5HUOA

Crystal structure of nadc deletion mutant in c2221 space group
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
283
structure length
283
Chain Sequence
TDLTPFQIDDTLKAALREDVHSEDYSTNAIFDHHGQAKVSLFAKEAGVLAGLTVFQRVFTLFDEVTFQNPHQFKDGDRLTSGDLVLEIIGSVRSLLTCERVALNFLQHLSGIASMTAAYVEALGDDRIKVFDTRKTTPNLRLFEKYAVRVGGGYNHRFNLSDAIMLKDNHIAAVGSVQKAIAQARAYAPFVKMVEVEVESLAAAEEAAAAGVDIIMLDNMSLEQIEQAITLIAGRSRIECSGNIDMTTISRFRGLAIDYVSSGSLTHSAKSLDFSMKGLTYLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Streptococcus pyogenes quinolinate-salvage pathway-structural and functional studies of quinolinate phosphoribosyl transferase and NH3 -dependent NAD(+) synthetase.
pubmed doi rcsb
source organism Streptococcus pyogenes ga06023
molecule tags Transferase
molecule keywords Nicotinate-nucleotide diphosphorylase (Carboxylating)
total genus 90
structure length 283
sequence length 283
chains with identical sequence B, C, E, F, H
ec nomenclature ec 2.4.2.19: Nicotinate-nucleotide diphosphorylase (carboxylating).
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01729 QRPTase_C Quinolinate phosphoribosyl transferase, C-terminal domain
A PF02749 QRPTase_N Quinolinate phosphoribosyl transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5huoA02
3.90.1170.20 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Quinolinate phosphoribosyl transferase, N-terminal domain 5huoA01
3KRUA 4HPJA 1P5BA 1QAPA 2TSYA 3THQA 3W7KA 5K3VA 2QCHA 3CC1A 3KXQA 2ZZ5A 5BOOA 1LOSA 3EEGA 3TQKA 1FWNA 3EXSA 5HWNA 3PUOA 1YPFA 5LNRA 3IV3A 4JTIA 2CLHA 1R30A 4ALDA 3HPXA 4CQ8A 2PURA 2FJKA 4JX6A 3LCIA 3N73A 4HKPA 5K9XA 1GEQA 1SZNA 1W8SA 3FKKA 1TB3A 5F1VA 2HS6A 1G7VA 1WAUA 4FIRA 1XKYA 3G0XA 3LCXA 5AYYA 3DFOA 4UMCA 4AAJA 4PEKA 1B9BA 1IIGA 3CIWA 2C6QA 3ZS4A 1D9EA 1K7EA 3RMJA 4M6VA 2C16A 1I4NA 4OT7A 2ZZ4A 1G67A 2ISVA 3CT7A 4FNRA 2NUYA 3O15A 3Q37A 1Z42A 4MLJA 2EPHA 1Q6LA 4MYAA 1N8FA 4KKXA 2B7OA 1EWDA 3O6YX 4KWVA 4K36A 3DHFA 5TBOA 2WNQA 3FLUA 1GG1A 4PTNA 2C15A 4O17A 2A7NA 2BLEA 5AHNA 1DQWA 3TFXA 1K8XA 2Q8ZA 3BG3A 1KFLA 1LORA 4MIMA 3DFNA 3IVTA 1ICSA 4MZYA 5FF3A 3P60A 4I7VA 2PC4A 1GVFA 2TPSA 1VHNA 3GKAA 3KHJA 4JTHA 2ABAA 3DZ1A 1EB3A 3E02A 4K8HA 5CPMA 1YADA 3KAOA 4MPQA 1FQ0A 1GJPA 4K7VA 4RR4A 2XN1A 5D2TA 4HT3A 1KFBA 4JX5A 5DCBA 3W88A 1OJXA 3UYCA 3MJYA 3LDVA 3E0IA 3IGXA 4TMCA 3S1WA 1OFOA 1NEYA 3G3MA 2Y62A 2HS8A 3DI1A 2OX1A 1R2RA 4ONVA 2RH9A 2V2HA 1LOQA 1X1OA 1UJPA 3KX6A 3MMTA 1VLWA 4RXGA 3GVGA 3SR7A 4O28A 1QDSA 1UB3A 3JR2A 4BI5A 2P1FA 4FX8A 3B0VC 2C19A 3W1LA 1LP6A 3EKZA 3W7EA 3O16A 1DORA 4JR5A 4ZQOA 2CLMA 4Z0SA 5F1UA 3G1AA 4LRSA 2A6NA 4FO4A 1L6SA 5LNVA 3UPWA 2ATMA 4PFMA 4DPPA 2Y70A 4K6AA 1MO0A 3P74A 2RDUA 3TA6A 3I7SA 1OK4A 4N9DA 4ICNA 1ICQA 4X9SA 3VI2A 3NM1A 5D32A 4KFOA 3EX1A 2NV2A 2ZRWA 3TFCA 1H5YA 1F05A 5F2GA 2GQ9A 4LC8A 3DAQA 3RU6A 5I3HA 3W2LA 5HMSA 1KLYA 1TPB1 3MBFA 3WK3A 3GXNA 3QH2A 5KTLA 2QCNA 4O53A 2Y6ZA 2CZFA 1LLZA 1R2TA 4A29A 3L0NA 1QFEA 4LS1A 1AG1O 3WJWA 3G0SA 1AMKA 1LDCA 3G1FA 3GLCA 3TROA 5D2XA 3W9ZA 4MLRA 2A7PA 4E38A 3KVMA 2RDWA 1JQXA 1WQ5A 4BF9A 1W31A 5EYWA 4BI6A 3ANYA 5K4ZA 4MZ8A 2V81A 5KZDA 5C2XA 3MP3A 1ZALA 1EP1A 1P0KA 2DORA 1IXQA 3M47A 2VFDA 2R91A 4NJGA 3W1XA 3GIYA 4OGZA 1EP2A 5CZJA 4NJHA 3S5OA 3SZ8A 3W83A 5K2ZA 2WSYA 1KFCA 5FEXA 5E1QA 1NAL1 4UTHA 2ZA2A 4O50A 1PS9A 2DZUA 1T99A 3NXFA 1SSGA 4GUIA 1VC4A 3W87A 1F7BA 3DU0A 2WOQA 3M16A 5LNUA 2G97A 3QSTA 2QCFA 2WSRA 4YCOA 1ZFJA 3BGJA 1U83A 4S2CA 1QPRA 2CLEA 2WKJA 2NLIA 3MHUA 4JTSA 5LNSA 4NX5A 4M7TA 1N7KA 3O63A 3BARA 1DBTA 3LHUA 5IBXA 2YFOA 3RFAA 3JRKA 1SO4A 3PC0A 5CZTA 1TJPA 4Y96A 4FF7A 4UIOA 5D02A 4A2RA 1ZAJA 4AHOA 2J9XA 4DF0A 1IF2A 3EWWA 3PR2A 1F74A 1JJKA 3NPWA 3W7NA 3SY5A 4HNVA 5E93A 2ISWA 3C2VA 4WOZA 2DZWA 3EWUA 1KM1A 4LVBA 5CPOA 3C0JA 4UFHA 2H3DA 1TV7A 3QMRA 3FJLA 3W85A 1VH7A 1H63A 1YPIA 1A50A 1GVQA 2ZYFA 3IIOA 2AAMA 1DV7A 3NVTA 4LW7A 5DBUA 5ABTA 4KFPA 1SW7A 1NSJA 4CCDA 4RKAA 3CHVA 4TR9A 3P8JA 3P5YA 4R53A 1LZOA 4N6FA 4OWGA 4CCCA 2Q8LA 2XN0A 1KFKA 4RZ5A 3NQDA 3W2KA 1NVMA 4MY8A 3N3MA 4A2SA 4JTKA 4LVAA 5AC7A 5H91A 1TREA 3C3NA 4NXKA 2YXGA 2EHHA 4LRTA 3QM3A 4QAIA 3G8RA 2E6FA 3UWZA 3RLUA 1PCWA 3VKJA 4GFSA 2A6LA 5D2YA 3NQ2A 4XZ9A 2PRMA 3G1DA 3P61A 1IXOA 4X2RA 1HO1A 6ALDA 4BFAA 4DBEA 4IPJA 4QISA 3LI1A 3OHIA 1BTMA 4O19A 4FX6M 3ABRA 3NL3A 1VYPX 1M7OA 5F4WA 3MYOA 1X1ZA 4O10A 4IJBA 3W73A 3TR2A 4WJEA 3IIZA 3GDRA 3F4NA 4OBTA 1W5NA 4YL2A 2X1RA 2VEPA 2YYTA 3QEZA 3BGGA 5H2ZA 1KFJA 1J2WA 1JULA 2ZDRA 3M6YA 3P8IA 2BSLA 1G6CA 1FDZA 4ADUA 2FB3A 1YLVA 7TIMA 4PC8A 4HHPA 1OHLA 1BWKA 1RD5A 1OFAA 2QCDA 1TTJA 1VQTA 5AN7A 3HQ1A 3NGJA 3UWQA 3W75A 4O12A 4EIVA 4DXVA 1JRBA 2CLFA 1W0MA 2A2IA 5K9DA 3NZRA 4NU7A 3TE9A 4FX7A 3C8FA 3LV6A 3HPSA 1VRDA 1SR9A 5KMYA 1X8FA 2VENA 5J5RA 1FDJA 1KV8A 3GNDA 3R12A 4Y90A 2RHGA 4JS3A 3TH6A 2AGKA 5IBXC 2ALDA 1G69A 3FIGA 4JYDA 5G1TA 4RZ6A 2A1YA 3LRKA 2NXGA 1QCWA 5AHLA 1H62A 5BMXA 1H1ZA 3O8AA 2V2CA 5DCEA 4C1LA 1WOBA 2QJHA 1KLZA 4CQ9A 2GOUA 4JY9A 3I65A 1VZWA 5C5YA 1OYBA 3OEXA 3W6YA 2VFIA 1QPOA 3PG8A 4JXCA 3KRZA 2JBMA 1AW5A 2HTMA 1K03A 3E9AA 4PL2A 3VFLA 3M43A 4QQ3A 4JICA 3U2OA 1IXPA 1YXDA 3IRDA 1JCJA 4CLMA 3N19B 1A5CA 4O11A 3N2XA 4JTUA 5F2IA 4UTKA 1IGSA 3R89A 2CZEA 1KTNA 4HSNA 4RZ4A 2O7SA 4OHQA 1TJRA 3HBLA 4BWLA 4HN4A 3HGRA 3FYPA 1M5WA 5MHBA 1NF0A 3O6DA 3MHGA 2WNNA 1LRQA 4N9EA 4EVZA 3GXPA 3FEMA 5AC6A 2E6AA 4NZFA 4N02A 3GDKA 1YDVA 2C3ZA 3S42A 3PY2A 3NA8A 3LV5A 1LRTA 1YTEA 2BWGA 4IWWA 2Q3RA 3M5ZA 4O57A 3EWBX 2NX3A 5F4SA 2WSQA 1LLWA 2ZQ0A 1OX6A 1O5KA 3G24A 3BW3A 1VYSX 4MOZA 3ZR4A 4O4WA 5HR6A 1TPUA 3O06A 3P80A 4K39A 4RCXA 1KBJA 1LCOA 2E6YA 2CLLA 3NOEA 1TTQA 1F6PA 3CU2A 3GDMA 4NZJA 3GR8A 2X1UA 3EWZA 5AHEA 2YX0A 3TK7A 4Q32A 3UY8A 2I9EA 3Q94A 4Z0JA 1VLIA 2ZTJA 3PBVA 3W3OA 2V30A 1BEUA 1RR2A 4NUWA 3T78A 4L4LA 3UWYA 2QDGA 2VFGA 3NQMA 5AHMA 3TMQA 2YDAA 2CZ5A 5TQLA 3W71A 1FXQA 4IMGA 1K8ZA 1EUAA 3L66A 3USBA 5G4EA 3E49A 5CG7A 3CEPA 3F03K 3U6WA 4AXKA 4ADTA 5HJLA 1I2PA 1KTCA 3TKFA 2E5BA 2BZNA 5BW6A 4MJZA 3C2FA 1EEPA 1LOLA 1Z44A 2HMCA 3AO0A 3DGRA 3O6CA 3W70A 5D2VA 1EWEA 3KVLA 2QUTA 1JRCA 2GQ8A 1HG3A 1S5VA 3P84A 1XM3A 4WX2A 1M6JA 1G4TA 4M7SA 3TX9A 1LTDA 1KW1A 4LOCA 1R2SA 4UNKA 4MJMA 1H7OA 3SIZA 4AMAA 1XFBA 2QCEA 1OFBA 3NQVA 5BMWA 3R8RA 2GVLA 4GXMA 4N9CA 3DFQA 4O0KA 4IMFA 4X3ZA 4HNUA 1XI3A 1OABA 1ZNNA 3LXCA 5DCDA 2Y7EA 1O95A 1TQJA 3W1RA 3ABQA 1SSDA 3P81A 3WJZA 3WJYA 1XC4A 1T96A 5HNRA 3RNDA 5TIMA 5E0KA 2ZZ7A 2ZRVA 4FB7A 5G2WA 4DELA 4OE7A 4LS2A 1XBYA 1H7XA 4MY9A 3L65A 4NNBA 4JX4A 2X1SA 3W2UA 1J5TA 2X30A 3KRSA 1H7RA 2OZ0A 3IGSA 2QEZA 1VJIA 3PG9A 4UFMA 2OCZA 5T26A 5C55A 1FCVA 1R46A 2XN2A 3BG5A 5CGQA 1P1XA 1U5JA 4UC5A 2DZPA 1JR1A 3TSDA 3TMLA 4IQLA 5KINA 1H61A 4JTJA 4AF0A 4DQWA 1D3HA 1XUZA 3PB0A 2WJZA 3L21A 2F84A 3IEBA 3S8HA 3F4WA 3Q2DA 2QJIA 2OJPA 1QR7A 3ATYA 3IVSA 2R14A 1PCKA 1H1YA 3HG3A 1W56A 3EX3A 3V75A 1FDYA 1EPXA 1O60A 3S1VA 4OQVA 3A22A 4YWIA 2J6XA 3QQ0A 1FCQA 2DJXA 3RK8A 3GDLA 4YXGA 4QNWA 3G1HA 5GVJA 2FPVA 3P7YA 3EB2A 5FF0A 2GQAA 1W1ZA 4XBKA 3QMSA 1LBLA 4CNNA 5FF7A 4ZVJA 1GQNA 3PBWA 3W2NA 2PE4A 1ZY9A 4H6KA 3TU9A 1WBHA 3HGJA 2WPBA 4AB4A 1PVNA 4UTTC 2JKEA 3HG2A 4AWSA 3LBCA 3M5YA 1H60A 3STCA 4AF0B 3C2OA 1QOPA 3SECA 3OVRA 3EX2A 3LLDA 1XBXA 3NYZA 4WY0F 4QNEA 2V2DA 1YYAA 1A53A 3S9YA 1TRDA 3NM3A 1VYRA 3CWOX 4HSOA 4AHPA 1ADOA 1V5XA 1W54A 3ABOA 3P62A 5DELA 4DEFA 4D2JA 5FEPA 5K7JA 1NFBA 3LTSA 3LM7A 3CQ0A 1MEWA 1XDLA 2H3BA 1W5MA 3DXIA 4IMEA 3W86A 2FLIA 3S6DA 3DFSA 4JD4A 2CZDA 1LBMA 3FJ6A 4GUGA 4O14A 4UFKA 1RQHA 5HINA 4O4VA 1WA3A 2HSAA 4XTIA 3U8GA 1DJQA 4UR8A 5K9CA 1PE1A 2VKZG 5IM51 1F6KA 3W7GA 4AWUA 2KZHA 2GVGA 3IIVA 3DI0A 1O5XA 5U4NA 3GR7A 3CLMA 2VFEA 2H8ZA 1W5PA 4ORMA 4UR7A 4PA8A 1Q6OA 2Y85A 3A5VA 3QQ1A 5FI8A 3G22A 4ZQCA 3G1VA 3LCWA 1OFDA 3M7WA 1L6YA 1OF6A 2QJGA 1SPQA 1FWRA 2ZBTA 4JTTA 2FTPA 2W6RA 1C29A 1QWGA 3ZFHA 3HO8A 1LRNA 1WOAA 2YCEA 4GJ1A 4LVFA 4M5PA 4LNYA 5HWJA 1QPQA 4EOUA 4UMAA 2GUUA 5KZMA 3E96A 4CNPA 1TPWA 3CIXA 4GUJA 2EF9A 3NPVA 5G5IA 3FA5A 3DKJA 5DN1A 1K3UA 5AHFA 3B0UX 1XXXA 4FNPA 3S5YA 4PH6A 3UY7A 1B57A 1OX5A 2CW6A 1MEHA 1VCVA 4LTSA 3S1UA 5HR7A 2ZRZA 1P0NA 3PM6A 2P0OA 2C0AA 5I3GA 2QCLA 3IIPA 3GK0A 1G7UA 1RQEA 1OFPA 3OBKA 1JCNA 1XDMA 2QR6A 2E09A 3C52A 1ME8A 1GVOA 5FF2A 1FBAA 3S5NA 4UTUA 1YDNA 4GNJA 1JCYA 2F7FA 2QCMA 3TC6A 2RDTA 2VEIA 4I7UA 4R33A 3FS2A 1AW1A 4DO4A 2VEMA 3TV8A 1ALDA 2W79A 4K38A 3SGZA 4JIQA 1C9DA 2B7PA 2GJNA 1ME9A 3M1ZA 2GJLA 1BKSA 3GZ3A 2QDHA 1G4EA 2J88A 3P5ZA 3WJSA 2A85A 4ML9A 4Z08A 4IGHA 1NF7A 3T7VA 1KM6A 5EPDA 1OF8A 5G1YA 1FXPA 3NQGA 3ZWSA 4IOTA 1YXYA 3A9IA 2V82A 4IMCA 2H8XA 2V0TA 2A5HA 4N4QA 3LCHA 3W22A 4UTWA 3T44A 1OX4A 4NJKA 3UWUA 3VNDA 2EGZA 2Y89A 4UTMA 2ZZ2A 3W1PA 1HO4A 3W2JA 3GX9A 1MEIA 4G1KA 4RK8A 5EA9A 4EWND 3BW2A 2YZRA 1S3HA 3T4CA 2O7QA 2TMDA 2VC6A 3EWXA 1KM5A 4TO8A 3EXTA 3RF9A 2CLIA 2VFFA 2OT0A 4JYFA 3NNTA 3NQ8A 5AYXA 3TXZA 5KSWA 1TV5A 1VHCA 5F2LA 2VXNA 5CPLA 4MYXA 4QM1A 2TRSA 1OG0A 3UZJA 1W3TA 3P82A 4IXXA 3UWWA 1H7PA 3NL2A 3LBMA 3NG3A 3C56A 4E2DA 4P2VA 5FF4A 1VR6A 1PL9A 1ZAIA 1TPDA 5KZEA 2EKCA 4Q33A 1B4KA 4M19A 4XKYA 4FNQA 1PV8A 4YMZA 3W1NA 3QSRA 3O05A 2Z0IA 4LV4A 4O13A 4PODA 2DZTA 2B4GA 3L5AA 5EBUA 4O54A 4TX9A 2VEKA 1HUVA 4TMBA 1ZCOA 3PS7A 2PCQA 1QO5A 4GWEA 3TAOA 2C13A 3W72A 4QSHA 3G1XA 1QNVA 4KWWA 4XWUA 3W2MA 2E6DA 3QPYA 3N34A 4AHQA 2YW3A 4UTWC 3C61A 4HIBA 3DENA 4LUIA 4ZQRA 1A5AA 4UCGA 1F2JA 1YTKA 3B4UA 2ISSA 2JGQA 3L0GA 2OMAA 4ZMGA 3LCGA 5K4XA 5EKYA 3LCFA 3TQ0A 3B8DA 1H51A 3TAKA 3MHFA 1E51A 3DKLA 3QRHA 1SUXA 3NAVA 5LNWA 2J9ZA 3N9RA 1VCFA 3H53A 3I7QA 3ATZA 5G2HA 3LB0A 4W9TA 2CLOA 1QOQA 1L6WA 1YXCA 1WDWA 4JGDA 1RPXA 3PB2A 3MP5A 2BXVA 3WK2A 4K8EA 3LHWA 3Q58A 1TRIA 1SZFA 4JDYA 1F73A 4Y9AA 5DY2A 5AYZA 1SFJA 3W7MA 4M6PA 1X6UA 1IIHA 4DBDA 2ZA1A 1JUKA 3NZ1A 2V5LA 3UNDA 2IQTA 3MI6A 4JNMA 4ZQMA 4A22A 4UFJA 4O1AA 3O07A 2EAWA 1YTDA 4N9BA 4ZQPA 2DZVA 1AL8A 4XUGA 5DY3A 3HGSA 4B5NA 3UWVA 1SQ7A 3GKFA 2BTMA 1K7FA 3NQ7A 2YSWA 4H4IA 1SW3A 2C14A 3BLFA 1GYNA 1HL2A 4Z1BA 3GXTA 3T55A 1I8JA 4GUHA 1XBVA 2PRHA 4RJEA 3LGEA 1BWLA 1GT8A 4IX0A 3IIXA 3MUXA 3P67A 4IPIA 3M44A 3B05A 4ADSA 2CWNA 3W7JA 2UV8G 3LXBA 3QYQA 1FCBA 2G5WA 4JN6A 3M0ZA 4PL1A 4UFLA 4FIQA 5CZSA 5D03A 3LHZA 4JEQA 1PIIA 4OV4A 4IUOA 3OVPA 2A21A 3LX9A 4KFNA 2X16A 4QIUA 2QF7A 1XBZA 5CSRA 3HJZA 3PSVA 4LC6A 4AH7A 1G4PA 1K8YA 5LHFA 1TPFA 4N2YA 2OT1A 1CW2A 3L2IA 1F5ZA 4UNLA 2NWRA 1ML1A 3QZEA 3DH7A 5U7SA 2QAPA 4HPXA 1TO3A 3HG4A 2J9YA 2Y7FA 3TJXA 3C6CA 3BLIA 1THFD 2Y63A 3B06A 1KFEA 1GVRA 5EL1A 4WD0A 1ONRA 3IVUA 4IMDA 2R94A 3A24A 3OVQA 1TYGA 3M41A 4U4MA 4GRSA 3SFKA 4LVGA 4U28A 4EF8A 4NX0A 4MKNA 4UTJA 4FNUA 1GG0A 1YDOA 3NQFA 3PVFA 1TMHA 3DFTA 5BNKA 1FY6A 1JVNA 4WQ6A 2ZZ3A 3BW4A 1DQXA 2ZRUA 1OFEA 5I3FA 2ZRYA 4LWWA 4R34A 2RFGA 1QPNA 2JK2A 1PHQA 1DHPA 3HB9A 3KVKA 1GWJA 4OV9A 5AFDA 4WY0A 3OG3A 4NNCA 1GVSA 4Q4KA 2YGYA 4FEZA 2P10A 1UBSA 3EWYA 2ZZ1A 3LTYA 4JY8A 2FPTA 1WV2A 4WXZA 1X7FA 2JKAA 4DF1A 1SO5A 4CQAA 5J5DA 2C18A 3LXAA 1Z48A 1EIXA 3B04A 5DBTA 5AHIA 3PULA 2Y7DA 1TPEA 3W76A 2JGYA 2FFCA 4DPQA 2FIQA 1UUOA 2GVJA 1TQXA 4JTFA 1K02A 1TTIA 3STEA 5I3KA 3KOFA 5L6UA 2Z1BA 3NR0A 2J27A 3C4UA 3TIMA 4X22A 3LHTA 4O1CA 3H54A 3LTPA 1OFRA 1KBIA 2ATSA 2H6RA 3EXRA 2DZXA 3MWAA 5EMUA 1Y0EA 1XUUA 3HG5A 4M6QA 3UZ5A 4DO6A 2NV1A 1SZGA 1C8VA 1H7WA 3TXVA 1V7YA 3WK0A 3TQVA 4JIPA 4I9AA 3WK1A 3SGUA 1L9WA 1MSSA 4ZZ9A 3G1YA 4P61A 4YLWA 1GTEA 3G1SA 1K7XA 1S5WA 3HIJA 1FWTA 2FDSA 4DF2A 1TSIA 5AB3A 4O8RA 1Q6RA 4EF9A 1FCUA 4RV8A 1KM0A 4ZL1A 3LI0A 5A5WA 3OIXA 4LT9A 2NUWA 4GC4A 3PSWA 4Z1AA 4AEOA 4O1BA 2J24A 3W7OA 3NEVA 4GBUA 5D37A 2E68A 1W3NA 4AVFA 2E5CA 3LOTA 3INPA 3SW6A 3BG9A 3PUEA 5G2IA 3MYPA 1N55A 1KM2A 4UFIA 3YPIA 3AJXA 4O18A 1SU5A 2B0MA 4FNTA 4NJIA 3W1MA 2E77A 3FKRA 3LRMA 2G95A 3HPZA 1RZMA 4WUIA 3CM4A 1LBFA 3L68A 2CFFA 4C1KA 4N4PA 2DJLA 2DZSA 2VOMA 1MXSA 1DKWA 2YFNA 5F2MA 1DOSA 2V9DA 4Z1DA 3RLVA 1JUEA 3LLFA 5BRBA 1R47A 1JUBA 3UPBA 4DO5A 5AOUA 1JCXA 3LRLA 5L9FA 1VPXA 1KA9F 2ZZ6A 3G0UA 3N14A 5C54A 3C2RA 1VCGA 5D05A 4A21A 3UQNA 3QFEA 4NNAA 1XL9A 1ZHAA 2QAFA 3G8EA 4MZ1A 2GPTA 4NJJA 1RV8A 1OK6A 1ICPA 4JTLA 1SFLA 3WFAA 3EX6A 1I2QA 3QPZA 1J4EA 2V8ZA 1ME7A 2VFHA 5I3JA 3GAYA 3O1NA 1IXNA 3CB8A 3L67A 3MO7A 4IXHA 4LS0A 2C1HA 3STGA 2NUXA 2QCCA 3TSMA 1QO2A 1GTHA 2Z6IA 3DHDA 4O1DA 3FYOA 2ZCGA 4TU1A 3NO5A 1VS1A 3NQCA 1OVDA 5D33A 2Z2UA 2TYSA 1JQVA 2G96A 3DBPA 3ELFA 3A21A 2CU0A 4FXRA 2B7NA 4NVTA 3NQEA 4A3UA 1SZEA 4XBSA 2JKPA 1SO6A 4MY1A 3TDFA 1ZENA 3TW6A 2A4AA 3N9SA 5HUPA 1SW0A 1I2NA 2CLKA 3W1UA 3BPWA 1Q3NA 1W5QA 4LY8A 3GB6A 3R13A 4TIMA 3SI9A 3W7DA 3M5VA 3QW3A 3TCEA 1EX5A 2WNZA 4OU1A 4POCA 5CSSA 3TUUA 5EY5A 3I68A 4O16A 2LLEA 3WJXA 5F4XA 3NL6A 4GE8A 5DXYA 2Z6JA 1HFBA 2VELA 3M5XA 1EA0A 4N6EA 1H7NA 2NWSA 3GAKA 1JCLA 2QKFA 4BWLC 1DVJA 3PUDA 1GPWA 3QJAA 1FX6A 2H90A 3S0CA 3PF3A 4L4MA 2YPIA 1WYIA 3VE7A 3W7RA 3TSBA 1P4CA 1UUMA 1AW2A 1TV8A 2V5BA 1TIMA 3V1PA 3VE9A 2A7RA 5HWMA 3KVJA 5DXXA 4LUJA 1UASA 5LZLA 3MI2A 3EKLA 4WXYA 1LYXA 3MW7A 2NZLA 6TIMA 3NPXA 1FWSA 3ABSA 3G3DA 4XQ6A 2I1OA 4NQ1A 4LU0A 3EX4A 3A5FA 4Z1CA 5D2WA 5AC8A 1JCMP 2R8WA 1W5OA 3UXDA 3PWAA 3BLEA 5CKSA 5C6MA 1KM3A 1T8XA 4JTGA 8TIMA 2X2GA 3BK0A 2I14A 4IX2A 4RXFA 3LCLA 5HQEA 1ZJIA 2QUVA 4JYEA 3H55A 1TPC1 1PHWA 3W84A 1MZHA 1DL3A 1TPH1 3PAJA 1LROA 5CPNA 2QCDB 4HNTA 2XFWA 3W7QA 4UMBA 4CCEA 4MFEA 2WQPA 1ZAHA 2AQWA 1WXJA 1KM4A 3L5LA 3S1XA 1UCWA 1VGAA 2A0NA 3W7IA 3A23A 4UTTA 2YW4A 3PBUA 4FXSA 1EP3A 3W23A 1GYLA 3T40A 2WV8A 5I3IA 1XCFA 4FNSA 3W1QA 1Q6QA 4K7YA 2Q3OA 3NQ6A 3HF3A 3NDOA 3W7HA 1RVGA 1Q45A 3B03A 3L0KA 3VCRA 3W7LA 1OYAA 2W0UA 1CX9A 2ZA3A 4J9JA 4BR1A 2PRLA 4ZQNA 1OYCA 5SWUA 3MP4A 4O52A 3W1AA 3BO9A 4R7JA 4ORIA 2YR1A 4HNNA 3TJLA 1L2UA 3BV4A 1GOXA 3K30A 3DFPA 3STFA 3UD6A 4MVAA 3TNOA 4MFDA 1G4SA 1W37A 3QMTA 5FEWA 3NL5A 2YYUA 1SO3A 5LKYA 5D09A 4XKYB 3W07A 1I2OA 4NT0A 2Y88A 3M9YA 2NXIA 4WOQA 3TC7A 1OFQA 1A5SA 4Y6GA 3C2EA 4XTDA 3JS3A 1QMLA 3IGUA 4YCPA 5LGXA 1S5TA 1A5BA 4UXDA 1B4EA 4UUIA 1M7PA 2RKXA 5CZ0A 3KFTA 4QITA 4S2BA 4WY0B 3UXAA 4I7WA 3HOJA 1AL7A 3R5EA 1WX0A 3HMJG 2DU2A 2FQIA 1O4UA 4CNOA 2BX7A 4UTIA 4PCFA 4MUZA 1HTIA 1T0OA 3L5MA 4GUFA 2ZTKA 2NX1A 3W1TA 3L9CA 3GNNA 5HUOA 2DP3A 3THAA 5LSMA 1WBJA 3LHVA 3I6RA 2X1TA 3QC3A 2NX9A 2ZRXA 3CEUA 2FPYA 3W7CA 4WZHA 2ABBA 4QJ1A 3S5ZA 3I7RA 4O0ZA 3D0CA 3W7PA 3N2MA 5D30A 3GDTA 3PBYA 1LM1A 3W74A 4H3DA 3SSJA 2E1DA 3LERA 3HGOA 4LVDA 1F76A 3CWNA 3FOKA 1TPVA 3QW4B 1W3IA 1GZGA 3B0PA 5LHEA 4NXSA 2NXHA 3MBDA 3SJ3A 4BK9A 1TCDA 2QCGA 1AK5A 4O15A 1CI1A 4Y8FA 1H50A 1DJNA 3G18A 4JTEA 2Y61A 3MI3A 1Z41A 1EUNA 1KTBA 3CPRA 2QUUA 2E5DA 4UTLA 1TTPA 3F1QA 1I2RA 5G4WA 5D38A 4LV9A 5HULA 3FFSA 5FEZA 1O94A 2D73A 1I45A 3BVJA 3GYEA 2B7QA 2ZFAA 3TW7A 4E2BA 3CTLA 3NPUA 2FB2A 3NQAA 4JDBA 1D3GA 1FWWA 5KITA 1OX4B 1FUYA 3R2GA 4K37A 4RLIA 2Y7GA 4E0CA 5FESA 4BI7A 3E12A 3OA3A 5LGZA 3ZWTA 2WO5A 3LHYA 4RX0A 5DLCA 5A8GA 1RQBA 4AWTA 1KV5A 4S1FA 5D04C 1B3OA 4FHAA 3QF0A
chains in the Genus database with same CATH superfamily
4LAUA 1UH3A 2HNEA 4XO6A 1P5BA 1VQ8H 2UZ9A 5K3VA 3CC1A 5H8MA 4US5D 3KBJA 1FWNA 1Q6FA 3EXSA 3KOWA 3KZSA 2DT1A 2CLHA 2QUMA 2ZJQJ 1R30A 4ALDA 4L61A 1XSKA 1PDYA 2PURA 3WUEA 2AMGA 5MF5A 1VQ6H 2XGBA 3WKZA 2W3SB 2HS6A 1QW7A 1YJWH 1WAUA 4WCJA 3QGKC 1CXLA 3WD4A 2HE5A 1O12A 1IIGA 3UYIA 1QJWA 2C6QA 3ZS4A 4M6VA 1MXGA 4OT7A 4GISA 4GIYA 1G67A 1ISYA 3CT7A 5JQ9A 1NELA 2NUYA 3QTGA 3LYEA 1UZ1A 5FIPA 1Z42A 2ZUNA 1CLXA 5EMMA 5HQMA 1S39A 1IWAA 4PTNA 2CHOA 4O17A 4RZBA 4EPDC 1KFLA 4XZWA 3WUFA 1LORA 4MIMA 3IVTA 1ICSA 1QWKA 1Y5XA 3AXMA 5FF3A 2PC4A 1GVFA 4TX8A 2TPSA 1VHNA 1C8XA 3KHJA 4JTHA 1MW0A 3MO4A 1EB3A 1XLDA 3E02A 4AZHA 2BGQA 3ITYA 1WCGA 1ZSXA 5D2TA 4HZ7A 1KFBA 2XFRA 1S46A 5I06A 2OO0A 1JDEA 3W88A 3TONA 8XIAA 3G1RA 2RJHA 3E0IA 2EG7A 1QNQA 3FSUA 1NOWA 1OFOA 2FTWA 1PXGA 4JCLA 2HS8A 3AIWA 3WDIA 1OTPA 1BXCA 2RH9A 4A8RA 5HBFA 1UJPA 1MDRA 1VLWA 4RXGA 3H7UA 7REQB 3G2GA 1T41A 2GJXA 1UB3A 4BI5A 3W1LA 1LP6A 3EKZA 2F6XA 2PP0A 4JR5A 3VD3A 1KO0A 1CENA 4M0XA 2INEA 3HQNA 2VZVA 3SCTA 4FO4A 1L6SA 4K6AA 4Q8PA 4KWUA 5FKYA 3TA6A 2VR2A 1FA2A 1KRCC 4ICNA 2Y5SA 4X9SA 3LSBA 3LSCA 3NM1A 2ZRWA 1HW6A 3TFCA 2V3FA 4DYJA 4BQ4A 1H5YA 5F2GA 1NARA 3T8LA 1PWMA 1FWDC 4GH3A 1Z8AA 1TPB1 4FXFA 1IT7A 3PPHA 3MBFA 2D3NA 3GXNA 4MB4A 4UQDA 4DLMA 4X0VA 4H1ZA 2Y6ZA 3QPEA 4NSBA 1LLZA 5I07A 3H7RA 3IUIA 2DVTA 5GAEN 1P0DA 3UR2A 3WBEA 4GYJA 4LS1A 2QQ6A 2PD5A 3A4AA 4P8VA 3I6EA 1LDCA 5A1AA 2CKSA 2VGGA 1Q81J 4MLRA 3CAQA 2Z1SA 3E74A 2A7PA 3KVMA 1UP3A 1ONXA 1DWHM 1HP5A 4BI6A 2PDHA 4MZ8A 5KZDA 1EDGA 3AICA 2WMIB 1P0KA 1IXQA 2R91A 4NJGA 3GIYA 4OGZA 4NJHA 1TV2A 2ACRA 1REQB 2PF8A 4DJDD 2P8CA 4UTHA 2VCBA 5A6AA 1VC4A 4PMXA 1F7BA 1BQCA 3M16A 2HCVA 2QCFA 2WSRA 3VM5A 4WIWA 4NX5A 1E1FA 5JMUA 1AVAA 3UZWA 4EAFA 3LHUA 2HISA 1SO4A 1GOKA 3VNYA 3WL1A 1FHUA 4FF7A 5D02A 4A2RA 1ZAJA 4PSPA 1J93A 1IF2A 4TVCA 1F74A 3OODA 1MYRA 1UIPA 2ZXAA 2WJEA 4WGHA 3VDHA 4U5IA 3EWUA 1KM1A 2HJPA 2H3DA 1JL8A 2D2OA 1OGBA 4R5EA 5DM6J 1YI2H 1A50A 1GVQA 4E5TA 2ZYFA 2AAMA 2OWXA 3ITCA 1GVYA 1ELSA 1SW7A 1NSJA 4GKLA 3DG3A 4GXPA 4OWGA 4CCCA 4AD2A 1W3KA 3ENLA 4RZ5A 4EPBC 1Z89A 4A2SA 2KX9A 2J7FA 4XD3A 4LVAA 3MPGA 5AC7A 1HIZA 4GYPC 1NVJA 3H26A 1XIIA 4QAIA 3S6TA 2E6FA 5D2YA 3SURA 3G1DA 1IXOA 4LXFA 2OLHA 4BFAA 4DBEA 2CBVA 1AUSL 4IPJA 3TLLA 1BTMA 4K1WA 1YBQB 1VYPX 2F61A 4KWOA 5JH1A 4OBTA 1TJ0A 1W5NA 3AMKA 3CZEA 2X1RA 1YPXA 1RK5A 3OZMA 3QEZA 3BGGA 4DO7A 5KEZA 1W9BM 1BFNA 4XBJA 3PTDA 1OY0A 5DRCA 1XISA 7TIMA 3ZYZA 4PC8A 1SFTA 1FWHC 2QCDA 1YQ2A 1OCJA 4O12A 3NZGA 3Q67A 4DXVA 1JRBA 3R6IA 1BGAA 1UPMB 3CK5A 5FA5A 3PIOJ 4J4KA 4J3TA 2E28A 5K9DA 2VCAA 3LK6A 3NZRA 3TE9A 4LF2A 1WB0A 4JFUA 2ASHA 1OT2A 3HPSA 4MKSA 1SR9A 2VENA 2J79A 1EHAA 4XG1A 1E0VA 1XYFA 4K1GA 4Y90A 4JS3A 3NQBA 1UW9A 1W2PA 1LJYA 5G1TA 1RJQA 1QBBA 5J04A 4J3ZA 3F5JA 4GIRA 1H62A 1NFPA 4J28A 3WX7A 4RW5A 4C1LA 4Y2WA 1HF6A 1FP9A 2JQXA 1MZRA 1PSCA 3BANA 4IJRA 4D6IA 2JBMA 3VA8A 2Z26A 4HU0A 2CNCA 5GAGN 3WDRA 3COTA 1A5OC 4O11A 4JTUA 1KC8J 4UTKA 1WNOA 3HPFA 2CZEA 3W01A 1QU4A 2XZ9A 1S3TC 2VL4A 4HSNA 4D8ZA 1Y69K 4RZ4A 3KM8A 3WLOA 2WQDA 5BZAA 3CL6A 3CL7A 1KCLA 3N29A 3N2CA 4GCXA 1EEXA 1KR1A 2ACUA 3SN1A 1XRVA 3DUGA 2I5QA 5GAHN 3AMCA 3MHGA 3ES7A 2ZX6A 3CUIA 4AC7C 1EHNA 3FEMA 4S3BA 2D69A 1VD6A 4N02A 3BAXA 3GDKA 5HPOA 4WSHA 1A0CA 3PY2A 2FHCA 4CGTA 1Z3NA 3NA8A 4B5WA 3LV5A 1YTEA 3AZSA 2WMGA 5BXPA 3EWBX 1OX6A 5LA1A 2HVNA 2YDQA 1R3QA 3H4GA 1U33A 4O4WA 3AYRA 1ZBVA 4P8UA 1LCOA 2GUYA 1FTXA 1S1RA 2E6YA 2CLLA 5TF0A 1WZKA 2JF6A 3NOEA 1TTQA 4BEUA 1TWIA 3AXXA 1TA3A 1DIEA 4HMCA 1D3CA 5I3DA 1W1A1 4YYFA 5A6TC 3BSMA 4LAKA 3W3OA 2V30A 2DSZA 3T78A 1PX4A 2X40A 4JBRA 4B5TA 2G4JA 3NQMA 8XIMA 1K4HA 2YDAA 2BODX 3U4AA 4GY7A 2CZ5A 3L66A 1UPPA 1XSIA 3E49A 1PIGA 3CEPA 3SR6C 2VEFA 3IAQA 1PKNA 3MUZ1 4IFKA 3A4JA 3TKFA 4B3ZA 2BZNA 3SUWA 3VNZA 2P0IA 2Q02A 1O1ZA 3O6CA 4J3SA 3DGRA 4U2ZA 1XX1A 2L5HA 2QUTA 2GQ8A 1HG3A 1S5VA 1V3KA 5D9MA 1V3HA 4ZBCA 2G4FA 2REQB 4M7SA 2A79A 1LTDA 3AHXA 4ECLA 2E9LA 2ZX7A 4MJMA 1H7OA 3MA8A 4H9TA 1XFBA 1YDYA 2QCEA 5I2UA 3L4WA 5BMWA 3RILA 4GXMA 4O0KA 5BOFA 3MSDA 4F2BA 4I8DA 3RG6A 1XI3A 1OABA 3E0WA 1ZNNA 1GCYA 3S83A 3QV6A 2Y7EA 4DWDA 1XLGA 1J2BA 3W1RA 3D47A 5AYBA 1CCWB 1IT0A 3WJYA 3WLKX 4HQVA 3RNDA 3AZRA 3ZJ8A 1EH9A 7CGTA 3RU8X 3RYSA 1CIUA 4PMJA 1CYGA 1H7XA 4NNBA 3OLEA 4JX4A 3W2UA 2OZ0A 3U7VA 3IGSA 2O56A 3CC2H 5T26A 4LAMA 2XN2A 3SSZA 1P1XA 1U5JA 1KB3A 4JTDA 2DZPA 2QA4H 3TMLA 2BVWA 4IQLA 4AZGA 4JTJA 1TJ1A 4AF0A 1EXBA 4PBGA 1D3HA 1XJBA 1XUZA 3VXGA 3PB0A 3BCFA 3L21A 3MUCA 4X63A 2FGZA 3F4WA 3Q2DA 1CXEA 1ONEA 1V6YA 4DJDC 2R14A 3VCCA 1D7KA 2ISDA 1PCKA 3BXWA 5EGRA 1UBPC 1IZCA 1W56A 1O60A 2BVYA 2VRQA 2HVMA 4OOZA 4YWIA 2J6XA 1AJ2A 1WZAA 3QQ0A 1R86A 3RK8A 4DI8A 3LNPA 4YXGA 4TXEA 3S2NA 3P7YA 5FF0A 1V02E 3B8TA 4ZVJA 5CGMA 1VPQA 3PBWA 4JOMA 2PE4A 1UROA 3CD6H 3VAVA 4H6KA 5D9PA 5JBFA 3GG1A 3MKVA 3HG2A 3M5YA 1H60A 3C2OA 1F8MA 3BH4A 4XKMA 3HZ3A 1A53A 3S9YA 1TRDA 3NM3A 2I57A 5E5CA 4JQAA 2PDFA 1BXNA 1U1UA 4JTAA 4IOAJ 4HU3A 4R85A 3ABOA 4CD6A 2E7FA 3L4VA 1VFUA 5FEPA 1R3WA 2Q5WE 3LM7A 3CQ0A 2H3BA 2ZUSA 2ZIDA 2PDMA 4G8TA 1ODZA 1Q13A 3S6DA 3DFSA 3CASA 3U2ZA 4O8AA 1RQHA 2PGRA 3U8GA 1V0MA 2BHZA 3AISA 3NJ3A 4PBFA 1YJ9H 1LWHA 2G50A 3IIVA 5U4NA 3GR7A 4C6EA 2TPTA 1EFZA 2VFEA 3QLLA 3ZJ6A 1K8AJ 4C90A 2VX5A 5AC4A 4QHRA 3B0XA 1W1YA 3A5VA 4XD6A 1XGEA 2D20A 4BF7A 4O1EA 1SGJA 4NY2A 4F79A 1OFDA 3M7WA 3SEPA 2NQ5A 3KOXA 4I8YA 4F3HA 3NZPA 4JTTA 4W89A 1ZB5A 3UJ2A 1QWGA 3HO8A 3JUGA 2WMKA 2BY0A 2V38A 1UQYA 3VZZA 1E9YB 4ZOCA 3WEZA 4M5PA 3K8LA 4UMAA 2GUUA 3QHNA 3E96A 3B9NA 3UETA 4GUJA 2EF9A 3AROA 1TG7A 1WKEA 4LYRA 3CJPA 4KEUA 2WZIA 1HKKA 3SCSA 1XXXA 3ZVHB 3VIHA 4S3JA 4AX6A 2CW6A 1VCVA 2ZRZA 4AVOA 1P0NA 4OBRA 3OBAA 3K4DA 3AU2A 4AY7A 3KTSA 1E4LA 1WDSA 3CV2A 1JCNA 2OZTA 3VIFA 3BSHA 1XDMA 3V5CA 3P93A 3HA1A 1FBAA 4UTUA 5EP8A 1MQRA 2F7FA 2RDTA 2VEIA 2VZTA 4V33A 1FWGC 4M1BA 3WLSA 4LHMA 4JQ1A 3HPAA 4DBWA 2B7PA 4S3GA 3T2PA 1XYMA 4AZ7A 3RO6A 2GK1B 1HQTA 3BLDA 4GGHA 4NAEA 1J6OA 4IGHA 4R9XA 3VIGA 4HGXA 1YXYA 3B97A 1VEMA 3C5QA 4IMCA 4ZOAA 4N4QA 1QW8A 2OGYA 3B3DA 2E25A 3MC5A 4NL1A 3UWUA 1HX0A 1ZS2A 2Y89A 3T08A 1V6VA 1XD0A 1MEIA 4RK8A 4EWND 2YZRA 4NIRA 3T4CA 2O7QA 3CZJA 2PTDA 1UR8A 3EXTA 5HNUA 2XIBA 2QGHA 1KGWA 2CLIA 3F2CA 3SY1A 2RGMA 1VHCA 1TMLA 4MYXA 2X7WA 3TR9A 3IPWA 2TRSA 3P82A 4IXXA 3UWWA 3LBMA 2YCLA 3C56A 4H9UA 2VX4A 4FP1A 4QLJA 2GSJA 1ZAIA 1DE5A 5KZEA 5FSDC 3W0KA 5HNNA 1DWAM 4LV4A 1NU5A 1CGXA 5DRIA 4MNLA 3KCJA 3U4FA 4O13A 4PODA 2DZTA 2QEXH 1E0WA 1HUVA 4QS5A 4TMBA 1ZCOA 1KD0A 2O9PA 3FXYA 4XWUA 3WLNA 2GK1A 4AHQA 2PDUA 1LUCA 3CPWH 3PFMA 3LG3A 4UCGA 4PUWA 1F2JA 2ISSA 1BRLA 2JGQA 2OMAA 4ZMGA 5IDZA 1JFHA 3KWXA 5K4XA 5EKYA 2BOEX 3OO2A 1ZLPA 3LCFA 1IR2A 1UZ4A 3MHFA 1I60A 3KLLA 3VILA 4LBUA 3H2NA 2Y8VA 1UD5A 3H53A 4W9TA 1EC7A 5H8PA 3UXIA 1YXCA 2C91A 2UBPC 3B9DA 1SFJA 1ECEA 1X6UA 4QP0A 3NZ1A 3O3RA 4ZQMA 4UFJA 1H0IA 3VPLA 4AZCB 2CESA 3OP2A 5DY3A 3P6LA 2BFGA 1ZJAA 2GDVA 1K7FA 1V6TA 1MW3A 3NQ7A 1CT5A 2XVLA 3A4WA 2CLPA 1DIOA 1I8JA 1MRQA 4GUHA 1XBVA 2PRHA 4RJEA 3W02A 5CQ1A 4A35A 4HB7A 4E2VA 3LENA 4IQEA 4GMEA 1W91A 2D0HA 3TW9A 3MCMA 3QYQA 2EO7A 1NOFA 1H3GA 3N2TA 4JN6A 4RE3A 3ZMRA 2VGBA 3BL3A 5CZSA 1C8YA 3OQEA 2YA2A 1GJUA 3OVPA 4GYFA 3TWBA 3UGVA 4C6FA 1XG4A 4AH7A 1M90J 1K8YA 1TPFA 2OT1A 4PULA 1BTCA 1K6WA 1VFSA 4P7QA 4L9ZA 1VBRA 2VOTA 4QX4A 2Y63A 2P3EA 5BXSA 3B06A 4YHEA 1ONWA 2W9MA 5EL1A 1DJGA 2R94A 3OQ8A 1HKMA 1O68A 3OVQA 4U4MA 3W25A 4XAFA 3MVTA 2HK1A 4UTJA 4PYSA 3WNLA 4B15A 1YDOA 3NQFA 2ZXDA 4WQ6A 2YL5A 2G3FA 2ZRYA 4GZ7A 4L80A 1GPFA 2ZWYA 4Z42C 3KVKA 1KBBA 1UG6A 3M0KA 1IEVA 2OELA 3OG3A 4Q4KA 4WEVX 1JZ4A 2QS8A 2WVSA 4FEZA 3CQJA 3EWYA 2ZZ1A 2FPTA 3ARXA 5G4HC 1X7FA 1F3WA 4JHOA 3MSGA 3KEHA 4UZSA 2YBVA 4QEEA 4LUTB 4XIAA 1FO4A 1LT8A 2HPMA 1BF6A 4ATDA 5J5DA 2C18A 2GVEA 1JYNA 5E70A 2WC3A 4IICA 4B5SA 4PN2A 4QBXA 1TPEA 3FV9A 3A3WA 1R8LA 5A8NA 1EF3A 2AL1A 3DIPA 4Y8EA 1OCNA 4DPQA 2GVJA 1EA9C 1K02A 4ATWA 1TTIA 3NZQA 3KOFA 1CXHA 5L6UA 3C4UA 4X22A 3H54A 3VMMA 1OZMA 3UR8A 4HK6A 2ATSA 2DZXA 1XUUA 1C8VA 4MHBA 4IIHA 3WK0A 1C90A 4FI4A 3H2EA 3TQVA 4JIPA 2PPGA 2OMDA 1FVPA 4ZZ9A 3SRFA 3T0AA 3OVGA 3H21A 1XYLA 2I56A 2WK6A 4P61A 3BAIA 3TWAA 4OIFA 5EMYA 4DF2A 5BRPA 4RNFA 4RPQA 1PO9A 4MTVA 1MW2A 3PSWA 4Z1AA 3WF1A 1N62B 5D37A 3WH9A 1W3NA 2E5CA 3LOTA 3INPA 3SW6A 3E1F1 2E8YA 1SU5A 4NJIA 1JAEA 4LAOA 4ZFCA 3WDHA 2E77A 3FKRA 3MQTA 2G95A 3HPZA 4DVOA 4J1OA 5C9RA 4Z2HA 1E1EA 3AIVA 2PA2A 4GI9A 3WF0A 1J6PA 3PN8A 3NVZC 3H23A 3CM4A 1QNPA 3L68A 2CFFA 2DJLA 5DEZA 1W3JA 3WD1A 4RDVA 1DKWA 5C71A 1XKJA 1VFTA 4G1NA 4KCVA 1R47A 3AHZA 2P50A 1XLAA 2J75A 3FDKA 1QVBA 4GFIA 5C54A 2O9RA 4NNAA 4HU8A 3LPPA 5LIXX 1ZHAA 3DERA 3ZM8A 3G8EA 1JCTA 3WFLA 4MZ1A 4X2PA 4XK2A 4K2SA 3H2MA 3R7MA 3QPZA 2DW6A 4ZOBA 2VFHA 5D9NA 1R3VA 1H0GA 5I7GA 3V18A 1B2YA 2ESCA 2FJUB 4KRZA 5GNYA 4I9JA 1IXNA 3CB8A 2YL6A 3WQWA 3STGA 3N6JA 4KGJA 2IKHA 3T1GA 3JZEA 3G6EH 1FWFC 4TU1A 4V2XA 4F9DA 1E3XA 4FLOA 4L5ZA 4NVTA 2HEJA 3NQEA 4A3UA 4XBSA 2JKPA 2DVXA 1UD8A 3IJDA 1A5UA 4NZ1A 2W61A 3N9SA 3NDZA 4WFBJ 1I2NA 2Q71A 3BPWA 1Q3NA 4LY8A 3NOYA 2PU0A 2ZDSA 3EA2A 3SADA 3P2VA 3W7DA 3TCEA 3TUUA 4POCA 5CSSA 3I68A 4CU8A 2LLEA 4CD7A 4BZYA 5F4XA 3GS6A 3NL6A 4D1IA 4H8UA 3GAKA 1JCLA 4LSBA 4Q3MA 2QKFA 1UA3A 2WWCA 1IQ8A 3OLGA 1GPWA 1B3XA 4FMVA 1VFOA 4L4MA 2YPIA 3VE7A 3IS4A 3TSBA 1P4CA 4AD1A 5JXQA 1AW2A 4MAVA 2V5BA 3VE9A 2XGZA 3MI2A 3MW7A 3WF4A 3ABSA 2I1OA 4INFA 2WJFA 1B0IA 3UJRA 4GACA 1B9ZA 1MI3A 1EJTC 2CHNA 1W17A 3UXDA 1HL8A 4IGSA 4FS9A 4RE2A 4JTGA 2X2GA 3BK0A 2I14A 3N6HA 4CCZA 4RXFA 3SQMA 1UUQA 4G56A 1ZJIA 3WQ8A 2QUVA 3ETRC 5ABGA 2QCDB 4HNTA 3B8VA 4GQBA 1BRLB 3DFYA 4IGMA 2WC4A 1ZAHA 4LYKA 3II1A 3L5LA 3A23A 4UTTA 5CJNA 3OZYA 2W67A 4HZ8A 3PBUA 3W23A 1T6MA 2TAAA 2DQXA 2V5DA 1XCFA 4YTSA 3W1QA 3N15A 2Q3OA 3NQ6A 3HF3A 3NDOA 3AFBA 1RVGA 1NJIJ 5BXRA 2VI0A 3L0KA 3SFWA 3I56H 3W7LA 1VFLA 4RDWA 1OIFA 4BR1A 1BD0A 1OYCA 3MP4A 3BO9A 5CXPA 4R7JA 2VQTA 3LN3A 2J78A 2IPWA 1XLKA 4Q4RA 2OTJH 1GOXA 1OGGA 4MVAA 1QHZA 1ISZA 2YYUA 5LKYA 3AS0A 4HTYA 2PP3A 1I2OA 2Y88A 3KP0A 4US8A 5LIUX 2NXIA 3VGHA 3H12A 4OZOA 3WSUA 4AZ5A 3JS3A 1QMLA 3IGUA 2A3BA 3AHTA 3BLPX 3GNOA 3FC4A 3UCDA 1S5TA 3W26A 5CZ0A 3RCNA 3KFTA 5IOBA 4YTUA 4JEJA 1AL7A 2VNCA 3KW3A 3RPMA 1XYCA 1W2VA 5IFPA 4HYRA 1EX1A 4ZENA 1GOOA 4ROQA 4MUZA 1AQHA 2F8QA 5ENLA 3B9EA 1T0OA 1R6WA 3EOUA 4KEZA 3L4YA 4IGNA 3WQ4A 1PUDA 3G5EA 3BLLA 2DP3A 2PDNA 1POJA 5LSMA 1WBJA 4ZSUA 3QC3A 4H01A 4JL1A 3CEUA 2FPYA 2OZ8A 1K9MJ 1P0BA 3FNDA 2VMFA 2ABBA 5H6HA 3S5ZA 2VWTA 3N2MA 5D30A 4K68A 5ABFB 5ABEA 3ABXA 2H9AB 3VGGA 1BWVA 3W6MA 1RBAA 2E1DA 3R8HA 2QJMA 4LVDA 3BGAA 3QW4B 1N2VA 1W3IA 3O7UA 1UA7A 3AMZA 3B0PA 1U5HA 4PUJA 1Q4WA 1VFMA 3GU1A 3WQVA 1KGXA 3H2OA 4UQCA 2V67A 2CBIA 4JTEA 4MG4A 3L23A 4U3CA 1EUNA 1KTBA 3CPRA 3SCRA 4JNYA 2PTWA 4DBSA 1RCQA 4I5RA 3BVJA 3KHDA 2ZFAA 4IL2A 3CTLA 3V1HA 4HNLA 3UNTA 1CECA 1XQKA 1EGVA 1XG3A 2FZNA 4WDXA 4GH1A 2OKOA 2J7HA 4JDBA 2BGSA 1D3GA 1GKQA 5A6JA 1PEZA 1HP4A 3GY1A 3R2GA 4KPLA 4HZ6A 4RLIA 2Y7GA 2QLYA 3EOEA 1J8VA 2J6VA 3TQPA 3UEQA 2WO5A 4KGLA 3LHYA 2YCIX 5DLCA 5A8GA 1RQBA 2ALRA 4F40A 4M3PA 3U57A 4S1FA 2Z1VA 1B3OA 4FHAA 4URIA 2J8FA 3THQA 2TSYA 1KQSH 3M0HA 3KXQA 4WRHA 4Y9PA 2XFYA 4EAMA 5HWNA 1F8IA 3HPXA 5I78A 2OTLH 2FJKA 3WLJA 4PRRA 3N73A 2FZBA 2GSHA 4HKPA 4PMRA 3SAZA 2WMJA 3FKKA 5EMJA 1TB3A 3MSRA 3PZQA 1XKYA 1E15A 3DFOA 1B9BA 3CIWA 3W28A 4RE0A 1D9EA 1E6PA 4S3CA 4PMVA 4ZOEA 4LYQA 2ISVA 4L4OA 3C2YA 3HFTA 3Q37A 2FHBA 3ARRA 1Q6LA 1N8FA 3MVIA 1YNYA 5AY7A 4KKXA 2B7OA 1GQJA 3VM7A 1PB0A 1XRTA 3DHFA 2EPLX 1GG1A 2FGBA 2IPJA 2C1GA 2PWDA 5CSYA 3UG3A 2BLEA 3TFXA 1DQWA 1K8XA 3BG3A 2G3JA 1RA0A 1K9DA 3QR3A 3OOQA 4MZYA 5AECA 4EK7A 1BSIA 3SN4A 3IJ9A 3GKAA 4W7VA 1M01A 3JZUA 4H8NA 1GONA 3KAOA 2DZAA 1FQ0A 1OGSA 4RR4A 2XN1A 3CXCH 1E0UA 4JX5A 3O9NA 5DCBA 2PMQA 3UYCA 1JDCA 2XH2A 3NXLA 3S1WA 4XZHA 4ERAA 5T9BG 1R2RA 3TP4A 4A8LA 3MUAA 1W3HA 2X0HA 1X1OA 4XZBA 4J3XA 4O28A 1QDSA 3N2BA 3MUY1 3CCEH 2OQLA 3JVAA 4UB9A 3SQLA 3MZNA 5FL1A 4Z0SA 5F1UA 2D23A 2A6NA 3PZVA 4XB3A 3V3WA 3UPWA 4DPPA 3QTPA 3KWSA 2RDUA 1RUSA 2WP4A 3W81A 1OK4A 1Q63A 1ICQA 5CLWA 4G5DA 5DFAA 4DN1A 3DBNA 2OODA 4MSSA 5TD4A 3M4HA 3FSTA 2J13A 4MDPA 4EE9A 1F05A 5I5RA 3WD2A 1IV8A 3RU6A 5I3HA 3AS3A 3AMDA 3B40A 3WK3A 3WCZA 4LX4A 3GHUA 1JGIA 4WLCA 3VZXA 3QH2A 4O53A 4JFSA 2F38A 2CZFA 1HJSA 2TODA 1EZWA 1R2TA 1NJJA 2FDMA 1TVNA 3LPGA 4WKHA 3SCQA 4FALA 1AMKA 1JI2A 3GLCA 1XLHA 1U1JA 3W9ZA 2HQAA 2R82A 4LANA 3Q4DA 2RDWA 1JQXA 1WQ5A 1W31A 4HK5A 5EYWA 4GXWA 2PWHA 1YEYA 3LZ3A 2DORA 3S5OA 1EP2A 1DP0A 5FEXA 3K5XA 3LZ5A 4LUSA 1FWBC 2DVUA 5FSEC 1JF5A 1IYXA 1GHSA 2PODA 1T99A 3DU0A 3VX1A 3UG8A 2XUCA 5LNUA 3G4SH 3STPA 3PJWA 1J96A 2W55B 4YCOA 1JZ7A 1U83A 4S2CA 3UVAA 3S6OA 2CXEA 1UYQA 4JTSA 3UXKA 4M7TA 3VDBA 1UOZA 3BARA 1KCXA 1DBTA 5XIAA 3RFAA 2PDGA 3JRKA 1X6LA 1L6FA 1TJPA 4Y96A 2CWXA 1V0LA 2OGJA 4AHOA 4DF0A 4UNIA 4CQCA 4OECA 4XZNX 3TTEA 4QDMA 3W7NA 3GVRA 3QVQA 3LPFA 1XQLA 3C2VA 4J2PA 3T0CA 3WQGA 4LVBA 5I09A 1T8QA 3C0JA 4AY8A 3R10A 1G9HA 3HJEA 2HRWA 3N4EA 3EA3A 3FJLA 1YPIA 1V0KA 4R3UA 4Z2KA 3IIOA 1K9TA 2BGNE 3V0UA 2JALA 4LW7A 4TVDA 3NCOA 3EGJA 5ABTA 4KFPA 1UP2A 4CCDA 3P5YA 4AIUA 3URNA 1T7LA 2XN0A 4GGBA 1YHTA 1KFKA 3VOIA 1NVMA 4MY8A 2PA6A 1E5NA 1TE1A 5MKGA 5H91A 4ERGA 3RM8A 4Z2GA 4NXKA 2YXGA 1TFVA 4QGCA 3ALFA 1I9CB 4O1FA 3NRZC 2CC0A 4MKVA 3C0LA 1SMAA 4GYPA 4GFSA 3MUIA 5I23A 3TJIA 2FVLA 2J7DA 2OLAA 1SJDA 4IFOA 4O19A 2CEQA 3NL3A 4LH8A 4O10A 3W73A 7TAAA 2OEMA 3FHQA 3GDRA 3H24A 3ES8A 4R88A 4M82A 3EDEA 2Y0FA 1ZBKA 3NSMA 3CXOA 2ZDRA 4QFUA 1UR1A 3M6YA 3P8IA 2OWCA 4XO7A 1FDZA 2FB3A 4HHPA 4NI3A 5AN7A 3NGJA 1M7JA 3W75A 4B16A 3FJ4A 1Q6GA 1QI2A 3MANA 2A2IA 3U0HA 3EWDA 4FX7A 3C8FA 5KMYA 5J5RA 2WC7A 1KV8A 3GNDA 4KBXA 3WF2A 3AQUA 4CNSA 2RHGA 3KBNA 1TZ7A 3BLKA 3WMCA 2ALDA 3FIGA 1JAKA 2A1YA 3VKCA 3UCQA 1WO2A 2EJAA 3KL3A 4CQ9A 2GOUA 4B2DD 3I65A 5C5YA 1AJZA 1A5LC 2D0GA 3GXFA 3OEXA 5CAKA 2VFIA 4C6OA 1QPOA 2AL2A 4DZIA 1S2AA 4JXCA 3GXMA 2IQDA 4PL2A 3THDA 3VFLA 1P0EA 3AIBA 5DF0A 1IEIA 4JICA 1IXPA 4E4PA 4CLMA 5F2IA 1HJUA 3RN6A 1IGSA 3AXIA 5C7VA 2ISFA 4L6OA 4FR6A 3E5PA 3UJFA 1FFVB 1W1TA 1A5MC 1UWQA 4HN4A 4OUIA 5ABFA 1XLFA 1M5WA 2V5CA 1OBAA 1NF0A 4XZLX 5CH9A 3FXGA 2WNNA 1ITQA 2Y8KA 4N9EA 5HMDA 4EVZA 3GXPA 5BXTA 4MGGA 4NZFA 1XGDA 1Q5MA 1YDVA 2YLLA 2C3ZA 1UR0A 2I17A 1E1CB 3T2QA 2OU4A 4IWWA 1TX0A 1P6WA 5F4SA 4WVXA 2VRJA 1O5KA 3AMLA 3G24A 1O7AA 1XW8A 1VYSX 3ZR4A 5HR6A 3O06A 3P80A 2XTKA 3KOYA 4NASA 4MWAB 1P7TA 1V3JA 3M0JA 2QIEA 4U2YA 4R27A 3WNKA 3GDMA 4NZJA 2X1UA 1CTNA 2BP1A 3TK7A 3ZQ9A 2I9EA 5REQA 3Q94A 3GNXA 3K1DA 4TOQA 5HA7A 5I0DA 4X61A 4JHMA 2ZTJA 2DPEA 3E5BA 3CCUH 2J7BA 3OHMB 4YPJA 4P7OA 1WDDA 2DSUA 4L4LA 3CV7A 3GHRA 2OKTA 4M80A 4X0NA 1OD0A 3W71A 1FXQA 1EUAA 3USBA 4DI9A 5CG7A 3GH4A 4NP7A 3H7VA 3RX4A 3SB0A 6ENLA 4F2UA 1I2PA 1KQZA 3UT0A 3UW6A 1KTCA 3P0WA 2VWSA 3DOPA 2D2JA 2HMCA 2YA0A 4C5YA 1V02A 3H5QA 4MJ2A 4WX2A 4PTDA 3CAKA 3MWCA 2DH3A 4LOCA 1CGUA 3GO2A 4PBEA 4S3FA 4UNKA 4AZBA 4B4HA 3PWGA 3HMCA 3NQVA 3ZVHA 4PUEA 1FMAE 1XGZA 3HV8A 2ZXBA 3VX0A 3LXCA 2WHMA 1TQJA 4WHBA 3GG7A 3ABQA 1SSDA 3P81A 4RDYA 3RXZA 1XLJA 4ZE4A 1T96A 2OXNA 4C7DA 1MXDA 5AC5A 3ERPA 3NFUA 4XR5A 5E0KA 4LNCA 2Q01A 1W9VA 4B3LA 2DDXA 2Z29A 1F07A 3QHOA 4MY9A 3GR4A 4E8DA 1HJWA 1U1HA 4MWAA 2OLSA 3SN0A 5H8UA 1VQ9H 4DZ5A 1VJIA 2R24A 1JPDX 3RM4A 4TUFA 5C55A 3CUJA 1VQOH 1FCVA 1R46A 1RA5A 3BG5A 5CGQA 3WNOA 4MNJA 4S3EA 4ACYA 3CMAH 1YJNH 1PZ1A 4UC5A 1HJQA 3TSDA 1ZP3A 3BMVA 1BGGA 1N60B 3EMCA 4E6MA 4DQWA 2XHYA 4DJED 3ZR5A 1QHPA 1CGTA 3RMEA 2QJIA 2FZ8A 1QR7A 3ATYA 3R1ZA 4RDZA 4KESA 3FAWA 3POHA 4NAEB 1XD1A 3CHCA 5A8QA 4XVEA 3EX3A 3V75A 1OEPA 4W93A 1HZYA 3CHFA 1EPXA 1Y65A 1PWLA 3A22A 5HPCA 1X39A 1XYBA 1VQ4H 3QR1A 1ZUAX 4H9MA 2GQAA 1W1ZA 2VP8A 3QMSA 4F9JA 1LBLA 4A3QA 3OLDA 4IO9J 3TU9A 3WLTA 5A2BA 1WBHA 4DWSA 2WPBA 2VM8A 2FZ9A 4UTTC 1GQIA 4AF0B 1MQPA 1QOPA 3K4AA 1PBGA 4WY0F 4QNEA 2JFEX 4AD3A 1KNWA 2IXUA 4IF2A 2O9TA 4HSOA 1FH9A 4M81A 3IK2A 3GTIA 1V5XA 1W54A 3P62A 3RIKA 3CLWA 2DGAA 4D2JA 3TOPA 1NFBA 3LTSA 1MEWA 1XDLA 2NSOA 3WNMA 2WHJA 2FLIA 1Q6CA 3ABZA 3FJ6A 4GUGA 4O14A 4O4VA 1FWIC 2VT0A 2HSAA 4XTIA 5I6SA 4UR8A 1PE1A 3HN3A 1V77A 5IM51 1F6KA 2GGEA 2KZHA 4AWUA 1PX3A 2GVGA 3CUGA 1NDVA 4QEHA 3CLMA 1ISWA 1H09A 1W5PA 3CC4H 4FAMA 5A6LA 4PA8A 1Q6OA 2QXWA 1HKJA 4QG8A 3J7ZM 5DO8A 4YNGA 2QJGA 1FWRA 1KXTA 5AKQA 5C70A 2W6RA 3KBWA 3ZFHA 3AJ7A 4N0RA 3VMNA 3BZJA 1WOAA 1K1DA 1TV4A 2WYSA 2CHRA 4LCSA 3FX4A 5A6BD 4C1NA 2GSEA 3A12A 3IJ7A 2VX6A 4CNPA 3CIXA 1X1NA 2BXYA 3GFZA 5C2CA 4M51A 5G5IA 3FA5A 4KEVA 5C8BB 4LAZA 5AHFA 2GWGA 1R3RA 3S5YA 2OYKA 3N13A 1EKOA 5J8LA 1OX5A 4LTSA 3S1UA 3SRKA 5HR7A 3WBAA 1OSEA 1AMYA 1BQGA 3HV9A 1DYSA 5I3GA 2QCLA 3GTNA 1E5JA 3V36A 1KBKA 1OFPA 3C52A 1GVOA 3TN3A 5FF2A 3S5NA 3ZXWA 4EX4A 1YDNA 3VGFA 4PEEA 1B30A 4GNJA 1JCYA 2QCMA 4Z17A 2ZJPJ 2G37A 1AH3A 1PTDA 3N18A 3TTYA 1K73J 1UD6A 4S38A 5T9CE 3TZNA 2VEMA 5CBJA 3N17A 1E72M 5FAJA 1W1PA 1K9FA 4JIQA 2OSYA 1U30A 4FF5A 4C7FA 2FVMA 1BKSA 4FLSA 3P5ZA 2J88A 2PWUA 4LGXA 2FYMA 4Z08A 1NF7A 5EPDA 1OF8A 3WD3A 5G1YA 3E2VA 3WDJA 4AD0A 2V82A 1EYEA 5M03A 2H8XA 3WEMA 3K2GA 5EMKA 3T44A 1GOMA 3VNDA 5A3HA 2EGZA 2OPJA 2QMKA 1QI0A 1WKDA 2PB1A 1A47A 2ZZ2A 3W1PA 2FFIA 1GOIA 3VC6A 4DWSD 3AHVA 3EWXA 2VC6A 2XSXA 3M46A 2DSJA 1XYZA 2GJXB 5FACA 4Z2LA 2Y4SA 1GNXA 2OT0A 4PUUA 3NVVC 3W6LA 3NNTA 1WZLA 3NQ8A 5AYXA 1A5NC 3GRIA 1EJVC 2VXNA 5CPLA 4MB1A 2J7GA 1GZ1A 1H7PA 4AEEA 3ZR6A 5I00A 5FF4A 6CGTA 2QVHA 4FNQA 3W1NA 4YMZA 1EC8A 2EQDA 2YDRA 4WCEJ 3GG0A 2PDJA 3CV6A 3BWWA 3KRBA 3L5AA 3N1AA 2D0FA 4L65A 3EAUA 5FJJA 2IKGA 2QHAA 1E6QM 1E3ZA 1S2UA 3PS7A 4HA1A 2BHYA 3FYYA 4GWEA 2JE8A 3TAOA 5M3WA 3TN6A 3DC0A 2VYOA 3W2MA 1E9IA 2E6DA 3QPYA 3PZGA 4H7VA 1S1PA 4UTWC 5AVHA 4LUIA 3GDBA 2ZUUA 1L8NA 1QNRA 1YTKA 3B4UA 4D6CA 4OJYA 2WVVB 3LCGA 4IIDA 1KRAC 1S2WA 2XIQA 4TQTA 1XS2A 2QW5A 2VC7A 4KERA 3N9RA 4AZIA 3NSXA 4U10A 3ATZA 3EDDA 1O66A 2CLOA 2XGIA 1GOQA 1I1XA 1QOQA 2WCSA 1QK2A 2DY3A 3MP5A 2BXVA 1DWJM 4K8EA 1QASA 1SZFA 3F4CA 4XAYA 3AN1A 3MZ2A 1B31A 1AFSA 1BKHA 4V28A 4WKFA 3RJXA 3V5OA 1JUKA 3GUWA 2VHLA 1R9YA 4JNMA 2PDQA 3VUSA 1UWTA 4O1AA 3O07A 1YTDA 3L4XA 3LA4A 4IH3A 1B3YA 1SQ7A 3PTMA 4BJHA 1ZP4A 3V5FA 4GKTA 1SW3A 3E3HA 4Q4QA 3SY8A 2J0FA 1GYNA 1SFSA 3BE7A 1RSCA 3WMBA 4Q4OA 4M24A 3WLHA 1NWUA 4ROPA 2ZC8A 3P67A 4Q7BA 1PKYA 4ADSA 2CWNA 5D8ZA 2UV8G 3GD6A 1MFVA 1FCBA 4BA0A 4FPSA 2G5WA 4MMWA 1MVYA 4S3AA 3T0DA 4PL1A 4UFLA 9CGTA 4JFVA 1ZGDA 4FIQA 5D03A 1PIIA 1JZ8A 2SFPA 1N8RJ 3LX9A 4U67J 2DIKA 2PD9A 2OTDA 4AEFA 3PPCA 4JKMA 1XIHA 3NYDA 2ICSA 5LHFA 1FWCC 5JBDA 2XWDA 4N2YA 2NW0A 4UNLA 3L12A 2NWRA 1T40A 1TO3A 2OFJA 1NDYA 2D24A 2R6OA 2HXUA 2FVKA 1KFEA 2YLAA 1ONRA 5EFDA 1VQ7H 1TYGA 3T0BA 5C9UA 1Z32X 5AVNA 4EF8A 1NQ6A 5CC5A 4DJFD 4FNUA 1GG0A 1SR0A 5M1TA 2ZZ3A 4Q8NA 3ARTA 1SM9A 2QYGA 4R34A 4NZ3A 3CC7H 4FK9A 2JK2A 1QW9A 1DHPA 1J11A 3HB9A 4OV9A 1EZ2A 1VEOA 3N4FA 4TTUA 1DWIM 1E4MM 3M6DA 2YGYA 1UBSA 3BAKA 4JY8A 1NDZA 4L9YA 2ZOXA 3DCPA 3K1GA 3SRDA 4Q4MA 4DF1A 1SO5A 1WKIA 4ZODA 3IARA 4J35A 1HVQA 1Z48A 4LBRA 1QATA 4I90A 4Q8QA 4R9OA 1PTGA 3PULA 1W9XA 4TV5A 3EB4A 5D9OA 2XSBA 1VIWA 2WMIA 2PAJA 3LPOA 4EKJA 5FJUA 3NR0A 2PS2A 4HPHA 3CMGA 4X46A 2XIJA 1OFRA 1PZ3A 4Q8OA 5HXMA 2BHUA 1Y0EA 4AP8A 1IE7C 3IK4A 3UZ5A 2NV1A 3WG6A 3CCLH 4UQBA 1O5QA 3ICJA 5ECUA 1ZQ5A 4I9AA 4KQNA 3WK1A 3SGUA 4DWSC 1F4HA 2EPNA 3R94A 3WQPA 4HOZA 4IPLA 2PZNA 1E56A 1IT8A 4YLWA 3M0VA 2OWWA 3G1SA 1K7XA 1S5WA 5C9ZA 2XVNA 1FWTA 1VP5A 2J77A 3SUUA 1EJSC 4EF9A 1FCUA 4RV8A 1C7TA 1ZJHA 3SCOA 1R5YA 2HWGA 3GFYA 3OIXA 4NZ4A 4LT9A 4GC4A 2PWEA 4PMOA 4P8XA 4AEOA 3GC4A 2AOSA 3WIJA 3NEVA 3OW2H 4AVFA 5G2IA 3MYPA 1KM2A 4UFIA 5HMFA 3LEPA 2BOGX 4O18A 4ZEPA 4FNTA 3SCPA 1CDGA 4ZGYA 4R7OA 4F0SA 3CL8A 4GI4A 3W1MA 2IKIA 4ZFMA 3R11A 2E9MA 1QOXA 3QR0A 3QBUA 3RITA 2GGJA 4BS0A 3TN5A 2DZSA 2ZUVA 2YFNA 5F2MA 1DOSA 1UR3M 2V9DA 5A6SA 1JUBA 2OX4A 4DO5A 4LYPA 1JCXA 3IUHA 4LFYA 3G0UA 4DYKA 3N14A 1VCGA 5D05A 1B3VA 2PDYA 3ZSTA 1LL4A 1XL9A 2Q6ZA 2GFTA 3ARZA 4LF1A 1OK6A 2GUBA 1NQKA 3GG8A 4JTLA 4H00A 3UZXA 1Y7VA 3GVWA 1KKRA 1YIJH 2V3DA 3GAYA 2HVOA 1KR0A 5DMNA 2V68A 3WQEA 4LS0A 3VOHA 1ZBCA 2Y5EA 1QO2A 4QLKA 4I5UA 4DY1A 4AG0A 4DBUA 4PMDA 1VS1A 2P5NA 3NQCA 2FMNA 2G96A 2VD8A 3WNZA 1HGWA 2OEJA 1SO6A 3BDKA 3WFZA 3FVDA 4PGLA 3RUBL 5HUPA 1MUWA 1SW0A 2CLKA 2PGFA 1W5QA 4ZXOA 2NT1A 1JDDA 3SI9A 4NI8A 3M5VA 3QW3A 2WNZA 4M1RA 5EY5A 4O16A 3WJXA 1E6SM 4RPPA 3VOFA 4MM1A 1HFBA 3N12A 3M5XA 4B5VA 3R4IA 1UKOA 1VFHA 2Z28A 2NWSA 3R0UA 2PF0A 4BWLC 1J0KA 3CIVA 5E9AA 1FX6A 3WH5A 4FOJA 2E8ZA 3U9IA 4BEQA 3TOYA 4MWAC 4A3RA 5FD0A 3VMOA 1D8CA 1WYIA 2W92A 4LB4A 4F0LA 4GY1A 2QIIA 4ZXLA 2A7RA 1HN1A 3WBXA 5DXXA 7PTDA 4GD0A 1UASA 5LZLA 3ZLHA 1JPIA 3EKLA 1LYXA 3D46A 3ZJ7A 3NPXA 1FWSA 1L2QA 2CXGA 4NQ1A 1ZZMA 4IIEA 4Z1CA 2YZ5A 2D2GA 2QULA 2ZX5A 3OJGA 3VIOA 4UCFA 2VUYA 2NV9A 5CKSA 1MUMA 4EACA 1CZ1A 3S47A 2CERA 4P5UA 3DC8A 4IX2A 3W24A 3GC5A 3LCLA 4OVXA 2Z24A 4JYEA 4NHVA 2DT0A 1PHWA 3W84A 2EPOA 1DL3A 1TPH1 3ZT5A 1ITUA 5CPNA 2ZC1A 3W7QA 4H6RA 3KE0A 4UMBA 5A6MA 2FZDA 2AQWA 2Z27A 2Y2WA 1VEPA 3GH7A 1UCWA 1VGAA 4OTKA 2ZXQA 2A0NA 2IPFA 2YW4A 1EP3A 3WH6A 4XAGA 2VCCA 2F2HA 3T40A 2VQUA 5CPTA 5A8OA 2WV8A 3CO8A 2HDJA 1UKQA 1X97A 3ZLGA 3K8KA 4DXXA 3WLPA 1IGWA 3VCRA 2UY4A 2W0UA 4H9XA 4ZQNA 1GHRA 4YWSA 4KCWA 4HZMA 2X42A 3S46A 4I5XA 1AQMA 1VKFA 3EZ4A 3BV4A 2BBFA 3DFPA 3RHGA 1DJHA 4PTWA 2OR2A 1AODA 3UD6A 2OO6A 3TNOA 4MFDA 5G1MA 3RCMA 4YS1A 4H8VA 1JZ3A 4QXIA 5D09A 3AWNA 1ENUA 3CBWA 4NT0A 3M9YA 1EO7A 2G3MA 1YHQH 3M0LA 2PDPA 1TWZA 1AD1A 1A5BA 2B31A 1D2KA 4UXDA 4UUIA 1TUXA 3KBSA 2BVTA 1U5VA 4WY0B 5JIWA 3WQCA 3UG4A 3HOJA 1JYVA 5CLTA 1WX0A 1UH2A 2DU2A 2FQIA 2BX7A 4UTIA 3DEQA 1VBUA 4V1YA 2ZTKA 4KW2A 2NX1A 1H2JA 4W4QA 3L9CA 4HOXA 4KWSA 1K6AA 2GJRA 2DUXA 4Z2JA 4JKKA 3LHVA 2ZX9A 3I6RA 2DUAA 1REQA 3W7CA 2J74A 1TR1A 1FFQA 2BG5A 3B8SA 3AALA 1R0MA 3I7RA 3VGDA 3W7PA 2OYMA 3ANVA 1VJSA 5E9XA 3T42A 1Q2RA 3SSJA 3VFCA 1F76A 3FOKA 4WJ8A 2WB5A 3QZAA 1I6NA 3EOSA 4YVVA 4HP5A 5REQB 1GZGA 1Q65A 2P76A 1EJRC 1NIUA 4O15A 1E4NA 5RUBA 3ISIX 4IMAA 4UBPC 2PDKA 3BOFA 4AIBA 1NWSA 4WDTA 3G18A 1JDAA 4YTTA 2V6AA 1UWIA 1TTPA 4YU1A 2VUNA 5HULA 3FFSA 5FEZA 3NVYC 5F7UA 2IMRA 4KCUA 3GVQA 2OYLA 4L6DA 2FB2A 4W87A 4CU6A 3RCYA 3MJMA 2QJJA 1FWWA 5KITA 3P0XA 1FUYA 3C8NA 3R25A 3GM8A 2C7FA 4E0CA 5FESA 5CJMA 4RX0A 5FJOA 1KV5A 1M3UA 1PYMA 1A5KC 4JL2A 3A64A 1QAPA 3W7KA 1E70M 2BNJA 3EEGA 3TQKA 2DFAA 4Y9NA 3H4WA 5LNRA 3IV3A 4JTIA 1Z9AA 3A47A 1XH1A 3SCNA 1QNOA 3WN6A 3DX5A 3LCIA 4UQEA 5K9XA 1SZNA 3PAOA 1H4PA 1W9DM 3RJYA 2HE8A 3KBVA 4AAJA 3LCXA 5AYYA 2D3LA 2OEKA 4F0RA 3WNNA 4YTQA 3VD9A 3T2OA 3RMJA 2C16A 4AMCA 2BY3A 1KD1J 2BB0A 4FNRA 1NDWA 3O15A 4WJXA 2XM2A 3CHDA 1E43A 4MLJA 2EPHA 3I4EA 2QGYA 5BWFA 4Q8UA 3QGAC 4NKCA 4EAYA 4JQ4A 4K36A 5TBOA 5JVHJ 3QQWA 3ECQA 2WNQA 2E67A 3FLUA 3KCOA 1JXKA 2C15A 2A7NA 5AHNA 3URBA 4Z2IA 3UGRA 2ZVIA 4PTVA 2J7CA 3WL0A 2G3NA 4GX8A 4C7GA 4PMZA 3WO0A 2D22A 1FHLA 1BSLA 4K8HA 5CPMA 1YADA 4MPQA 1RALA 2X7VA 4JAWA 4KF1A 4HT3A 4C6BA 4NYUA 1EF2A 4AVNA 1OJXA 3LDVA 1AD4A 4TMCA 3G3MA 2Y62A 3DI1A 2OX1A 1HKIA 3IV8A 3A13A 3CYJA 2V2HA 1YNQA 3M64A 2GLKA 4W5ZA 1V0NA 3SR7A 3GVGA 1J5SA 2CCRA 3JR2A 4FX8A 3B0VC 1QI4A 5KZ6A 2C19A 3APTA 3KBMA 3W7EA 4Z1YA 1DORA 4ZQOA 5A2CA 2CLMA 1XV8A 1HNYA 1ZJBA 4LY4A 3RGTA 4QG6A 1KRBC 3GFXA 3SCWA 3FN9A 1MO0A 3ARQA 2ZX8A 1BYBA 1IHIA 3I7SA 4V15A 4BY3A 4N9DA 3USZA 1X96A 4DYEA 3CCRH 3R0DA 1CXKA 4KFOA 3EX1A 2NV2A 4XIMA 4GINA 2QNEA 4LC8A 4D72A 3W2LA 1IWBA 2W62A 1RBOB 3BURA 5KTLA 2VVNA 3SCVA 2PBOA 2PTYA 2DSVA 1N5XA 3RAOA 4A29A 2XG9A 2PDCA 2I5IA 2ZUMA 4B3KA 3L0NA 1EOMA 4KCTA 1AG1O 1CEOA 1VF8A 3WJWA 1CXFA 4PMYA 1VFFA 1DJXA 3PBGA 3VIJA 4C6IA 3G1FA 3TROA 5D2XA 3RPFA 3F5KA 3I55H 1VB9A 4E38A 1M41A 2I5GA 4L64A 4BF9A 3ANYA 3KLKA 3E6EA 3L2LA 2VZSA 3I6TA 5C2XA 2E4TA 1FKXA 1BG4A 3K8MA 3FVMA 2XVPA 2WK2A 2O0TA 3W1XA 4DIAA 3SZ8A 4UQAA 3W83A 3DGBA 1KCKA 2WSYA 1KFCA 1VRXA 5E1QA 1JPHA 5JU6A 2YL9A 4O50A 1PS9A 4I6VA 1SSGA 4GUIA 3W87A 4JQ3A 3UA4A 4B5XA 1QUMA 4QLLA 1US0A 3QSTA 5DMYA 1ZFJA 1Q85A 2CLEA 2REQA 2WKJA 3WELA 3MHUA 5LNSA 4F8XA 3FHAA 3VKBA 4JFTA 1J10A 4G7EA 1BYDA 3BAYA 1ODUA 1K70A 5IBXA 2YFOA 4QRNA 1F61A 3DN5A 3PC0A 1VDVA 3M0IA 1K77A 4C6MA 2VTFA 1NVIE 3TYDA 2YCJA 3BQ6A 3EWWA 3APYA 1JJKA 4IIGA 4A3YA 3SY5A 4HNVA 7ENLA 2VC9A 3GW3A 3SO7A 5E93A 1JPMA 2A3LA 2ANUA 3KL0A 2DZWA 1LQ2A 1C92A 5CPOA 3UZZA 4XD4A 5FJRA 5T91A 2QPSA 3F7JA 1YX1A 3QMRA 2J8TA 1V7AA 3OPSA 1TELA 3BSGA 1JDFA 3M7SA 2W63A 9XIMA 4HA3A 1CB2A 1DV7A 3NVTA 3BIIE 3S2LA 3F4VA 5DBUA 3WO1A 4RKAA 4TR9A 3P8JA 4R53A 4N6FA 5A2AA 2Q8LA 3FJNA 1KBLA 4A6GA 2PDXA 1XP3A 4HMNA 3QV9A 5LIKX 3NQDA 3W2KA 2NQZA 4OBSA 4JTKA 1TREA 4HNCA 2EHHA 4LRTA 3A4XA 5M2FX 3VKJA 3NQ2A 2Z7GA 3S2JA 6ALDA 2O9OA 2EJ1A 5E6YA 4QISA 1EOKA 3LI1A 1GVEA 1V08A 3LU2A 4FX6M 5I77A 1M7OA 5F4WA 1X1ZA 3TR2A 4MDOA 2QF8A 5TNVA 4YL2A 5HK4A 4QJ5B 3FAHA 4WSKA 5GJNA 2PDWA 1Q7MA 1JULA 4W8LA 1RY0A 1IZJA 2BSLA 3IWPA 1G6CA 1HJVA 1X8CA 1YLVA 1JEZA 4EWJA 1OHLA 1RD5A 1TTJA 2CBUA 3L4TA 3MDUA 3C86A 4JIHA 1W0MA 4WGXA 4HHLA 4NU7A 4CNTA 1V8EA 4QDPA 3IGHX 2OQYA 4KEMA 1X8FA 1DJZA 3R12A 1JD9A 1M04A 1CBGA 3DG6A 4B4FA 2AGKA 3OTRA 3I4KA 1G69A 4JYDA 3LRKA 2NXGA 1QCWA 1R7AA 5BMXA 1H1ZA 3O8AA 2V2CA 4U31A 1WOBA 4HTBA 1NWTA 1KLZA 3QXBA 1P6BA 3UWEA 1VZWA 5GPRA 2FH6A 4Q7NA 3KRZA 1JPKA 3E9AA 3LY0A 2R1LA 3NS1C 4QQ3A 1YE6A 3U2OA 4D6EA 1J0ZA 1YXDA 3IRDA 1G0CA 5EFFA 3MMWA 5GADN 3N2XA 4MWAE 3TYUA 4ATLA 4C5ZA 5AN9F 1PTAA 4GX9A 4NF7A 3GE7A 1CXIA 4MNKA 3KCLA 4OHQA 3GIQA 1Q8AA 4AD4A 3W27A 3HBLA 3SJNA 4BWLA 4PE8A 1G01A 2BY2A 3WLQA 3CCMH 3CQIA 1ADSA 5MHBA 4MPKA 3AXKA 3O6DA 3EBVA 2F6UA 4CD5A 2D1ZA 1NP0A 4L9XA 3Q45A 4IP7A 2E6AA 1UP0A 1K4GA 4GIAA 2QPXA 1PKLA 1LRTA 3VO0A 2BWGA 2MUCA 4O57A 3G6MA 4D6HA 2NX3A 2WSQA 1D7FA 3VNMA 2ZQ0A 4XD5A 1WUEA 4C6QA 4MOZA 1HKVA 4RCXA 3GTXA 3V35A 1TWDA 2UWFA 5E09A 1F6PA 1TWSA 3CU2A 3FW6A 3GR8A 2V63A 3EWZA 5AHEA 3GQYA 4NYYA 4F0MA 4C65A 3AUJA 1ZBWA 4HMDA 3UY8A 1MMFA 1BXBA 4Z0JA 1UJQA 4QS6A 1VLIA 3RM9A 3PBVA 2DH2A 1RR2A 4NUWA 1IEQA 3HURA 3W4RA 2VVSA 3S3GA 3TMQA 4M8UA 1N63B 5TQLA 3NSNA 4IMGA 1K8ZA 5G4EA 4IP4A 1UQZA 3DYPA 3M0XA 3F03K 3E2SA 3KTXA 4AXKA 4ADTA 3CB3A 2HBXA 5HJLA 1MRAA 4KH2A 3H2CA 3WLRA 4GPNA 1QI3A 3WD0A 2E5BA 3KDNA 3C2FA 7A3HA 1Z69A 2WWDA 5MPOC 1LOLA 1Z44A 3W70A 5D2VA 1QTWA 2PWFA 4U33A 1EWEA 4XVDA 5FAGA 4NAFA 1R3TA 3FGCA 1JRCA 2Z7KA 1XM3A 3ORWA 1G4TA 1EPVA 3TX9A 2NVAA 2PWGA 1KW1A 1MNZA 3L7RA 3VOCA 4AMAA 1NH6A 3SIZA 3REQB 4WFAJ 2GVLA 4N9CA 1WPCA 4IMFA 1NFGA 4AISA 1JJ2H 5MKGB 5DCDA 1O95A 3H6OA 1LQ0A 1SZRA 3CO4A 5DQPA 1XC4A 4DM1A 3KUMA 4CVUA 5HNRA 1PZ2A 3MS8A 2XZ7A 1V6WA 2OQHA 2ZRVA 4FB7A 5G2WA 4DELA 3QN3A 4OE7A 2QPUA 3CMEH 4LS2A 1XBYA 2VZOA 3NVWC 2X1SA 2ZICA 3CHEA 4IT1A 4EP8C 2FKPA 3KRSA 1UWRA 1GORA 4JKLA 3VD5A 2OCZA 2E9BA 3VDGA 2XH0A 4RL3A 3FCPA 2GGHA 5KINA 1H61A