A 2OKTA 1PUDA 4IQEA 1T5AA 1RCOB 2A79A 4B2DD 4Y8EA 3OP2A 2TYSA 4QDMA 2V3EA 4D6DA 4LWWA 5D05A 4HSOA 4DUVA 3FVMA 1V4YA 4K68A 2GUUA 3ZJ6A 2KAUC 2CXEA 3TN5A 3USZA 3WQWA 2DDXA 5MKGB 1P7TB 2CNCA 2ACQA 2VZTA 2DORA 1GVQA 4XZNX 2YDAA 4N4QA 3BICA 1GOWA 4JTGA 1H09A 3ZR5A 5FSEC 2GGHA 2XWEA 3PUDA 2HK0A 3BZGA 3WO1A 4PTVA 4PFHA 1FWFC 3CS2A 5DO8A 4CEXC 2PBOA 5KSWA 3SAZA 3T2PA 4C7YA 2XFFA 4Y9PA 3GNRA 4FNUA 1BYCA 1HF6A 4UFKA 1PYFA 4MKNA 3NG3A 3U5UA 1ECEA 5JBDA 1OGBA 3NO5A 5DCDA 3B9AA 4WOQA 3UWEA 1CTNA 1XIJA 1BSLA 2CFFA 3APGA 3WJWA 4JYDA 1Q8AA 1V7YA 1ZL1A 1LWHA 3WLIA 1DJYA 3KZSA 3C86A 4ZTXA 3NCOA 3CT2A 1ZGDA 4CD7A 4IGMA 1Q65A 5D2XA 3L2MA 4WCJA 5KZ6A 3VKAA 1VQ8H 4JTEA 1UC4A 4NJHA 1HTIA 1LT7A 3BH4A 4UQDA 3U0HA 3EWWA 1JDCA 4UMBA 3AIBA 3EDFA 5E9AA 1H2JA 2H9AB 3VIMA 3NYDA 4MWAE 1W2VA 3AXKA 2GOKA 2ISDA 4I9TA 3IIXA 1US0A 4IMCA 2V5DA 4P61A 3QW3A 1EFZA 3CCMH 4ZOAA 1E40A 3DG6A 2IUZA 4H4IA 3ABOA 1KLZA 3FGCB 3VX1A 4AVNA 3U2EA 3J7ZM 1NU5A 3VCCA 1KW1A 4S3JA 3GFYA 3HJZA 1TTIA 4KGJA 3LZ3A 1D8CA 1F73A 3BAIA 4J2MA 5JMUA 4KFPA 2A3CA 1QUMA 3GH7A 1QBAA 3UPMA 3HV9A 1ZXIB 4NX5A 1YDNA 2V63A 4ONVA 3ATZA 4IFOA 2ACRA 1VS1A 2HPIA 2IKJA 5CC3A 2VX5A 3B9NA 3IGXA 1S3HA 1N60B 2IPWA 2NQHA 1MFVA 3T05A 5JH2A 3N73A 2BLEA 5HQEA 3MC5A 4JBRA 4RV3A 1XDLA 3NXLA 3VNLA 1BGAA 1K9DA 3G0UA 1MNZA 5GPRA 1IE7C 4FOKA 1XCFA 4R3UA 4O54A 5AKQA 1KA9F 3TSDA 5LZLA 4J3XA 5CQ1A 3WNNA 2GVJA 1J11A 1UIPA 2IQDA 4U2ZA 4W93A 4FSAA 1K73J 1AZ2A 4HJWA 2AMXA 1NIUA 3T0AA 5DM7J 7CGTA 4FX6M 4A4AA 1RPXA 2D0FA 3N13A 3WLSA 3H2OA 3M0JA 3WFLA 4LSBA 3PSWA 3L23A 1XSIA 1EKOA 3B05A 1US3A 3SN0A 2OU4A 1TPB1 4GABA 4H6QA 5DT7A 4IMDA 2HS6A 2WQPA 1B3WA 2XM1A 2HVOA 2HMCA 2PDCA 1XM3A 4G7EA 3FDKA 4J3ZA 2DJXA 4OVXA 1LWIA 2E5DA 1G4EA 2OELA 3AIEA 1WZAA 3TW6A 1VPYA 2OG9A 4A22A 3SCSA 1QXLA 1ZHAA 4CU8A 4C6EA 1Y8BA 2G37A 3O6DA 3FEQA 3P14A 1GQLA 2PAJA 1PKYA 4HBKA 3TN4A 3W07A 5HWNA 4GINA 4XWUA 3HV8A 1I2PA 4BF7A 3NVTA 1XIBA 1BEUA 1S2UA 2F7FA 3RLVA 2HK1A 3AQUA 3VNMA 5ABFB 3EXTA 3UZJA 2DZXA 1T8QA 4R7WA 4HT3A 5A6KA 4N7QA 4QROA 3CPRA 1V6TA 5KINA 5D9NA 4B5TA 4B3KA 4H01A 1W8GA 4L9YA 3GH5A 3DYMA 5F4SA 2VDHA 4PCFA 4JNMA 1CB2A 1ZBWA 5BRPA 2VEGA 4J28A 4JFWA 4GBDA 2E77A 4MUPA 4O11A 3K13A 1BF2A 3QRHA 3T08A 2QVHA 4CQ8A 1QFEA 3GG0A 2QMKA 4IIFA 3WELA 1DJWA 1LORA 2BGNE 3VGHA 4Q8OA 1M04A 4TIMA 3T55A 1ZENA 2WVUA 4PZVA 3NQAA 3FXGA 4CQCA 1HKMA 1QATA 2XDFA 4J2PA 3IIPA 3OHMB 2X1IA 3I56H 4CN6A 2Y7EA 1FWIC 1PVNA 2NUYA 2FZ9A 5BXSA 1OFQA 3P67A 4X63A 1PCKA 4UCFA 4NZ4A 1TPWA 2Y24A 2CLKA 2DSJA 1X6NA 4FB7A 1DJHA 3B9OA 2VVSA 4DNHA 2XSBA 3QZAA 3GR7A 3VXGA 1K03A 3AZRA 1E0WA 2XIIA 2VFFA 4PCPA 3RM8A 3C61A 4HNVA 1B2YA 1GOMA 2JE8A 2Y63A 2OZTA 1A5CA 3BLDA 1SMAA 1TX2A 4UQBA 4XK2A 4CVUA 3HPZA 3KEHA 2XIBA 4QLJA 4I6KA 4YTRA 3TP4A 1Q5MA 4MSSA 2VWTA 5HDRA 1CEOA 5BU9A 1IGSA 3EX2A 6A3HA 1B4EA 1NJJA 3N6JA 5MLCO 4LU0A 3NQFA 1SU5A 4C6CA 3QGKC 3UF9A 1JXJA 1XBZA 2BY1A 2RAGA 3ARYA 3VNIA 3PIOJ 3UA3A 2Y5SA 3MCNA 4PMYA 1OC6A 1Q8JA 3F4VA 1EJXC 3NURA 1P1XA 6XIMA 2NLYA 4E2DA 3NJ3A 1GKRA 4NXSA 5LA2A 4JOMA 1HL8A 2QPXA 2ISSA 2JKAA 4C6FA 2ZZ5A 4L5ZA 1JUEA 3SN1A 4MYAA 2E3ZA 4BR1A 3GU2A 3O2LA 5FF2A 4IQLA 3T0DA 4D1IA 2YDRA 3FSTA 1VYPX 3N2CA 3RLUA 2VEKA 1IWBA 1F3TA 1I0DA 4Q7NA 3VC5A 2W3RB 3AROA 2VVNA 4MMWA 1UMLA 1DEDA 1E3XA 1OX5A 1FCUA 3LRMA 1P6CA 1DHPA 2YCJA 1GKQA 4H83A 4ZFCA 3E5BA 1VQLH 5K9CA 1FKXA 3OVPA 1UR1A 4LUSB 3CB8A 4PMDA 1TCMA 4HNLA 1QI3A 1XYFA 3C52A 5F2IA 1H50A 1H7PA 1HGYA 4IQJA 5MPOC 4JYEA 5LNVA 5KEZA 2H3BA 3QTPA 1E4IA 5FAGA 1S2CA 2BY2A 2QJHA 3PUEA 3WLLA 3K46A 3WEZA 4M6QA 3G8EA 2YCLA 3S9ZA 4WIWA 3W1TA 5CCZA 1HJUA 3LI1A 4F2UA 1BG4A 4GNKB 1XIGA 1VYSX 3QC3A 3RPTA 2E67A 4AYSA 1IT8A 4DJFC 2PP1A 3QLLA 4Q3MA 1BF6A 1LBFA 4EXQA 4AC7C 2J9ZA 1O68A 1UOZA 4DI8A 2ODOA 4KEMA 2BX7A 2Z6IA 2VWSA 2XN2A 3TVAA 5G4WA 3KW3A 1RJPA 2ASHA 2DH3A 5J04A 2TODA 4C7DA 3A3HA 4G5DA 1OQFA 3GXPA 2WCSA 3VX0A 2YCKX 4LEQA 1W1PA 5I3DA 4JKKA 4RZ6A 1YPXA 1C90A 2XINA 2JQXA 3UD6A 4IX2A 1B57A 3WQVA 5CZ0A 3WLOA 3VCRA 1FCBA 4JIHA 4WZHA 4MLRA 2OPJA 2RDUA 1EEPA 1M90J 3WUEA 1YE4A 1VC4A 4F40A 1FQ0A 4TU1A 4PYSA 2D2JA 2ZX6A 3IACA 1UKPA 3U2CA 1VQ7H 3B04A 4ORIA 3ETRC 2F61A 3KBSA 4IM4A 3N04A 4KCUA 1TE6A 2V81A 3TW7A 1J4EA 4AZCB 2REQB 3STGA 3U4AA 3LHVA 2TSYA 3DESA 4MG4A 1MW0A 4LHMA 2F9RA 1CXLA 2WSRA 3L0KA 1EIXA 3GHRA 3WLPA 1BYAA 5CPQA 3P0XA 3WEMA 3F2CA 2BGQA 3FN9A 2CKRA 4LRSA 4C60A 4ATLA 4I9AA 1XDMA 4RCXA 1RVKA 5C71A 3E2SA 3W7PA 4IXXA 4Q4MA 4GY1A 4L6DA 4NI8A 2GJXA 2Z1SA 1UH3A 3B97A 3QZ6A 4B5NA 2R1PA 1L9WA 4GJ1A 3GDLA 4UTIA 3N14A 2NQLA 4FNQA 4IFKB 2VM8A 2W67A 3SGZA 5JIWA 2B31A 4JAWA 1NOWA 3GBDA 4DNMA 3LCXA 3DBPA 4NAEA 1UWQA 1WKYA 3PIPJ 2QCDB 1EB3A 1GOQA 1DXEA 1OYAA 4XSMA 4Y9OA 5DX7A 2YGYA 1BHGA 2YBVA 6REQA 1OG0A 4LBSA 1FDJA 4XTIA 2FH6A 4QHRA 2Y2WA 4B5UA 4LUYA 2W27A 4ES4A 4HNNA 3LCGA 5DCBA 1YHQH 2YCEA 1JPMA 4HPGA 3UEQA 1AL8A 3MYOA 2AQWA 5H8PA 3R4IA 4GJJA 4LV9A 1J2BA 4C6IA 2HWGA 4IHCA 1D8WA 2ISWA 5D2TA 4A35A 3DC0A 3MSDA 1FWAC 1VR6A 1W1TA 9RUBA 3R0UA 1O12A 2E8ZA 3A3XA 1QW7A 1UWTA 4A3YA 3GG8A 1TPUA 3VIKA 3VE7A 2W92A 4EK7A 2E0PA 4J27A 7PTDA 4ZSTA 4ZL1A 1RR2A 1VLIA 1O4UA 3BK0A 4Q8QA 5CJ5A 3VFLA 3FJLA 2HCVA 4FF5A 1NTHA 4UXDA 4FOJA 4A05A 3GTHA 1OYBA 1XLMA 5HANA 4LAKA 1P7TA 3G8RA 2C14A 1GORA 1XBYA 1UZ1A 3ZO9A 1KWGA 4A3RA 1VENA 3HZ3A 3M0ZA 1GQKA 4O4WA 1FWNA 2WMGA 1V6WA 3AXXA 4LAZA 2FPTA 4ACZA 3P62A 3LLDA 4AQLA 3N3TA 1EX5A 4NF7A 3W7MA 3ZVIA 2ZADA 2YKKA 4W86A 3MY9A 3FC4A 1YTKA 1XINA 2D2OA 4C1KA 1EC8A 1RD5A 1B30A 1W91A 3AHYA 4C6MA 4HMEA 1FWDC 3M0LA 2ZUTA 1PDYA 3H4WA 1J6OA 3A47A 1XPYA 1R30A 3LPGA 1W32A 2VD9A 4C5YA 4Y9AA 3B40A 2PRMA 1GHRA 1M41A 2WMIB 4EOUA 3WDJA 1PAMA 3T1GA 2VQUA 4PRTA 2DZTA 4X3ZA 3N19B 2QQ6A 1UW9A 3LTSA 4NVTA 3FAXA 5E9XA 3VC6A 3MMDA 1Q85A 1W0MA 3O6YX 4NY2A 3MT1A 3BAJA 2PSNA 5D30A 2ZZ1A 2I9UA 3NPUA 1HXJA 4D6HA 4R7OA 2YDSA 4LX4A 4LYQA 1SZRA 3OZYA 1WDWA 1Z3NA 1JDAA 5DBTA 3ARUA 2C7FA 3TONA 5T9BG 5AC5A 3WUGA 4M80A 2POTA 3ABZA 3PBYA 1B4KA 5EPDA 1CLXA 3VPLA 4ZZ9A 3H2FA 3SRHA 1YITH 2D23A 4AHPA 1KFKA 1OEPA 2VX6A 3NFUA 1XGZA 1J0YA 3Q37A 4GYPC 2LLEA 2J74A 2EKGA 4YWSA 1JNEA 1W31A 3GG7A 1ISVA 4C1LA 4DQWA 1RUSA 1MXDA 3ONBA 3ANVA 3O15A 4Q4QA 3B8TA 1S2TA 4K1WA 4QDPA 1N8WA 1MNSA 2EPOA 3PHAA 3UWQA 3M6DA 4XZMX 1TX0A 2HEJA 4MOZA 5LIXX 1YBQB 3B4YA 1JI1A 1JJKA 3NSNA 4UTWC 3CNYA 3GNXA 4ZQOA 1LL4A 3DEQA 3OJGA 1NP2A 3ENLA 1JF5A 3H2NA 3EA1A 2UWFA 1H5VA 4B3LA 3FAWA 5CGMA 1TV8A 2WZHA 1KM1A 3LY0A 2XUCA 1VAHA 4GUJA 1Q86J 4H9XA 4GCAA 2YXXA 5I03A 2XZ9A 3D5HA 3VIOA 5C7HA 4IG2B 4I8YA 3VGDA 3LENA 4NJJA 3CZGA 8XIAA 1HKIA 3RMEA 3H8AA 4JTIA 3JZEA 2XM2A 4IX0A 2GJLA 1M7OA 4Q8WA 3WQ4A 1RY8A 4DF0A 4KWOA 2BVTA 4NNAA 3W26A 5D2VA 4WDTA 4EKJA 5EP8A 1NDVA 3CAWA 1WKDA 4TV6A 4RDYA 3NL2A 1L8PA 1E0XA 3THDA 1VBRA 3CIWA 1EH9A 4HN8A 4IUGA 1EZ2A 1E4LA 2QCGA 2J0FA 2V5JA 1EJRC 2XVPA 1V3HA 3VM5A 5AYXA 2ADAA 1W5QA 3VZXA 4C91A 4V33A 2XSXA 4WFAJ 1LOLA 2V9DA 4PMJA 5KETA 3H6OA 4D6EA 1R46A 5HL7J 1EJ7L 2YA0A 5DELA 5E5CA 3LGEA 4NZJA 3GUWA 3WQFA 4LS1A 5AYBA 1WV2A 4NHVA 1HO4A 1U1UA 3IV8A 1W9BM 3LCFA 5FAJA 3AM9A 1QVGH 2FTPA 4DBDA 4RDWA 2GWGA 3SUTA 1BRWA 3TEVA 3MMTA 1XXXA 3LQGA 2HRWA 1I1WA 1I60A 3HG5A 3NEHA 4JFTA 2XTKA 1VJIA 3CMEH 1MW1A 2XIOA 2NZLA 1K4GA 4IICA 3CHCA 3KL5A 3TC3A 1JR1A 1YJ9H 3TNBA 2VEMA 1NVMA 4ZQMA 4B90A 4S3BA 2QCNA 1E6ZA 1ELSA 1W3HA 4DVOA 5CPTA 1I1XA 3NL5A 3SCTA 4Q6JA 3FA5A 2PLCA 2G8ZA 5EMYA 2W61A 3U4FA 3WH5A 1J01A 1LLWA 2PWFA 1FHUA 2DQWA 1HKVA 1VZWA 3WLNA 3OBKA 3KCOA 2YBTA 1V03A 3C8FA 3QMTA 4IPLA 1TVNA 2PBGA 3QLDA 1IXPA 2VC7A 4KRZA 6TIMA 3EPNA 2WP4A 5FA5A 3S1WA 5TIMA 2J78A 1PSCA 1KGWA 3M46A 4JZ5A 5IRPA 5DF0A 4JFSA 4WF7A 2Z1BA 3S1VA 3U2ZA 3IJ9A 1LUCB 3GC2A 3DH7A 4HVXA 1K7EA 4HHPA 5A6JA 5CAKA 4G7FA 3ARXA 1SW7A 5E6YA 1O6IA 4JIIX 4WQ6A 3AMLA 1A5SA 3CEUA 4UFMA 1NFPA 2OQYA 4DO6A 3M0HA 1F7BA 4BQ5A 3S0CA 4BEUA 4L1GA 2QPSA 1Z69A 1FWGC 5L6UA 4DWSC 3LN3A 3M5YA 4AD3A 1CT5A 4BQ4A 1T8XA 4JHZA 1EJTC 3ES7A 5J8LA 4QP0A 3VIJA 1GYMA 2PWEA 2C16A 3SN4A 4S2CA 3TW9A 2EG7A 3NL6A 3EUB4 3N4AA 4JTCA 1RA5A 4O50A 2BBFA 2GVYA 1KBBA 5C7VA 8XIMA 5HR6A 3NZ1A 1MW2A 2QS8A 3ID7A 2VEPA 3CUFA 4X0NA 3PAOA 3IIVA 4D72A 5BOFA 4XKMA 4ORMA 5U4NA 3WL0A 4OUEA 3RILA 1VLWA 4Q4KA 3CAVA 4H9YA 3VMOA 3JRKA 1XPGA 3O0FA 5LIKX 4ZXOA 5CPNA 3CT7A 1IGWA 5A69A 3EMCA 2ALRA 4FLQA 4NNBA 1PKNA 2VQTA 3WBXA 3STFA 3WG6A 4LH8A 3UXKA 3GQYA 4ML4A 1OT1A 4ZFMA 5CGTA 4CD4A 2JFEX 4BQ2A 1YIJH 4Z08A 4CD6A 1DIDA 1V08A 2WNZA 3BLPX 2VFIA 5D03A 4QFUA 3N9RA 3QC0A 2OO6A 4XVEA 1L6YA 3QQWA 4QCFA 3M41A 3BMXA 2PTDA 5G1MA 3PSVA 4GPNA 4IP5A 4NILA 3NPXA 4DBEA 7REQB 5FACA 4O28A 2QJJA 4OBRA 1GOKA 4PMQA 4Q8PA 4GNVA 2NSOA 1QNPA 3ISIX 3O3RA 4DO5A 1H49A 4PBFA 4GQBA 1TG7A 5FD0A 5JVLA 2QKFA 2VRKA 3H24A 1V6VA 2MUCA 3ATYA 1PTDA 3KTSA 3LPOA 1ZCOA 3ALFA 3GY1A 4KEZA 3GSMA 2EBNA 5G5IA 3WMLA 2B7OA 2NWRA 5FJRA 2W79A 2Z26A 5I3HA 5I24A 3W6YA 1Q6GA 4R88A 1ME9A 3CUJA 3UWUA 1YDVA 5XIAA 2FIQA 5LGZA 2SFPA 4U10A 5IM51 4PB5A 4TUFA 3HBLA 5LNUA 1FA2A 1ZQ5A 3OGRA 1U5HA 1UP0A 5GAHN 2NX1A 2D20A 1DYSA 1M7PA 1XQKA 4KFOA 1Z8AA 2G95A 3M5VA 1YKWA 1NY1A 3FW6A 1HO1A 3AMDA 1TA3B 3UETA 2NVDA 2C1HA 3NZRA 3S2MA 3LGGA 5FOOA 3NYZA 1UWAA 1XG3A 3S9YA 2I57A 2I5QA 1EPXA 1OJXA 5FIPA 1B9BA 2DUAA 4JR5A 1A3HA 3RO6A 2YW4A 2ZFAA 3MVTA 2Q3OA 1QHOA 3V5FA 3CTLA 4E8CA 3ITVA 1DTUA 4GVGA 3L9CA 2G5WA 3QY8A 3TX9A 3KX6A 2JIEA 3DCPA 3KCLA 3HMJG 5I02A 2PPGA 3QSTA 3TYZA 3STCA 2CU0A 3V5CA 1VHCA 2WVSA 3EX1A 2VMFA 4NZCA 2CXGA 1G6CA 1G7VA 1O7AA 3VNKA 1TPC