5HUOA

Crystal structure of nadc deletion mutant in c2221 space group
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
283
structure length
283
Chain Sequence
TDLTPFQIDDTLKAALREDVHSEDYSTNAIFDHHGQAKVSLFAKEAGVLAGLTVFQRVFTLFDEVTFQNPHQFKDGDRLTSGDLVLEIIGSVRSLLTCERVALNFLQHLSGIASMTAAYVEALGDDRIKVFDTRKTTPNLRLFEKYAVRVGGGYNHRFNLSDAIMLKDNHIAAVGSVQKAIAQARAYAPFVKMVEVEVESLAAAEEAAAAGVDIIMLDNMSLEQIEQAITLIAGRSRIECSGNIDMTTISRFRGLAIDYVSSGSLTHSAKSLDFSMKGLTYLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nicotinate-nucleotide diphosphorylase (Carboxylating)
publication title Streptococcus pyogenes quinolinate-salvage pathway-structural and functional studies of quinolinate phosphoribosyl transferase and NH3 -dependent NAD(+) synthetase.
pubmed doi rcsb
source organism Streptococcus pyogenes ga06023
total genus 90
structure length 283
sequence length 283
chains with identical sequence B, C, E, F, H
ec nomenclature ec 2.4.2.19: Nicotinate-nucleotide diphosphorylase (carboxylating).
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01729 QRPTase_C Quinolinate phosphoribosyl transferase, C-terminal domain
A PF02749 QRPTase_N Quinolinate phosphoribosyl transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5huoA02
3.90.1170.20 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Quinolinate phosphoribosyl transferase, N-terminal domain 5huoA01
2ALDA 4MKNA 2CLLA 3TJXA 5KSWA 1Q6RA 3PBUA 2JBMA 1MSSA 2X1SA 1KFBA 3W1QA 1M7PA 3C61A 5AHEA 2WNQA 3EX6A 2Q3RA 1IF2A 3S5ZA 4MIMA 2JGQA 3N9RA 5EMUA 2VEKA 1DOSA 3LCLA 3BLEA 1RR2A 3HG2A 3LTPA 1VCFA 4JD4A 1Z42A 2ZCGA 3L67A 3O07A 1ICPA 4RV8A 3USBA 2ISWA 2E68A 3HO8A 4IMEA 1AMKA 4G1KA 1YTEA 1DKWA 5LGXA 2A7RA 5AYYA 1XUUA 1GEQA 1KBJA 4LTSA 3IV3A 4IPJA 4N9EA 3NPVA 4KFNA 1A53A 2C18A 3CTLA 1FBAA 3CU2A 1WV2A 3EWZA 3FJLA 3G0UA 3GXTA 3GNDA 4FEZA 4NU7A 2J88A 4UTUA 4K38A 2A1YA 1EP2A 3HJZA 5D03A 4M7SA 2WNNA 1L2UA 3A5FA 3A5VA 1O94A 1UB3A 2QF7A 4K7YA 3Q37A 3GAKA 2EGZA 3THAA 4X22A 4KWVA 1X6UA 3KRZA 3AJXA 4O15A 3DFNA 3P5YA 4JNMA 3L5MA 3OVRA 1SO5A 2X30A 3O6CA 4EIVA 3P7YA 1TJRA 4CCDA 5EKYA 1KFJA 3T78A 2A7PA 3DU0A 3NL3A 4IX0A 1OFEA 1XDLA 1W37A 2NUXA 2A21A 1BWLA 4LV4A 3PR2A 4UCGA 4S1FA 3CM4A 3AO0A 3INPA 3NL2A 4JIPA 1X1OA 2A4AA 4GC4A 1FCQA 3E96A 5EY5A 4JX6A 4LVDA 1F73A 2ZA2A 4CCCA 3NM3A 5L6UA 2NXGA 5LNUA 2FFCA 3NL5A 5MHBA 3HIJA 2Y7GA 4ADUA 3NEVA 1ZALA 2E6FA 1F74A 5AYZA 3E0IA 2TSYA 4WY0F 4NJJA 2QCHA 5AB3A 5I3HA 1YXYA 4O18A 2VFFA 4JTTA 1XC4A 2BSLA 2CU0A 2AAMA 2VFIA 4XTDA 4KWWA 3PSWA 1TSIA 7TIMA 2J9YA 5G1YA 3WK3A 2PC4A 1HTIA 2DZWA 4UMAA 1PHQA 4UUIA 1EUAA 1DQXA 5DY2A 3RK8A 4N02A 4IUOA 1K7EA 5KZMA 2ZFAA 2WKJA 5CZTA 5LSMA 4LU0A 4TMBA 1TB3A 4JTIA 3B0UX 1SSGA 3NVTA 1QO2A 1UBSA 3NQMA 2X1RA 2ABBA 2FQIA 3CWNA 3TQVA 1EX5A 1ONRA 1AW5A 1EB3A 3G0SA 1HFBA 1W56A 3M1ZA 1TTJA 4FNSA 2EF9A 3EX1A 5K4XA 3W1NA 3T4CA 1IIHA 2X16A 4O4VA 2C14A 3STGA 3GXNA 2NX3A 4O1BA 4LY8A 3MI3A 5HNRA 1FDYA 5AN7A 1YDNA 3MUXA 3G1HA 1I2OA 3CC1A 1W5PA 4ZQOA 3S5YA 3MHFA 2GVLA 3L66A 1C8VA 1HO1A 3TFCA 3S1UA 3TE9A 3LX9A 4QIUA 3CIXA 5DXXA 2XN0A 3I7QA 1ALDA 2YGYA 3HG4A 3P60A 4WX2A 3W1RA 3G1XA 1RPXA 3B03A 3W7GA 4MY9A 3SR7A 5E93A 2V9DA 1RD5A 1W5QA 1XDMA 4Z1DA 3UWZA 1H61A 3QEZA 3SJ3A 2H3DA 2B7PA 8TIMA 2HS6A 1NEYA 1HG3A 1EUNA 3RF9A 2E5BA 2OX1A 3TXVA 3GB6A 2VFHA 1XBYA 1LLWA 4B5NA 1SO3A 3M41A 2ZDRA 1JUEA 3FFSA 3S0CA 3DGRA 3HGSA 3EX2A 1ADOA 3EX3A 3B0VC 3KXQA 5AC7A 3P8JA 3PVFA 1X8FA 5LHFA 1OFDA 5AOUA 4UXDA 4IGHA 2W0UA 1W31A 3I65A 3UYCA 1OYAA 3NG3A 3EEGA 2P0OA 4O0KA 3CB8A 2Y7DA 2NV1A 3NZ1A 1OFRA 1OX4B 4DEFA 4RX0A 1LRTA 4ICNA 4PA8A 4YLWA 4CQAA 3L5LA 1RQBA 4DF2A 3LDVA 4JS3A 3NPUA 5BRBA 2RDWA 2ZZ5A 3G1DA 2Y85A 4BK9A 4RLIA 3ELFA 3QMTA 4CNOA 2ZRYA 5CPNA 4DO5A 3BW3A 5KZDA 5I3JA 2VFDA 2OMAA 5FF4A 4K7VA 3M9YA 1SW7A 2FPTA 4HNTA 4W9TA 3HGJA 1ME9A 5C2XA 4UMBA 4OQVA 3C0JA 2WSYA 3LBCA 2XN1A 1VYPX 4IMCA 2WO5A 3KVMA 5LNRA 4Z0SA 3LCFA 1KLZA 2F7FA 3GAYA 4O54A 2CLHA 4IMGA 4DQWA 4UFJA 4A2SA 4EOUA 2DZSA 5FEXA 3DFOA 4MJZA 3DKLA 3G24A 1YPIA 3UWUA 1B3OA 2Y88A 4NNCA 4JTLA 4AHPA 2OT1A 1EWDA 3W9ZA 4HN4A 4WXYA 3W7LA 3GDLA 4UR7A 2J9XA 1UASA 3NGJA 1FDJA 4ZQMA 3H55A 4IWWA 3QSRA 1K03A 3ATYA 3I6RA 3L68A 4LS2A 2DJLA 1QFEA 5TBOA 4A29A 3EWXA 4MZYA 3C2EA 1FUYA 4XZ9A 1J5TA 1UUOA 4DELA 5LNVA 3UWWA 2AGKA 3WK1A 1W54A 1GTEA 2QCLA 3S1XA 3VFLA 2GVGA 2H8ZA 4XKYA 5D09A 4MOZA 1OG0A 1LRQA 2VENA 5DY3A 3UXDA 1W1ZA 4PC8A 5D2TA 1K8ZA 4MZ1A 1QR7A 3E12A 1E51A 1KM4A 3BLFA 2V2CA 2A6LA 3GNNA 2G95A 4FIQA 2C6QA 5G2IA 4H3DA 2PCQA 3NAVA 3O6DA 4M6PA 4OT7A 4DPPA 1G7VA 4FF7A 1FCVA 3GDTA 3GLCA 5CPMA 1OFAA 4Q33A 3CWOX 1OX4A 3W74A 2E77A 4HHPA 4NQ1A 1G7UA 1GG0A 4EF9A 1G6CA 3G1SA 3ZWSA 3DHFA 1KM2A 3KRUA 3NQAA 2ISSA 4ML9A 5J5DA 3QW4B 1ZNNA 4O57A 4LVFA 2VELA 4IXHA 2DORA 1Q6LA 2FLIA 4MVAA 3P8IA 1RQHA 1LTDA 5KITA 5L9FA 3WFAA 2GQ8A 3A21A 4UTWA 1OVDA 1WX0A 1G4EA 4NJKA 4NJHA 1GJPA 1H7WA 2QCEA 3LXCA 3MP4A 2YFOA 1U83A 4UFKA 1OX5A 1I8JA 1S5VA 3SZ8A 4O1CA 1TREA 3L2IA 4JGDA 1FWWA 3PWAA 4CNNA 1O5XA 4O0ZA 1SW3A 1H7RA 3W7OA 4CQ9A 3TIMA 4QISA 1MZHA 3NR0A 4E2BA 3UPBA 2D73A 4P2VA 3U8GA 2VOMA 1B9BA 5D2YA 2QUVA 5AHFA 4DF0A 3GKAA 4N2YA 4KKXA 3M5VA 1VRDA 1KTNA 4AWTA 2C0AA 2XFWA 2HSAA 4FX8A 4JDBA 4NVTA 4ZQPA 3CIWA 2R14A 3NZRA 4RCXA 1S5WA 5K9DA 3NQCA 3BARA 1PCWA 4BFAA 4QNWA 3DENA 2QCCA 2QCFA 4UTHA 2G5WA 2CZ5A 3T55A 1WOAA 5H91A 5BOOA 3BGJA 3LLDA 1W5MA 4Z0JA 1DBTA 4FX6M 4LVGA 4O4WA 5FF7A 3ATZA 3W70A 3W2LA 4K6AA 1N55A 3TROA 3HBLA 2I1OA 3B0PA 4UTTA 3IVSA 5HR7A 3O16A 1NF0A 3N34A 5CSRA 4UTIA 4K8HA 5FI8A 1VPXA 3G1YA 4FNPA 3KHJA 1DJNA 3IIVA 2VFGA 4PFMA 2YX0A 4GUFA 3LLFA 4OU1A 1P4CA 1C9DA 2Y62A 2CLFA 3G3DA 1XFBA 2FTPA 3IEBA 3HGOA 4DO4A 4HPXA 2VEPA 2GQAA 2VKZG 1F6PA 4RR4A 5HWNA 1IXNA 3O6YX 5C54A 2UV8G 1JCMP 1ZFJA 3P81A 1OX6A 3DFPA 4DBEA 5G4WA 2JKPA 4ZQCA 3W2KA 3PBWA 1KM6A 3MBFA 5FF3A 2H6RA 3N2XA 3UNDA 1KTCA 4BR1A 2HS8A 1EEPA 3I7SA 4PL1A 2DU2A 5BW6A 4ALDA 2QJIA 2V8ZA 4R53A 4JY8A 3P84A 1TQJA 3TW7A 2ATSA 3JR2A 1TPVA 3FOKA 5IBXA 4UNLA 4BWLA 1LYXA 3G18A 1I2NA 4JIQA 4X9SA 3CHVA 4A2RA 4JTGA 4UIOA 1LM1A 2ZYFA 2H90A 2V81A 3CEUA 4AAJA 3TMQA 5A5WA 2P10A 4RZ6A 1JR1A 2YW3A 3TW6A 4NX0A 3PG9A 3GVGA 4RXGA 4GUJA 1SQ7A 4L4MA 1DQWA 4TU1A 3VKJA 2ZBTA 4BF9A 3PB0A 2X1UA 5CGQA 4HSNA 5I3FA 3PC0A 2YYUA 3W7MA 4E38A 3W1AA 2ZZ6A 2JKAA 3W3OA 2NUWA 3CEPA 1P1XA 3GDKA 1Q6OA 3S1WA 1FXPA 4DXVA 3C2OA 1VCGA 1HUVA 3LGEA 2Y89A 3PBVA 2QCMA 4UNKA 3G1FA 3PM6A 3T44A 1B4EA 3DAQA 5LNWA 2HTMA 2ZRXA 3NYZA 2Z0IA 2DZTA 4S2BA 1YTDA 4OBTA 1G4PA 3W1LA 1VHNA 3FS2A 3C3NA 5FEZA 3DFQA 3M6YA 1TRIA 4PL2A 5K9CA 2GJNA 1OK6A 2R91A 4UC5A 3T40A 5FESA 1W3NA 3NL6A 1WYIA 2Q3OA 1QCWA 3TSDA 3UXAA 5EA9A 1BEUA 2G97A 3M44A 1SPQA 2X2GA 1VHCA 1A50A 4O12A 3MYOA 5D33A 1QPQA 2O7SA 4ORMA 3UZ5A 3EWUA 4A3UA 4BI5A 1OF8A 1AG1O 3BGGA 2NXIA 4DBDA 4ZL1A 4UR8A 1AK5A 2A5HA 2V82A 2A0NA 3C4UA 3R2GA 3C6CA 1KBIA 4JR5A 4NJIA 3UY8A 3DFSA 3RMJA 3QSTA 2X1TA 4EVZA 5EPDA 3RLUA 3GK0A 2JK2A 1SZFA 4JY9A 3LHUA 3O06A 4U28A 1XBZA 3ABSA 3GX9A 3W7PA 3TFXA 1O5KA 3LRMA 3LHYA 3W86A 2DP3A 1P0KA 2IQTA 2GVJA 5CG7A 2Z1BA 2C15A 4K8EA 4CNPA 1TMHA 4JN6A 4OE7A 3S5OA 2FPYA 2QEZA 1KFCA 3GYEA 3TNOA 4WD0A 1H7NA 3LRLA 3KVJA 3GR7A 3O1NA 1TQXA 2V2DA 4AEOA 2TYSA 4NZFA 4Q32A 4AWSA 2CZFA 3O05A 1UUMA 1UJPA 4TMCA 3LCXA 3W7KA 2CW6A 3MW7A 3W2JA 2Y70A 3LV6A 3IIPA 1MO0A 2B4GA 1Z41A 3BVJA 1LORA 3L5AA 2G96A 1K8XA 4QITA 2YYTA 3EXSA 4JXCA 2YFNA 3R8RA 3G0XA 4Z1CA 5D2XA 1DJQA 5AC8A 4MPQA 2YZRA 4Z1AA 2E6AA 3NDOA 4POCA 3MHGA 4JYEA 3EXRA 3TXZA 5G5IA 4LC8A 4E0CA 3S9YA 4HNUA 4O52A 3B8DA 5CSSA 3KVLA 4IQLA 3JRKA 2C16A 4O8RA 3BW4A 2EHHA 4O1DA 1XI3A 2QKFA 4HNNA 4MLJA 4TO8A 3TC7A 1H5YA 2Y7FA 1LZOA 3TX9A 3NA8A 4TR9A 3PS7A 1QDSA 3UZJA 1IXQA 3EWBX 2DZVA 4AMAA 1OFPA 1RVGA 4O10A 2VXNA 5CZJA 4FB7A 1TV7A 2CLIA 3QPYA 1RV8A 2OJPA 2YXGA 1GVOA 3TCEA 3ZWTA 3QC3A 3BK0A 2P1FA 3ZS4A 4LUIA 1ML1A 4O11A 5G2HA 1XKYA 2V5LA 1F6KA 4MY1A 4XKYB 1OFOA 1QPNA 1OF6A 2J6XA 2VEIA 2TRSA 2J24A 1PHWA 5DN1A 1XM3A 3KRSA 1TCDA 1Q3NA 1WBJA 1YXDA 5KMYA 1XBXA 4HNVA 1I4NA 3TH6A 3EWWA 1R2SA 3GKFA 3NPWA 4UTJA 4XBSA 4UFMA 1K3UA 2QUUA 1H62A 1GTHA 2QAFA 4JYDA 2ZZ7A 3CLMA 1P5BA 3DZ1A 4R7JA 1H7XA 4OV9A 2GUUA 3NOEA 4LNYA 2NLIA 1THFD 1WXJA 4GXMA 2DZXA 1P0NA 3WJXA 1B57A 3W87A 3L0KA 1W0MA 3VI2A 3WK2A 3KAOA 4OWGA 3VCRA 3LCWA 3C2FA 3PUEA 1L6YA 4JX4A 1FY6A 5HUPA 5EL1A 3W7QA 1M7OA 1JRBA 3O8AA 3LCHA 3QMRA 1M6JA 3IGXA 4WUIA 4O1AA 3HB9A 2O7QA 3G22A 4DF1A 5LKYA 4N9DA 3EX4A 1RQEA 5DCBA 1QPOA 3N9SA 4GFSA 3FLUA 4LRSA 3GDMA 2ZRZA 3NQVA 3DI1A 4Y9AA 3W2MA 2ZRVA 4JTSA 1FCBA 4LV9A 2WPBA 4X3ZA 3DXIA 3UPWA 6TIMA 3CQ0A 3GZ3A 4NX5A 2ZZ2A 3IIOA 1FWTA 3H53A 5TIMA 2YDAA 3EKLA 1B4KA 1ZCOA 3QQ1A 1FWRA 1J4EA 1QO5A 4UFLA 3WJZA 1V5XA 2H8XA 2BXVA 4O13A 2ATMA 4LVBA 4R34A 3M7WA 3G1VA 2BX7A 2E5DA 3BW2A 2NWRA 4GUGA 1VR6A 2FDSA 5C5YA 4QQ3A 3W7HA 1YTKA 5F4WA 3DKJA 1PIIA 4Z08A 4A21A 3C52A 3TSBA 3PSVA 2ZZ4A 3Q2DA 3B04A 2RKXA 3LM7A 3MWAA 1TIMA 2QDHA 1LROA 5DELA 2QCDB 5CKSA 2Y63A 3KX6A 3HOJA 3U6WA 1ZJIA 3CPRA 1OABA 4YCPA 3H54A 3RNDA 1IIGA 1TV8A 2JGYA 3F4NA 1LOSA 2OT0A 4X2RA 3M0ZA 5C55A 5FF2A 1CX9A 1SO4A 3G8RA 2ZQ0A 3OBKA 3S6DA 4OGZA 3BV4A 3IRDA 3I68A 3NQ7A 4GBUA 3UD6A 1ZY9A 4YMZA 3W22A 5DBUA 1CW2A 3QYQA 2Z6JA 4RXFA 1A5BA 3LI1A 1QOPA 2QCGA 5FF0A 4S2CA 1OFBA 1RZMA 1JULA 4WOZA 5D2WA 3STEA 1KM1A 4WZHA 4ZMGA 4H4IA 1WBHA 3P61A 4WJEA 1LCOA 4UFHA 5BNKA 3LXBA 2FJKA 1W8SA 3S8HA 1F76A 3SI9A 4U4MA 1KV8A 2EKCA 3IIXA 4JTUA 4J9JA 3FKKA 3L9CA 3TC6A 2PRLA 1DVJA 3ABRA 1GQNA 1Y0EA 4JTFA 5J5RA 4Y96A 4UTMA 2V30A 2FPVA 2ZTKA 2QJHA 3K30A 3YPIA 3M5XA 1H1YA 1GPWA 3KOFA 2W6RA 3QMSA 1JCJA 3L0NA 3NQ8A 2PRHA 5IM51 2V0TA 5FEPA 3LTSA 5HQEA 3P62A 4RZ4A 5F4SA 4JTJA 5KTLA 1L9WA 3MI2A 5FEWA 5K3VA 4N9BA 1O60A 4JTEA 3W88A 1VS1A 4M5PA 4L4LA 3QM3A 5U7SA 1I2PA 4LS0A 4K39A 3W7EA 4QM1A 2H3BA 1TJPA 2QCDA 1YXCA 2VC6A 3C8FA 1VQTA 3HG3A 3PY2A 3NPXA 3M16A 3Q58A 2E6DA 1H63A 4NXKA 3TR2A 3DHDA 1TO3A 5DCEA 4HPJA 2QCNA 4Q4KA 5D2VA 4ORIA 1DL3A 2QR6A 3LTYA 3W23A 1FWSA 2BWGA 3FEMA 4O53A 4YCOA 3PG8A 2F84A 3ANYA 3C56A 3QZEA 3HGRA 2VFEA 3TAKA 1OYCA 3LB0A 1TPB1 5SWUA 4O19A 3O15A 3A23A 1NFBA 4D2JA 3LHTA 1TYGA 1KFKA 3P82A 4EWND 3A22A 2YCEA 4MFDA 3W83A 4XQ6A 3OEXA 3MO7A 3NQ2A 3NXFA 1O4UA 3TMLA 3STFA 3VE7A 2Z6IA 1N8FA 1W3TA 3SIZA 1DV7A 5BMWA 1X1ZA 3ABOA 1SU5A 5HMSA 1XCFA 3DFTA 4AF0B 1TPC1 1VLIA 2B7OA 1AW2A 1L6WA 3PF3A 4MY8A 3UY7A 2YSWA 2Y6ZA 2Y7EA 2ZZ1A 4K36A 4I7VA 1GYLA 3P74A 2DZPA 3IVTA 3LCGA 5F2LA 1DHPA 5HWMA 3PB2A 5KINA 3EWYA 2OZ0A 3QH2A 4FNRA 3VNDA 1NAL1 1VZWA 1T8XA 2RHGA 1GT8A 1QAPA 3F03K 1KM3A 4NZJA 3W1UA 4M6VA 4FXRA 2ZRUA 2Y61A 4RZ5A 3TK7A 1FXQA 1H60A 4NNAA 4RKAA 4KFOA 4PH6A 3WJYA 1H50A 4O28A 5CZ0A 1OHLA 1LLZA 2BZNA 2YPIA 4Y8FA 2YR1A 4ADSA 3LRKA 4ZVJA 4DPQA 4MLRA 1JUBA 1L6SA 3QW3A 1W3IA 5CZSA 5K2ZA 1Q6QA 1VYRA 5HULA 1JQVA 3A9IA 3ZFHA 1VYSX 1ICSA 1SUXA 2NWSA 4GWEA 4XBKA 4CLMA 1R46A 2RDUA 3W76A 2CLEA 5F4XA 3MHUA 3W73A 1FX6A 2Q8LA 1YYAA 3O63A 4JICA 4AHOA 1JQXA 4ADTA 3HPXA 2C3ZA 5KZEA 4CQ8A 1ICQA 1I2QA 3QJAA 2FIQA 3LV5A 5D37A 5AYXA 3KFTA 1JRCA 3EXTA 4FHAA 3P67A 3MBDA 1W5OA 4N4QA 4QJ1A 3W1PA 4MUZA 3B06A 1PE1A 3DBPA 5K9XA 3W7RA 3S42A 3W71A 1U5JA 2WV8A 4JX5A 4NNBA 4QAIA 2DZUA 1PCKA 3NQDA 4JEQA 6ALDA 4IMDA 1SFJA 3SFKA 3LHZA 1GG1A 3W07A 3W6YA 1LRNA 4Y90A 4FXSA 1JCLA 4AF0A 3PUOA 4OV4A 4MFEA 3E9AA 3RU6A 4ZZ9A 4H6KA 1JCXA 1SZEA 4QNEA 3W1TA 3M43A 3W1MA 2NUYA 4PCFA 3TQKA 1LP6A 1KLYA 1XUZA 4JYFA 1C29A 1EA0A 1YLVA 1H51A 4NT0A 1XL9A 5HWJA 2J9ZA 3BO9A 3LERA 1OYBA 4MYXA 1F05A 2WSQA 1YADA 2NZLA 4N6FA 4AVFA 4LC6A 3OIXA 5GVJA 1G69A 1W5NA 1JUKA 3SECA 1QWGA 3W2NA 3F4WA 1VC4A 1ZENA 1S5TA 3FKRA 4QSHA 3UQNA 3W7DA 1LDCA 1SR9A 2V5BA 1D9EA 4MZ8A 2EPHA 2RH9A 3BPWA 3LBMA 1YDVA 2BTMA 4LWWA 5F2GA 5AHMA 1LBFA 2V2HA 4FX7A 3B4UA 4FIRA 2E6YA 2PE4A 2AQWA 5T26A 3QRHA 5C6MA 3RFAA 5AHIA 1D3GA 5G1TA 4AH7A 3W85A 3TUUA 4N4PA 1MXSA 1TPEA 2FB3A 5F2IA 4PODA 2TPSA 3OA3A 1ZAHA 3FA5A 4WY0B 1F7BA 1TPWA 3E02A 3MI6A 3BG3A 2NX9A 4AXKA 4GUHA 1LBMA 2QUTA 3EKZA 2YW4A 4C1LA 4CCEA 1MEWA 4GJ1A 5DXYA 3MJYA 4M19A 5AC6A 3UWVA 1VGAA 3UWYA 4GNJA 2FB2A 3C2RA 3IGUA 5HJLA 3TU9A 4FO4A 3U2OA 3UWQA 1EIXA 4FNQA 4R33A 3CT7A 3ABQA 3NO5A 4O14A 4WQ6A 3TV8A 4UTWC 5AFDA 3BG5A 4MYAA 3SY5A 4O17A 4EF8A 3LCIA 3F1QA 4LRTA 2NX1A 3V1PA 1WAUA 1WOBA 3FJ6A 3IIZA 1G4SA 2WOQA 4NJGA 4RK8A 3THQA 2GPTA 2CFFA 4PEKA 1HL2A 1SFLA 1VCVA 3SGZA 5G4EA 1F5ZA 3OVPA 1R30A 2I9EA 1HO4A 4ZQNA 1AL8A 1ME7A 3NQGA 3SSJA 2OCZA 5G2WA 4AB4A 2CLKA 4JTHA 4O50A 1T96A 4A22A 1SSDA 2E09A 5I3KA 1BKSA 3EB2A 3G1AA 3LHWA 3NQFA 4M7TA 3STCA 3GDRA 1WQ5A 3HPSA 1Z44A 3VE9A 5AHLA 2A6NA 1R2TA 3MP5A 3N3MA 3HMJG 1GVFA 2A85A 1KA9F 1PL9A 1JCNA 3TJLA 3MMTA 2W79A 5HUOA 3W7CA 3W1XA 1D3HA 3QQ0A 4I7WA 3QPZA 4DO6A 1EPXA 1PS9A 3Q94A 1KM0A 5DCDA 2VEMA 4JDYA 1TTIA 1NSJA 3R13A 3PAJA 1N7KA 1SZGA 2NV2A 5E0KA 3TA6A 3T7VA 3P80A 4Z1BA 5U4NA 3I7RA 4UTTC 3D0CA 2QDGA 1KW1A 4WY0A 1R47A 1SO6A 3NQEA 3JS3A 1M5WA 3BG9A 3OG3A 1KFLA 4ONVA 1MEHA 1SZNA 5A8GA 1FDZA 3FYOA 3PUDA 1LOLA 2ZTJA 3B05A 5F1UA 1G4TA 1TPH1 4WXZA 3LOTA 4YWIA 1T0OA 5LNSA 3HF3A 3WK0A 2Z2UA 4PTNA 4IX2A 3NNTA 3FIGA 4RJEA 2NXHA 5F2MA 2B0MA 2B7QA 4WOQA 3KVKA 1Q45A 1KTBA 2ISVA 5D05A 1A5SA 1XXXA 3FYPA 4AHQA 5ABTA 1MEIA 3RLVA 2GJLA 1FWNA 3W2UA 2ZA3A 1UCWA 4UTLA 3GR8A 2XN2A 4IPIA 3BLIA 3W7NA 1OJXA 1ZAJA 1VH7A 1GVQA 2GOUA 2ZRWA 1BTMA 2J27A 3N2MA 3G8EA 2Q8ZA 5IBXC 3MP3A 4P61A 4IJBA 1IXPA 4BWLC 4BI7A 2BLEA 5K7JA 4HIBA 4I9AA 4O16A 1TPFA 4M6QA 4AWUA 3LHVA 3SW6A 3OVQA 4OHQA 1GZGA 3PBYA 2PURA 4XTIA 4N9CA 1NF7A 3TAOA 3HG5A 5HINA 3LI0A 1QMLA 2B7NA 2QAPA 3PULA 5K4ZA 1NVMA 2C13A 2A2IA 3NQ6A 5HR6A 3E49A 4FNTA 5D32A 3M47A 4BI6A 1PV8A 4UMCA 5EBUA 5H2ZA 1YPFA 3W75A 3DI0A 3S1VA 1K02A 3WJWA 3QFEA 4YL2A 1TTPA 2WNZA 1QNVA 3SGUA 1IXOA 1KM5A 3TDFA 1OK4A 4ZQRA 4TX9A 2A7NA 2CLOA 1FCUA 4TIMA 5CPOA 4GE8A 2WQPA 2TMDA 2HMCA 2CWNA 3QF0A 1GOXA 1F2JA 2JKEA 1FQ0A 1GYNA 1LBLA 1JCYA 1I2RA 4IMFA 4LW7A 4I7UA 4UFIA 5D38A 1TPDA 2C1HA 1GVSA 2R8WA 3LXAA 3M5YA 3WJSA 4LOCA 2EAWA 3A24A 5I3IA 4LUJA 4K37A 4NUWA 2WJZA 3HPZA 1ZHAA 4JTKA 5F1VA 3HQ1A 3NM1A 3TKFA 2C19A 3OHIA 1TV5A 2KZHA 1KV5A 3P5ZA 1IGSA 1XBVA 2CZEA 4LS1A 3GXPA 3W72A 4UTKA 4LT9A 3N19B 2R94A 2DJXA 5D02A 3R5EA 1KFEA 1Z48A 1VLWA 4E2DA 2GQ9A 4MJMA 5EYWA 2LLEA 1ME8A 2PRMA 1S3HA 1GWJA 1R2RA 1O95A 1TTQA 1YDOA 3N73A 1EP1A 1AW1A 2ABAA 2I14A 4HT3A 1A5AA 1H7OA 2RDTA 5TQLA 3N14A 1CI1A 3IGSA 4FNUA 4NXSA 5I3GA 2QJGA 2RFGA 3W84A 1EP3A 3ZR4A 5LZLA 1PVNA 3W7JA 2ZZ3A 5DLCA 3TSMA 5D04C 4IOTA 3GIYA 1DORA 5BMXA 2WSRA 1OFQA 1SW0A 1ZAIA 5LHEA 2CLMA 4YXGA 3IVUA 1LOQA 1H7PA 1JVNA 1I45A 4N6EA 1QPRA 3R12A 1GVRA 4GRSA 3L21A 2E5CA 4Y6GA 3L65A 3W7IA 4GUIA 1QOQA 3G3MA 1A5CA 5E1QA 1K7XA 4HSOA 1J2WA 5LGZA 1VJIA 5CPLA 3TQ0A 1G67A 4IXXA 5D30A 3S5NA 1T99A 5AHNA 3V75A 1X7FA 2E1DA 3C2VA 2ZA1A 1TRDA 4C1KA 3DH7A 2CZDA 1WA3A 3MYPA 1EWEA 4XUGA 1JJKA 3L0GA 1AL7A 3M5ZA 4KFPA 4LVAA 1BWKA 1H1ZA 1K8YA 5DBTA 1TPUA 4HKPA 1K7FA 1WDWA 1V7YA 4XWUA 3R89A
chains in the Genus database with same CATH superfamily
1DJYA 3N2CA 4L6OA 5DMNA 3QV8A 1S3TC 2B31A 3M0MA 2JBMA 2AL2B 3BLDA 2XDFA 3W1QA 1M7PA 1US0A 3WH6A 2D0FA 3MCMA 2Q3RA 1IF2A 3E0FA 2JGQA 3AICA 3LCLA 4ZODA 4BEUA 2ZCGA 4DWSB 4PN2A 3CNYA 2PTXA 2GUYA 1UOZA 4AEFA 1PWLA 3G71H 1YTEA 4EPKA 3OPSA 1KBJA 2WWDA 4LTSA 3CMEH 3NPVA 3EWCA 2P3ZA 4HOZA 3GNDA 3M4HA 1W9VA 2DT2A 2ZUMA 1KXTA 2A1YA 1EP2A 1QWKA 3CC4H 3HJZA 3H4WA 4U5IA 1OIFA 2WNNA 3CZJA 5GJMA 1VD6A 2E40A 1O94A 5C0QA 3SUVA 4K7YA 3NS1C 1WZLA 3MSRA 5C9UA 4KWVA 2ACSA 4L6HA 3P5YA 4XD3A 4JNMA 4GKTA 5DEZA 1HVXA 1HJQA 3OVRA 4I90A 1C93A 4IT1A 3O6CA 4EIVA 4FAMA 3P7YA 4QJ5B 1KFJA 3NL3A 1XDLA 1T6MA 3TCSA 4FS9A 3INPA 1YBQB 3QPEA 2DIJA 5EY5A 4JX6A 1UQZA 4CCCA 3NM3A 5L6UA 1XV8A 2NXGA 2FFCA 4HOWA 3NL5A 3AMDA 4ADUA 3L2MA 1JZ8A 3WD4A 4JNZA 3CHFA 3NEVA 4LUTB 5XINA 4H9MA 1F74A 5IOBA 1JDEA 1W1B1 3OYXA 3WIJA 1GVIA 3QY6A 5AB3A 1E40A 2F6XA 1V97A 1PEZA 1W9PA 4QLKA 1VBJA 2GJRA 4Y8EA 4UCFA 5G1YA 4A05A 4C80A 4UMAA 2VWTA 3R1ZA 1DQXA 3FA3A 1O66A 3RK8A 4N02A 4IUOA 2WKJA 3R0UA 4G7EA 1PDYA 1VPQA 3JU2A 3WF4A 1SSGA 3NVTA 4AZGA 3B0UX 3KCJA 2F2HA 2PTZA 2E7FA 1MXGA 3TQVA 4AD0A 1EB3A 3D3AA 3EPMA 2W3SB 2OOGA 4G5DA 5BXPA 1IIHA 2OTDA 1G0CA 1BLIA 2CBIA 4ECLA 2VEFA 2PZ0A 3L4UA 5HNRA 1XLAA 3VOGA 4Q4QA 4MG4A 3I4KA 1I2OA 5ABHA 4ZQOA 4MDOA 1QK2A 3S5YA 3AIQA 1C8VA 3WBEA 1HO1A 1NWSA 1QPKA 5AC4A 3CUIA 3OBAA 3CUZA 4HMEA 3CIXA 4C6JA 1ECEA 1R9YA 4TX6A 3I7QA 3W1RA 2DSWA 3HJEA 4WX2A 4CVWA 3SQSA 4QBXA 3SR7A 3RM4A 3OP2A 2Y4SA 4OVXA 2XSAA 4MWAB 3GTIA 3UW6A 3TW9A 2YCLB 4NZ3A 1XHGA 1HJUA 1TE6A 1EUNA 3RF9A 1L8NA 3TXVA 2HK0A 2FDMA 2VFHA 4DJFC 4NF7A 3FN9A 2WJEA 1JUEA 1XF0A 3DGRA 1ADOA 3OVGA 1BGGA 2DZAA 3MKVA 5AC7A 1D3CA 3P8JA 4RL3A 1X8FA 1V6WA 5HNUA 4G9PA 4IO9J 4C7DA 2V63A 1W31A 3GFYA 2BG5A 3UYCA 3UR5A 3OG2A 3L23A 4GO9A 1FHLA 2Q6ZA 2WCSA 4E2OA 3QC0A 3CC2H 1OFRA 1YDYA 1V0KA 4RX0A 2I7GA 4AX6A 4YLWA 2YA1A 3A3HA 3L4PA 1C92A 1UC4A 4F8XA 2RDWA 4WK9A 3G1DA 3MUAA 4DNMA 2X0YA 3ELFA 3QMTA 4CNOA 2ZRYA 4DO5A 4MDPA 3FSTA 2VFDA 4K7VA 3M9YA 3COTA 4J27A 4W9TA 4DLMA 1ZCCA 2P5NA 3H2OA 3MY9A 1A5UA 2XN1A 4HNOA 5LNRA 2CITA 3LCFA 1PTAA 4PYSA 2X05A 1CXHA 2DUXA 5GAEN 1UP0A 4IMGA 1W1YA 1I9CB 3PFRA 4UFJA 3TJ4A 1TWWA 2WB5A 1RBAA 1TV3A 3RRXA 1YHQH 2DUAA 1VFMA 4MJZA 3DKLA 1E56A 5IDZA 4NNCA 4HMDA 4AHPA 1E43A 2J9XA 1UASA 1VBRA 3VOIA 2W92A 1C3FA 4LSBA 1DJHA 2VUYA 2PCEA 5FA5A 3GW0A 3LUTA 3C2EA 3ABZA 4DELA 2AGKA 2VMFA 2XZ9A 3WK1A 1L0PA 4F0SA 1US2A 1R3RA 2BGSA 3HPFA 1CLVA 3ID7A 1VENA 1LRQA 2VENA 1W2BH 2VDHA 3KCLA 4GYJA 3TTYA 2QHAA 1KM4A 3TYEA 1Q4WA 4TTUA 3NZQA 2UZ9A 7ODCA 5G2IA 2RDXA 2PCQA 3C0LA 1ONEA 3GBEA 1DXIA 4FLQA 1OFAA 1OX4A 2WLYA 4GQ0A 3TLLA 1G6CA 5DM6J 4JFTA 1R9XA 3FAXA 3QW4B 4UQ9A 2PMQA 4YS1A 5L9FA 1NDYA 3WFAA 4RE4A 4GVIA 4UTWA 5CQ1A 3IJ6A 1OVDA 1F8IA 1WUEA 3ENLA 5CZKA 1YJWH 4GG9A 3THUA 2PI6A 2ZUVA 4ZXLA 2GFTA 1FHUA 4UFKA 1OX5A 4RE0A 1I8JA 1QVGH 4Q8PA 3L2IA 4DB7A 3RN6A 4CNNA 1O5XA 4US5A 2GJPA 4CKQA 4CQ9A 3TIMA 4QISA 5A69A 4WRHA 1Q7QA 4GO8A 3T8LA 3UPBA 2PGRA 3WD3A 3GD6A 4K1WA 3U8GA 1N2VA 1P0BA 2VOMA 5D2YA 2XGBA 5AHFA 4U2ZA 4UOQA 3WLSA 4CU6A 2O56A 4AC7C 4Y7EA 4H01A 4AD1A 3U48A 2HE8A 2ZX6A 4FR1A 4XB3A 1GONA 4JDBA 1QI5A 5K9DA 1S5WA 3JZEA 3NQCA 4GQBA 4BFAA 3FHQA 1MVYA 2XIQA 4E8DA 2CZ5A 3T55A 1WOAA 3CAVA 1DIOA 5BOOA 4YWSA 3VKDA 2D22A 3CL7A 3VIOA 1E3ZA 2VR4A 2G41A 5D9NA 1K9TA 4C6FA 5EMJA 3ATZA 3W2LA 1N55A 4PRTA 3TROA 3O16A 4HU8A 2GVEA 4PUDA 1XICA 2ZJQJ 5A6TC 2WPGA 3IK4A 2YX0A 2Z26A 3SGGA 4W7UA 3VC5A 4OBRA 2A3HA 3E2RA 3G3DA 1YMYA 4C6EA 4DO4A 1QTWA 2Y8KA 2WANA 2IKHA 1F6PA 5HWNA 5FJRA 2PWGA 2YCKX 1MNZA 1IEIA 3DFPA 4DBEA 3W2KA 3H22A 3MBFA 3A12A 1XIJA 2HS8A 1ADDA 5BW6A 4OFCA 1XG3A 4AD2A 4GXPA 1TQJA 3TW7A 8XIAA 4QLJA 1BF2A 2EXOA 2ATSA 4NP7A 2CIPA 4B91A 3JR2A 4FLSA 4MB3A 5I7GA 1GKRA 3AS3A 5IBXA 1LYXA 3G18A 3S6TA 1A5OC 1E15A 1ADSA 3T8QA 4E3TA 3CCJH 4AAJA 4RZ6A 1XD1A 4IISA 3O2LA 1LG2A 5I79A 1UIPA 1GOMA 1SJAA 1SQ7A 4FXFA 4JFSA 4LAKA 5D9PA 3EB4A 1PWMA 2ZBTA 4GA5A 2C7FA 2RAGA 2X1UA 4XD5A 3ZJ8A 4FZIA 5CGQA 5I3FA 3PC0A 4E38A 4Z1YA 3NJ3A 2QXWA 2NUWA 3ITVA 1FWAC 4J28A 3C2OA 1VCGA 3PBVA 4MKVA 2QCMA 3BURA 1KQZA 3G1FA 2WM0A 1TWDA 1ZS2A 1B4EA 1PZ0A 1XGZA 2Y2WA 2ZRXA 3DX5A 2DZTA 1NQ6A 4OBTA 1UKOA 1J5SA 2GJXB 3W1LA 3UU0A 3FS2A 3BANA 1VLBA 3DFQA 2E9LA 2CPUA 1TRIA 2D2OA 4PL2A 3VIHA 1MUMA 1IEWA 1OK6A 3NL6A 2QMJA 2X2YA 1QCWA 3WYZA 4U67J 1V3LA 4D1JA 2WZHA 1REQA 1BEUA 3IK2A 2GDQA 5F7UA 2X2GA 1VHCA 4O12A 1B3XA 4ORMA 2O7SA 1T41A 1UQYA 3BGGA 4DBDA 1AK5A 2A5HA 3SUWA 3R2GA 5EU9A 2WMKA 3LGDA 1KBIA 4NJIA 4QQUA 3RLUA 4JY9A 1UP3A 2WP4A 3GX9A 4CQBA 3CS2A 1G01A 4WKFA 1P0KA 3F4DA 2WW5A 4DRSA 2Z1BA 4K8EA 3VGBA 1TMHA 2YBVA 2FPYA 2W5FA 4JIHA 1KFCA 3FAHA 1GHRA 4B3ZA 1N8IA 3GR7A 3L4VA 2BY0A 2O9RA 2XWDA 2Z1KA 3UJEA 2CZFA 3O05A 3SSZA 3LCXA 4FOUA 3IIPA 3GQYA 3WNNA 1MO0A 1HIZA 1IZJA 1R3TA 3MMUA 1Z7AA 4NY2A 2QW5A 4DVOA 3QR3A 3R8RA 4Z1CA 3R7MA 1A5KC 4MPQA 2E6AA 3NDOA 1FWJC 3MHGA 1BG4A 4GI8A 4LC8A 4HNUA 3PZIA 2IKGA 2DVUA 3UESA 3UF9A 3CZKA 1PKNA 2C16A 4H41A 1UWRA 1HL8A 4JQ3A 4E4PA 2BS9A 1B0IA 4TO8A 2GGHA 4ZOEA 5EBAA 4FI4A 3EWBX 1SB3A 1VQKH 1V0MA 2DIKA 2DSZA 1RVGA 2Y1HA 1AMYA 2VXNA 1TV7A 3SN0A 2H9AA 3QPYA 1XRTA 2YXGA 5B7YA 1CGXA 1GVOA 2XHYA 3QC3A 3BK0A 4ICCX 3S9ZA 2V5LA 4H9ZA 1FKWA 4MTVA 2FGLA 4AZCB 2QDDA 1SIJA 2J6XA 1LT7A 3EA1A 1XM3A 3B9OA 4P7RA 1V3JA 1WBJA 2QEXH 5KMYA 1XBXA 3A6OA 3TH6A 3FY1A 4PUUA 2A3CA 2HNEA 5CBJA 3CXCH 3EWWA 4N42A 1V77A 4XBSA 1GZ1A 1FIQC 3VIMA 1GTHA 1EJWC 4YTUA 2ZZ7A 3DZ1A 1QI4A 4U33A 3C3UA 4OV9A 3NOEA 4LNYA 2PDFA 2NLIA 4D6IA 1VFSA 1N61B 1SMDA 1B57A 1JYXA 8XIMA 3MJMA 3ITOA 1TA3A 3POCA 2GQ3A 3LCWA 3PUEA 1L6YA 3ONBA 5HUPA 1UWQA 4OUEA 3VNIA 3LCHA 3VCNA 1XYZA 1OSEA 2F8QA 4GFSA 2TODA 3NQVA 3BJTA 3WUGA 1FCBA 4LV9A 4D71A 2ZZ2A 1UIOA 1FWTA 4FLOA 1EJXC 2I9UA 1B4KA 3TP4A 1Y5WA 2VX6A 1ZCOA 3N15A 4NI3A 1TVNA 2WMIB 4UFLA 1V5XA 2H8XA 1N60B 3T08A 1MUCA 4LVBA 4R34A 3G1VA 2BX7A 2E5DA 3BW2A 1FO4A 2EG6A 4Y9NA 1VR6A 4KH2A 4URIA 3UJSA 4QQ3A 1YTKA 1OT1A 3UGRA 3DKJA 2A3AA 4ZFCA 1PIIA 2BY1A 3AHVA 3C52A 2E0PA 3TSBA 2RKXA 5M3WA 1MQQA 3MWAA 3AM9A 4XR5A 4H7VA 4KWSA 5DELA 2ZUTA 3OQEA 3I10A 3MCNA 3KX6A 1ESWA 3N6JA 1HKIA 9CGTA 3ITTA 4GJIA 2WMGA 1IIGA 3ZVHB 1LOSA 2PDMA 3WFZA 3M0ZA 1WZKA 3WQEA 3QN3A 1OD8A 1QI0A 3GVWA 3EGJA 4GBUA 1TV4A 1XH0A 3AHYA 3W22A 3WL1A 3LPPA 4LBSA 5KZ6A 5I09A 5G1MA 1XPGA 1QOPA 2QCGA 2R1LA 4S2CA 1OFBA 2Z2BA 2G3IA 1GOQA 1UZ1A 1KM1A 2W66A 3LXBA 2FJKA 3N2OA 1F76A 3CXOA 4CQCA 1V0NA 3SI9A 4U4MA 2VZTA 2ZUSA 4NRRA 4JTUA 4UTFA 1NDWA 3ARTA 2HXTA 3L9CA 5FIPA 4GVFA 1GQNA 1Y0EA 4Y96A 4UTMA 1UZHA 2FPVA 3YPIA 2V5CA 3MSGA 1GPWA 2ACUA 1JCJA 5MKGB 3T09A 5I23A 2X8RA 1MW0A 5IM51 2PRHA 5FEPA 5HQEA 1VFUA 4RZ4A 3VXGA 5F4SA 3UETA 3TN5A 1KCKA 4FLRA 1O60A 2AMXA 4JTEA 3UJFA 4M5PA 2QULA 3ITLA 1P0DA 2XTKA 2FH8A 5U7SA 1I2PA 3SIMA 3U2CA 3FGCB 4GBDA 4HHMA 1VQTA 5ABFA 4NZ1A 4PULA 3Q58A 2E6DA 2D2JA 3M0HA 1XCXA 3W4RA 5D2VA 4LCQA 1Q7ZA 1X6LA 1XCWA 1DL3A 2QR6A 3LTYA 4GI6A 4IF2A 3PPCA 3TTQA 3CJPA 4ZR8A 5D8ZA 2X7VA 4Q8VA 2F84A 4NG3A 4F0LA 2HWGA 3C56A 3GG0A 3HGRA 3P0WA 1OYCA 3LB0A 2X7WA 4JHMA 2PWVA 1TVPA 1TYGA 1OB0A 3I4EA 4GA8A 3SCNA 1FVPA 3NXFA 1HJXA 3STFA 3TMLA 2Z6IA 1W3TA 1Q6FA 3K8KA 5I00A 2EQDA 3N04A 4YTSA 1S2TA 1SU5A 5HMSA 4A4AA 4AF0B 4Q8TA 2B7OA 4UQDA 3GNXA 2J7FA 1GYLA 2PLMA 3P74A 2DZPA 5AKQA 3PB2A 3KTCA 2OSYA 3VZZA 2OZ0A 3QH2A 1NAL1 1VZWA 3MTWA 2IXUA 2RHGA 2YOCA 5CC5A 1FP8A 3FX4A 1JGIA 2WK6A 5CXPA 3BAYA 3B8VA 4RV3A 3T05A 3SCTA 2ZRUA 4U2YA 4RKAA 3BMVA 3GH7A 4KFOA 1OBAA 1H50A 4O28A 5CZ0A 1J96A 3CH9A 1NTHA 2BZNA 2QS8A 1VJSA 6REQA 3N3TA 3CQIA 3QW3A 2PU0A 1J12A 5K2ZA 1Q6QA 4I5XA 4NAFB 4EKJA 1VYSX 3ZLHA 1SUXA 2NWSA 3EMZA 3FNDA 4XBKA 4CN4A 2R1MA 4HZ6A 2RDUA 3W76A 4HU3A 3VOJA 3B8UA 4N0RA 3OZMA 5F4XA 3MHUA 3CTTA 2OX4A 3WQ6A 1E73M 4HCDA 1HX0A 3O63A 3U5UA 1RSCA 2PWEA 2F2KA 5KZEA 4CQ8A 1XIDA 1ICQA 1WXYA 2WMFA 4MJ2A 4OZOA 2DW7A 3P67A 3S3GA 3MBDA 2OB3A 1W5OA 4O1EA 3W1PA 3DOPA 3VNLA 5FSDC 5HMFA 3OJGA 3PK7A 3W71A 2YBTA 1WDDA 3PZVA 2PP3A 1QI3A 1KD0A 3ZLFA 1FRBA 4JX5A 4NNBA 2DZUA 1QRQA 3E3HA 1X97A 3OU8A 2D3NA 1KCXA 1EF3A 2CZVA 1HL9A 5HNTA 1XS2A 3PUOA 3WH9A 2P3EA 4FOJA 4H6KA 3W1TA 4UZUA 3RJXA 4PCFA 4X63A 1KLYA 1Q7MA 4JYFA 3FJ4A 2FTWA 3T6CA 1EX1A 3BQ6A 2WK5A 3AU2A 4NT0A 2QF8A 4DX3A 2Z1XA 4QDMA 2WLZA 1OYBA 1VF8A 1F05A 1YADA 1GQLA 4GYPA 2NZLA 3R11A 4NYYA 3OIXA 2V69A 3QBUA 1W5NA 4P8WA 4YN5A 4C7FA 3CPGA 4QR6A 1S5TA 3UQNA 1F3WA 1SR9A 2EEXA 3ITGA 4MZ8A 1WYGA 3VNYA 4MADA 1RY8A 5LIYX 5B7ZA 1C8XA 1I1WA 3L4TA 1RH9A 2YXXA 3UZZA 3LM3A 3ARXA 2WJDA 1E5JA 4FIRA 3KEHA 4X60A 2IKJA 5C6MA 3WQ8A 1W3KA 5AHIA 3GZAA 5G1TA 5FOOA 4AH7A 5TF0A 1WE5A 3W85A 3TUUA 4C1NA 4PMYA 1HGWA 4EXQA 1MXSA 2ONEA 5F2IA 4R5EA 3GXMA 1F7BA 3BG3A 1I60A 4GUHA 2EPLX 1LBMA 3WQVA 2QUTA 5DXYA 4FSAA 3QV9A 1ZZMA 4M19A 1C7SA 4B16A 4BQ5A 3UWQA 1W3LA 4AY8A 3D5HA 3ABQA 4O14A 4UTWC 5BWAA 4HA0A 1S72H 1VBGA 4MYAA 3SY5A 3ZOAA 3NSMA 1WOBA 3TN3A 5C2CA 2PD5A 3MCOA 3TYBA 2VRQA 4RK8A 3THQA 3LA4A 3SY8A 1HL2A 1JXKA 1SFLA 2WVTA 3OVPA 3WQFA 2I9EA 4JHZA 1HO4A 1MUWA 1ME7A 3ES8A 1E6RA 2QUNA 4C60A 4J4KA 1TR9A 3OZYA 4JTHA 4GA4A 5HANA 4PMXA 1BKSA 3EB2A 3NQFA 1AODA 1WQ5A 4O1FA 5AHLA 3WNPA 4QFUA 3N3MA 3HMJG 3BGAA 1JCNA 1BVZA 2ISFA 3TJLA 3U7BA 4PB4A 3W7CA 2ZX8A 4I7WA 4X46A 1F07A 1KM0A 2PDYA 2CC0A 4DZ5A 4HU0A 3K1DA 5JVHJ 4HA3A 1SMAA 3GXFA 3TZNA 1QNQA 1C90A 3AJ7A 3R13A 1SZGA 5E0KA 3DC0A 3TA6A 3WX7A 3H2CA 3P80A 4Z1BA 5E9XA 2ICSA 2HE5A 4MHBA 5U4NA 2UY2A 3T4WA 1CLKA 3U9IA 4WY0A 1SO6A 2UY4A 1OZQA 2VVSA 1M5WA 5HBFA 3BG9A 3KM8A 3NFUA 4FOKA 4CD7A 1XIFA 1FMAE 4PEEA 4IX2A 4CD6A 3NNTA 4H9UA 2NXHA 4B4FA 4DZIA 3HU7A 1I0BA 1Q45A 2ISVA 5D05A 4JN8A 1A5SA 3SCRA 1XXXA 3SO7A 1EL3A 3FYPA 5AYIA 2O4QA 3RLVA 3PZMA 3W2UA 4HZ8A 1BYAA 1EXBA 4A6GA 3OHMB 3C8NA 5HQMA 4WSKA 3EKGA 1OJXA 4USAA 2ZRWA 3SJNA 4JTRA 5BRQA 4L1GA 2XJ7A 1UPMB 3TTOA 1E6ZA 3NO1A 2VO5A 5IBXC 1FWBC 4HIBA 3LU2A 3TVAA 4S3EA 3AXMA 4UOJA 1UH2A 1NWRA 3OVQA 3W00A 1R8LA 4QX4A 4D8LA 4EXAA 4KWOA 4GI9A 1L6GA 1XIEA 1QMLA 4UQAA 2OZTA 4PSPA 5K4ZA 3EAUA 1M3UA 1XR2A 2C13A 1TELA 3NQ6A 4YTTA 3PZQA 4FNTA 1K73J 3APGA 3WF1A 3G77A 3RGTA 4CD5A 4UMCA 2Z4GA 4H7CA 3W75A 1F4AA 3WJWA 3BDKA 5AZ0A 1FWIC 3QFEA 1UR3M 3XIMA 2YDSA 3AXKA 2BXZA 4AZ6A 3WL0A 4ZQRA 4TX9A 3WQCA 5CPOA 2WQPA 3OZOA 5DT5A 2W55B 1QW7A 1GOXA 1F2JA 4PUNA 3MVTA 4IMFA 1GOIA 4UFIA 5CLWA 1KWKA 4RZBA 3VNKA 4GHRA 1RLCL 2PDUA 4QDPA 2WWCA 1ONXA 4LUJA 1BHGA 2X40A 4NUWA 1P48A 3OOQA 4PZVA 3FJNA 3THDA 1NWUA 4C91A 4P7OA 1P1MA 4HNLA 2GDUA 2X0SA 3GXPA 3O0FA 1XRFA 4I9MA 4J1OA 4S3AA 3GG1A 2R94A 2F6UA 3OLEA 3UT0A 1S5NA 2WMHA 1UBPC 3PAOA 3EPNA 3FYYA 1S3HA 2W67A 1XRVA 1TTQA 3WKZA 3DG7A 1AW1A 1UJQA 2ABAA 2JIWA 2YL5A 2R1PA 1K4GA 2Y5EA 4D6DA 3EPOA 2VUNA 4QG6A 3VFCA 5I3GA 4B4HA 1XYAA 1NY1A 2J4GA 5CSUA 1AVAA 4NKCA 4LB3A 4JEJA 1H3GA 1PVNA 3W7JA 2OYLA 5DLCA 5C9WA 1KKOA 3CV7A 3F5JA 3R8GA 1SW0A 1ZAIA 1NU5A 1GVRA 4Y6GA 4JKKA 3QOKA 3G3MA 1JDCA 3DDMA 2PWHA 5CC6A 5LGZA 1VJIA 3E5BA 4IXXA 5D30A 1G5AA 1CECA 5A6LA 1X7FA 4DJEA 1LQ0A 4C1KA 2PPGA 3WLLA 4GYFA 2CZDA 4IP5A 4XUGA 1K70A 3L0GA 1DIEA 1R85A 3VKAA 4LH8A 1VQMH 5LA1A 2OTJH 1H1ZA 4J35A 5BROA 5DBTA 3NTYA 1K7FA 1ODZA 4TVDA 3CUXA 3R89A 4F66A 1TUFA 2ALDA 1D7KA 1EGVA 3HPAA 3VNZA 4DUWA 4I8DA 2C1GA 4M56A 3C61A 5AHEA 1DWAM 1JYWA 1RR2A 1W9XA 3LTPA 5D8WA 3VIKA 4B5UA 2ISWA 3B9EA 3HO8A 4IMEA 1AMKA 2VOTA 1J6OA 1VQ7H 4S3CA 1GEQA 3IV3A 1XH1A 5H6HA 1BXNA 4KFNA 4OBSA 1DPMA 3CTLA 2FZMA 3FJLA 3G0UA 2WZIA 1OGBA 4FEZA 3ERPA 1XSJA 4DUVA 3AMGA 3AXIA 4PUKA 3KP1A 3KP0A 4AZHA 5D03A 4GZIA 3A5VA 1BTCA 3WH5A 3P3BA 2NVAA 3Q37A 4Q22A 4AC1X 2R1KA 4X22A 1ZPTA 3S47A 5BOEA 4NRSA 1EO5A 3L5MA 4ML4A 1XYMA 4ILSA 1SO5A 2KAUC 4CCDA 5EKYA 3T0TA 4IX0A 2DQWA 4YTRA 2O4MA 4EAYA 2AMGA 4LV4A 1UKSA 4PCTA 4S1FA 3RX3A 1KRAC 5I03A 3NL2A 2WCGA 1U5HA 1CB2A 4GC4A 4CCZA 1FCQA 4EP8C 2CBJA 2ZA2A 3UR8A 4GABA 3S9IA 3HIJA 3THCA 4HD5A 4IL2A 1YJNH 5FACA 3CWHA 3RX4A 4JL2A 1ZB5A 2REQA 3E0IA 4WY0F 1JPHA 4NJJA 2QCHA 4GVGA 1KBKA 5FJOA 4CN6A 4JTTA 1XC4A 2VFIA 3H4XA 4YTQA 3PSWA 1TSIA 3GHRA 5J04A 5E9AA 4DWSA 4H1ZA 2VZVA 3MUZ1 5DY2A 3BAWA 1W91A 3IWPA 1BVWA 3VIFA 4TMBA 1TB3A 1B31A 3WLHA 4AZ5A 4C6CA 3VDBA 3FHAA 2MANA 1HFBA 1W56A 5IHRA 3QFWA 4LYQA 3EX1A 4MNJA 1JI1A 2AOSA 1S2CA 4H6QA 3M6DA 1K1DA 4AXNA 4J3UA 2X16A 2C14A 3K5XA 3PJUA 4GIEA 2NX3A 3DBNA 4M24A 5CBIA 1YPXA 3H8AA 3VGDA 1FDYA 3CAQA 4XO6A 5AN7A 1YDNA 3MUXA 3G1HA 3CC1A 3RO6A 3CPWH 1W5PA 3MHFA 3ARQA 1UWSA 3CUJA 2DFAA 3TFCA 3TE9A 4PMZA 5FJTA 4QJ3B 3Q4DA 2VZSA 3QR0A 4RW5A 4UB9A 3HG4A 4LNCA 4ERAA 1NOUA 3KWXA 3OGRA 5E09A 5A8QA 2FGZA 3UWZA 1H61A 3QEZA 3SJ3A 3NSNA 2B7PA 5FSEC 8TIMA 2HS6A 3BZGA 1M1BA 4W5UA 4PTDA 2HRWA 2OX1A 4LUTA 1LLWA 2PS2A 1SO3A 5REQB 2OQYA 4LCRA 3S0CA 4KW2A 5PTDA 2OKOA 4H6EA 3B97A 2ZJPJ 3B0VC 2J79A 1AH4A 3MMDA 1OFDA 1AH3A 5AOUA 3K2GA 4IGHA 1W1PA 2W0UA 3A13A 4W87A 4KEZA 1LQAA 4HPHA 4HA4A 4O0KA 3NZ1A 2ZKMX 5FL0A 1LRTA 4ICNA 4CQAA 3LDVA 4TUFA 3NPUA 2ZZ5A 3BSHA 3ANUA 1KCZA 4HNCA 5CPNA 3BW3A 4A3HA 1OC5A 2FPTA 3RM8A 3HGJA 4AD5A 1M65A 1ME9A 1BRLA 4UMBA 3BC9A 3C0JA 3WLMA 4H9VA 2CHNA 2YL6A 4BKNA 3GAYA 1J0ZA 3EOSA 1HJSA 2ZUNA 2CLHA 1V4YA 1V3HA 4WSJA 5FEXA 1WNOA 3H2FA 4Q4RA 1HF6A 1RD6A 1EA9C 1B3OA 2Y88A 1W32A 4E3VA 3WBXA 2ZADA 4PTVA 1FDJA 4BS0A 3L68A 1UKPA 2DJLA 3FVMA 4MZYA 1NFPA 4LXFA 3O3RA 2YCLA 2BOFX 4D6CA 2QCLA 4JFVA 2I5GA 4MOZA 1OG0A 4L9ZA 2OO6A 3OODA 2TAAA 3GSMA 3UR2A 2FVKA 5D2TA 1QHOA 3EDJA 4MZ1A 4WCJA 3PIPJ 3OO2A 2V2CA 2WVVB 2G95A 2J8FA 3P6LA 3NAVA 2IW0A 1JAEA 1V51A 1ZQ5A 1FM0E 4OT7A 3EDKA 4Q7NA 3WDPP 1G7VA 3V4BA 4FF7A 1FCVA 5CJ5A 3GLCA 5CPMA 5CPQA 1E55A 1J0IA 3EDDA 2A3EA 4ZO8A 3G1SA 3QVQA 4HJFA 5J5DA 2VM8A 3BQ5A 1ZNNA 4O57A 1GJWA 2I16A 1Q6LA 2FLIA 2VI0A 4AP8A 3M0IA 1G4EA 1WKIA 1GJPA 3WF0A 2QCEA 5TNVA 5C9RA 2G4FA 3CCSH 2YFOA 3DC8A 1W1IE 2OVLA 2VCAA 1CXFA 1FWWA 3UCDA 4REQB 1SW3A 3IARA 3W7OA 2QT3A 5C9ZA 4GLEA 2D73A 3ARVA 4L4OA 2A3BA 3IAQA 4QSFA 4F79A 4N2YA 3UZXA 3PTQA 3ITYA 1D7FA 2QV5A 1JDDA 4A35A 1VRDA 4E2VA 4AWTA 1DGJA 2XFWA 3WMCA 3BICA 2EBNA 1SJCA 1TUXA 2Y8VA 3CIWA 1KD1J 4LBRA 4QNWA 5I24A 1CGUA 2YLAA 3LLDA 4X61A 2J0FA 3UXIA 3BLOA 4Z0JA 4GYPC 5JIPA 3KOZA 4LVGA 1NVIE 3W70A 4M8UA 4Y9PA 1LWJA 4WVXA 3AHTA 3N34A 4M0XA 4Z2KA 5CSRA 1XLDA 3WNOA 4UTIA 3CMAH 4K8HA 2ZXDA 2E28A 2PC8A 4FNPA 1H0GA 4P5UA 3TTEA 4PFMA 3H2AA 4GUFA 1MRAA 3LLFA 3U7VA 4WHBA 2CLFA 4US5D 4UZSA 2WZEA 4HJWA 3EA3A 4K2SA 2VEPA 4PCNA 3DN5A 3LD5A 4QE5A 4Z2GA 3AXHA 3O6YX 5C54A 1ZFJA 1OX6A 2PSNA 5G4WA 2JKPA 4ZQCA 3PBWA 1KM6A 1OZMA 4MB1A 1QHZA 3N2XA 3M0LA 3UNDA 1QNSA 2DU2A 3BOFA 2YL8A 5BXSA 5ECVA 3N2TA 2IQDA 1VEPA 1WAWA 4XZLX 4CU8A 4HHHA 1B9ZA 3VU2A 1TPVA 1KRCC 3KZSA 3EWDA 2XM1A 3PFMA 4Q8WA 2OSWA 3CHVA 1NOFA 1E9ZB 4A2RA 3AC0A 4JTGA 4UIOA 2ZYFA 1DWIM 2H90A 3FC4A 3LZ5A 3UBPC 4DBSA 2SFPA 1YJ9H 3WLIA 1JR1A 1RK5A 2J13A 2D24A 4NX0A 4RXGA 4L4MA 1CLXA 4S38A 3PB0A 3W7MA 4PUWA 2DT3A 4XZWA 2JKAA 3W3OA 2VTFA 1P1XA 3S1WA 1F61A 1FXPA 4L9XA 3ZJKA 2A3LA 3LGEA 5CCZA 5C71A 2HZGA 1WDPA 1OCQA 4HN8A 4KIRA 2CBVA 3DAQA 2HTMA 3BIIE 4S2BA 3WO0A 1VHNA 3C3NA 4H2CA 3LPGA 4BHYA 1XYBA 4YVVA 3T40A 3NVWC 1ZJBA 3T0BA 3WBAA 1XFCA 3UXAA 4PMUA 1UR4A 3B9AA 1RP8A 4JQAA 1A50A 3MYOA 2XZ7A 3EWUA 4BI5A 5I0DA 1Q13A 3F4VA 1AG1O 4UR8A 4PFHA 3KRBA 1E9YB 3PZGA 4J3TA 3DFSA 3RMJA 2X1TA 4AYGA 4EVZA 3GK0A 4PUJA 3FEQA 1XBZA 1NH6A 3BLLA 3W7PA 3TFXA 3W86A 4WFAJ 2IQTA 2GVJA 2VX4A 2XFRA 5CG7A 4OE7A 2QEZA 1UH3A 1PZ1A 3AYRA 3GYEA 3TNOA 3KVJA 4GNKB 3PUGA 1BXBA 1E4IA 3LYEA 4Q32A 3R8HA 4AWSA 1IWAA 4TMCA 3WO1A 4MAVA 1UD5A 3W7KA 3MW7A 3CO4A 3SQLA 5HJYA 4L80A 5HATA 1LORA 3L5AA 1S39A 2G96A 2D69A 3EXSA 4JXCA 1UWUA 3EB3A 4H8HA 3G0XA 2EPOA 1DJQA 1W9BM 2YZRA 4Z1AA 1VQNH 1QJWA 3EXRA 2JF6A 1S38A 4MNLA 4O52A 2V5DA 2GJXA 5C7HA 1W1TA 3JRKA 4V1YA 2BBFA 1XH2A 3RJYA 3UFYA 5A2CA 3UZWA 3WQOA 2D20A 4O8RA 3BCFA 4WJXA 4W89A 3L4ZA 1XI3A 2OWCA 3TC7A 1H5YA 4XSLA 1DE6A 3S2JA 5FJJA 4ZEPA 4FF5A 3T9PA 3TX9A 3DHPA 1GEHA 5CGMA 4QG9A 3UZJA 4X2PA 1E72M 2DZVA 3A64A 4IIFA 2POZA 4B5TA 4S39A 2OJPA 2GDVA 2XVGA 1UR1A 1ZJHA 4H00A 3EOUA 1W2PA 3ZWTA 1V6YA 3SUUA 1XLMA 3ZS4A 3RUBL 2INZA 2YCJA 4DZHA 5G2HA 2BNJA 1J8VA 1CZ1A 1OF6A 3QYSA 2VEIA 2J24A 1PHWA 3WENA 1TCDA 1Q3NA 3RG6A 4LUSA 3VINA 4IIGA 7XIMA 3NPWA 2BVWA 4UFMA 3M07A 4GY7A 4L5ZA 3I6TA 4XAZA 1A5LC 2QAFA 1UR9A 1H7XA 3W37A 4F40A 2DZXA 4D6JA 1P0NA 2A79A 1A0DA 3L0KA 4KS0A 3VI2A 3WK2A 5AYBA 1UD4A 4LHMA 1E6SM 3C2FA 4QAWA 4JX4A 1O1ZA 2PDCA 4MPKA 3O8AA 3N6HA 2VGGA 4TTGA 3SCSA 2IPFA 3GFXA 3IGXA 4XAYA 1XLGA 4O1AA 3HB9A 1EDQA 2O7QA 3G22A 5LKYA 4N9DA 5JVLA 3EX4A 1RQEA 5DCBA 3N9SA 3O7UA 3DI1A 3W2MA 3B4YA 3E0VA 3UPWA 3CAWA 3CV1A 4IG2B 2VL4A 4M6UA 3EKLA 4M29A 3F2DA 1QO5A 3ARWA 3UJ2A 4RDZA 4AG0A 3AMLA 3WJZA 5LXEA 2BXVA 7ENLA 4WDTA 4DJEC 5LXXA 1EBGA 4B2DD 3M7WA 4JPGA 1OC6A 2DDXA 4GUGA 2FDSA 4JTDA 1S1RA 3FA4A 4LYPA 4ZXOA 1L6FA 5BOFA 3CC7H 5F4WA 3HTWA 4JL1A 1DTNA 1XYLA 4Z08A 4A21A 3Q2DA 3B04A 5ABGA 1E5NA 4HTBA 4AZCA 1TIMA 3T2OA 2QDHA 4HPNA 3NYDA 5BXTA 3PJTA 4KIEA 3VIGA 4TX8A 4L56A 3HOJA 3U6WA 4ERGA 1VEOA 5EMKA 4YCPA 2Z27A 3H54A 3RNDA 2BGQA 1JXJA 1E4MM 1B5TA 4H7ZA 3LMZA 5HL7J 4IGNA 4U3CA 1EBHA 3K4DA 2ZQ0A 3S6DA 5DO8A 4OGZA 3BV4A 3IRDA 3NQ7A 3UD6A 3OW1A 1ZY9A 4YMZA 1GYMA 5DBUA 3GG8A 3OBEA 4RXFA 4G1NA 1S2UA 1A5BA 5DMLA 2PA6A 4TQTA 1JAKA 3LBOA 4MNKA 2NVCA 3VZYA 2P76A 1GHSA 5D2WA 4WZHA 4W93A 2CETA 2VQTA 4H4IA 4ZMGA 4HZMA 1UWTA 3PBMA 1LCOA 4H04A 3GH5A 4C7YA 4MNMA 2BFGA 1K9FA 3RCYA 1E4LA 3TC6A 2PRLA 5J5RA 3T2PA 2XVPA 3CCMH 4XVEA 2ZTKA 1PIFA 4E4FA 2BGNE 2WMIA 3JW7A 2CXEA 4MWAD 1VB9A 3HFTA 3ISIX 5DM7J 3EZ4A 3P62A 5A1AA 4AZIA 3NO3A 2GLKA 3SQMA 3MI2A 5FEWA 1R38A 4D1IA 3W88A 1L8PA 3POHA 2Q5WE 2W3ZA 2GGEA 3PIOJ 4LS0A 2VDGA 4P7NA 2BY2A 1TJPA 2O9OA 3C8FA 1E71M 3I3EA 1JPMA 3PWIA 3NPXA 4H9YA 1CGYA 3DHDA 1TO3A 3QZAA 5DCEA 1VQLH 1YQ2A 1PKMA 1JJ2H 1KKRA 4A8IA 3ZVHA 3VMPA 4ORIA 2XIOA 3WEOA 1EXPA 4IFOA 4N7QA 4R7OA 1B3VA 4O53A 3BAKA 4YCOA 4DWSC 4JNYA 2GGIA 3D3FA 2VFEA 3FXYA 3TAKA 1TPB1 2P8BA 4O19A 2WHKA 3LHTA 5RUBA 4MFDA 3BUVA 3MO7A 3NQ2A 2XGIA 3UNTA 1LLOA 1DV7A 1DJWA 3ABOA 4WF9J 3CMGA 1LWHA 1RAKA 1FWFC 2PWUA 3PF3A 2Y6ZA 2ZZ1A 3OGSA 3VCCA 5BU6A 2GGGA 4Q7IA 3IVTA 1JPKA 3WY1A 4Z2LA 2WM1A 3ZZ1A 5KINA 2C91A 3SCQA 3OGVA 1T8XA 2D23A 1QAPA 3F03K 3W1UA 4AQLA 4LQ1A 5MKGA 1W3HA 3TK7A 1FXQA 1H60A 3GS6A 3AN1A 4W84A 4PH6A 3REQA 2ZVRA 1OHLA 3V0SA 4DXKA 4OKDA 3AS2A 4WR3A 1XIMA 3ITCA 4ADSA 2V3EA 4ZVJA 3UJRA 4MLRA 1BYCA 2FH6A 2OEJA 2VC7A 5CZSA 7CGTA 2UY5A 3VAVA 4BQ4A 1JQVA 3FGCA 3T0AA 1GVEA 3I55H 3SB0A 4IICA 3TTSA 4DHGA 2CLEA 1TZZA 2PBOA 4ZO9A 3W73A 2XIBA 1E1CA 4AYSA 4PUMA 3DLLJ 1FX6A 2Q8LA 1YYAA 4JICA 4AEEA 2ZX5A 3HPXA 2EPNA 1I2QA 3NZPA 4CU7A 5D37A 3W26A 3RPMA 3CUFA 3NURA 3EXTA 1MW1A 2DY3A 4GYKA 1TG7A 3B06A 1PE1A 2ZUWA 1ZBVA 5BZAA 3ZJ6A 3CCRH 3W07A 3W6YA 1PTDA 1R6WA 2OODA 1EZ2A 4Z2JA 4AF0A 5C7VA 1CT5A 2QJNA 4OV4A 4MFEA 2GSEA 2PDQA 3RU6A 2BV9A 3CK5A 4E8CA 4ZZ9A 3ZSSA 1M7XA 1SZEA 3W1MA 4B5WA 3E1F1 3TQKA 3IJ7A 1C29A 3N9KA 4AD4A 4EACA 3PN8A 1K9MJ 1PB0A 1O12A 3VD4A 1H51A 1XL9A 2J9ZA 4WSHA 2CHRA 1VP5A 3FAWA 1SFSA 3A4WA 2FZ9A 5GVJA 4UOZA 1UOUA 2Z7KA 1JUKA 1LG1A 3F4WA 1VC4A 3FKRA 3PANA 5CSYA 4PMDA 1ISWA 1D9EA 2EPHA 4S3JA 5FJPA 2BTMA 4LWWA 4NAFA 2DVTA 3QLLA 1C9WA 3W24A 5AHMA 3AZTA 1UA7A 1TA3B 1EGZA 1BRWA 2PE4A 2NT0A 3DERA 1WPCA 2X41A 5T26A 4NSBA 3FDKA 2G3FA 1YHTA 1W9DM 4QE4A 1J18A 1CXKA 1ZXIB 4KCUA 3FA5A 1GQIA 3FVDA 3E02A 3TOPA 3U4FA 3EKZA 3EEZA 3CT2A 4CCEA 3H5QA 5IFPA 4GJ1A 1RJRA 3MJYA 2GWGA 3N25A 3UWVA 1E0UA 1Z89A 4GNJA 3VDAA 2VCCA 2FB2A 1XQLA 4KRUA 3O6AA 1Q86J 3IGUA 4FO4A 2E9MA 4DBWA 4ATWA 4FNQA 4R33A 3CT7A 3TV8A 2ESCA 2X1IA 1MWOA 1ZP3A 4ZB0A 4EF8A 3ARUA 3DESA 1M04A 5ECUA 3WF3A 5C8BB 1LF1A 4S3DA 2CFFA 4PEKA 4V33A 3OIHA 1VCVA 3ARZA 4B5XA 4I3GA 4ZQNA 1AL8A 5G2WA 1UHVA 2CLKA 3H21A 1Q5MA 4XX6A 3WLPA 1AA1B 2W62A 4XZNX 1K6AA 3G1AA 2ISDA 4B3LA 1RLDA 1Z44A 3VE9A 1UD2A 3RCMA 1R2TA 2ON3A 3MP5A 1GVFA 1E4NA 1JFXA 4B92A 2W79A 3EBVA 4ZB2A 3I6EA 3QQ0A 1DXFA 3E38A 3Q94A 3L4XA 4IP7A 3VKBA 4A8LA 3ORWA 1DXEA 3IAPA 2ANUA 4KCVA 2VEMA 1H2JA 3KL0A 2XSBA 1N7KA 2BHYA 2NV2A 2ODOA 1RPKA 4MB4A 3I7RA 1V3MA 4WDWA 3D0CA 1R47A 1XKJA 3WN6A 1OC7A 3JS3A 3OG3A 1KXVA 3FV9A 1EPVA 1NARA 1FH9A 3FYOA 3PUDA 5F1UA 1B3WA 4WXZA 3N13A 2TPTA 1T0OA 5LNSA 5DT7A 1S5MA 5CGTA 3HF3A 2XFFA 1HVQA 4PTNA 3A47A 3FIGA 3RAOA 4Q8QA 5A6JA 1TX2A 4WOQA 3KVKA 3AMKA 2IUZA 1KTBA 1A47A 4AHQA 5ABTA 1TVLA 3WQ5A 1FWNA 2ZA3A 2PDLA 3N4AA 1JZ5A 4UTLA 2Z29A 4IPIA 3KBSA 3VUSA 1EIBA 3MKCA 4C7GA 3VX1A 1VH7A 1GVQA 4G7FA 3UYIA 4HA1A 4YJ5A 3N2MA 1GNXA 1UD3A 3G8EA 1PJ9A 3VNJA 2Q8ZA 4IQJA 3BOLA 3VD7A 5ABFB 5K7JA 3VABA 1MW2A 2PLKA 1J93A 4I9AA 1EDGA 1U1UA 3BWWA 2HDJA 4CVUA 1EJTC 3VDCA 4AWUA 3WG6A 3SW6A 4L61A 4DJDD 1GZGA 3BSMA 3ZM8A 3ZR5A 5LIXX 4U3AA 4EX4A 3PBYA 2PURA 2V6AA 4XTIA 1NF7A 3HG5A 3LGGA 4XBJA 3PULA 1WP6A 2A2IA 4PRRA 5HR6A 3E49A 3QHNA 5D32A 1I6NA 4AVNA 2NQZA 3O0KA 1DQUA 2NV9A 5H2ZA 1JNEA 4GK8A 4Q4SA 1NJJA 1TTPA 1V03A 2CLPA 3SGUA 1KM5A 3TDFA 1G9HA 3VYLA 4GH1A 2TMDA 2HMCA 3QHOA 1DWHM 4LFYA 2JKEA 1FQ0A 1LBLA 2FFIA 3PZUA 1I2RA 4LW7A 4I7UA 5D38A 2IS7A 1S1PA 1GVSA 1FFUB 3RPFA 3LXAA 3PNUA 3WJSA 2FHFA 5CC3A 2EKGA 3A24A 1AJ2A 4AY1A 5I02A 4S3KA 3WMSA 1OADA 2Z1VA 1TV5A 4UR9A 3OA5A 3PZTA 6REQB 4A3RA 3II1A 2VQUA 3W72A 4UTKA 4LT9A 1J6PA 3WSUA 1HKMA 3N19B 2DJXA 5D02A 5FJUA 3R5EA 1KFEA 1Z48A 1PBGA 4LALA 3DHUA 4E2DA 2GQ9A 4DBUA 5EYWA 1SJDA 3BCJA 1K8CA 3R58A 1YIXA 1YITH 1EP1A 4HT3A 3BCDA 3WUBA 1XSKA 1H7OA 1MYRA 2W63A 2RDTA 3WO8A 3GC2A 1V6XA 1F9CA 1A0EA 1QNPA 5TQLA 3IGSA 4FNUA 1D8WA 2PA2A 1V02A 1EP3A 4PRWA 4J3VA 3TSMA 4IOTA 1F6YA 1DORA 4R27A 1DWFM 3VC6A 1VQ9H 2CLMA 1KFWA 3IVUA 4RPQA 4D72A 1VIZA 1UW9A 2CBUA 1QPRA 4NZCA 3OW2H 1G94A 9XIMA 1KRMA 4HMCA 1GCYA 3KZPA 4GUIA 1QOQA 4IIDA 5A6KA 1A5CA 4Y9OA 1SR0A 4HSOA 3MV11 3S83A 3W38A 1P7TA 1JYVA 3TQ0A 1G67A 1Q65A 5AHNA 3URQA 5CEWA 1BSIA 3C2VA 5BYWA 3DH7A 1BVNP 3VGHA 1JJKA 2BODX 4KFPA 1BFNA 1I0DA 1DJXA 1VFOA 3EDFA 4TOQA 4LYRA 3G4SH 1JL8A 1WDWA 1V7YA 4MSSA 4NL1A 5FCZA 1VDVA 1QW9A 3RITA 2CLLA 1Q6RA 3PBUA 1MSSA 2X1SA 1Q6EA 2HQAA 1XSIA 2CCRA 1F3XA 4FALA 1V02E 3EX6A 1X1NA 2VEKA 4F0RA 4NIRA 3HG2A 4C6LA 1VCFA 1FHVA 1Z42A 2PB1A 3L67A 3AUOA 4D6EA 4HP5A 3O07A 1ICPA 3PZNA 3UCQA 4F4RA 3KDNA 1DKWA 3M0XA 5LGXA 1XUUA 5I2UA 1A53A 1GKPA 2C18A 3HQOA 3CU2A 1WV2A 2FKPA 4ZA0A 1ZBWA 3DUGA 2J88A 3MV01 5M5DA 3PTKA 4K38A 4F9JA 4IQEA 4A3YA 2HJPA 2P53A 3RLGA 1XLFA 3VO0A 1ITQA 1R3YA 4P8VA 3F2CA 3GAKA 1EFZA 2EGZA 3THAA 3RX2A 1X6UA 3KRZA 2WMJA 3AJXA 1A5MC 4O15A 4AZBA 3DFNA 1EJ7L 1XLLA 3PPFA 4L6DA 1GZJA 2OG9A 3UPMA 2X30A 3GNOA 1TJRA 3A3XA 3C0QA 1OFEA 2NUXA 2A21A 1BWLA 3AWNA 4UCGA 3GHSA 3CM4A 3AO0A 4H8UA 1DYSA 4JIPA 1X1OA 2A4AA 3E96A 3PWGA 2W4XA 2XIJA 1V6VA 2Y7GA 2PWFA 3AAMA 4PMVA 1ZALA 5HPOA 2ALRA 3V5OA 5AYZA 3QV6A 3KOXA 2WVUA 1MRQA 1YXYA 4O18A 2VFFA 2GWNA 3G2GA 2V38A 5DRCA 2BSLA 4XTDA 1R87A 5I07A 4NASA 3SAZA 4TV5A 2PC4A 2ZX9A 1FHDA 1HTIA 4ZOHA 3H7VA 2DZWA 2PU1A 1PHQA 3OQ8A 1EUAA 1J01A 2WHJA 4JTAA 1K7EA 1NOWA 1XIHA 2FTYA 5A3HA 5BCAA 1U1HA 5CZTA 3H6OA 4WJ8A 4JTIA 1UBSA 3NQMA 4EPBC 1ZGDA 2X1RA 3CCVH 2J8GA 2XIMA 2Y5SA 1AW5A 4AZ7A 7A3HA 4S3FA 3B8SA 1KQYA 2EF9A 2VRKA 3CZLA 4QCEA 4HU4A 1JPDX 4C6MA 3U0HA 4W86A 2Q02A 4O4VA 4DY1A 3GXNA 1RM6A 4LY8A 3MI3A 2BHUA 3WNKA 2HROA 1KBBA 2CYGA 2BDQA 4AX7A 3S1UA 3LX9A 1W1VA 4UWMA 4PBFA 3GNPA 3AUJA 1MQRA 1Q6GA 4GVHA 2OYMA 2XN0A 2YGYA 3P60A 1CTNA 5HOSA 1MMFA 2XH4A 3WF2A 1IWBA 5E93A 3WELA 4GZEA 1XIIA 2V9DA 4HYVA 3N1AA 5FAJA 1NP0A 4L1XA 2H3DA 3R0KA 5HAOA 1HG3A 1R9ZA 5CPTA 2E5BA 3MMWA 1ENUA 3QTPA 3ALGA 3O9NA 4B15A 1XBYA 1QI2A 4B5NA 3M41A 3QKEA 2ZDRA 4DWDA 3FFSA 3I3BA 2QIIA 1BG9A 3EX3A 2W9MA 3KXQA 1OEPA 2PDNA 6ENLA 3CUGA 5EY3A 3PVFA 1K6WA 3XINA 2GYIA 4UXDA 3I65A 1OYAA 2Z24A 4X0NA 3EEGA 2P0OA 1MZRA 2P8CA 3E74A 2Y7DA 2NV1A 2V3DA 3HQPA 4PA8A 2BP1A 1XYCA 3L5LA 1GKQA 4JS3A 5AY7A 1IR1A 1VFLA 3SBFA 2Y8UA 3M0YA 3N17A 4RLIA 2AKZA 3GC4A 5KZDA 4GH3A 5I3JA 2OSXA 3SADA 1B30A 4GGHA 3RCNA 4HNTA 4KETA 3LLXA 3AZSA 3LK6A 5C2XA 3WUEA 4OQVA 4IMCA 2WO5A 3KVMA 3IJDA 2OMDA 5BWFA 4O54A 5ABEA 4XIAA 3V36A 1GVYA 2W27A 4DQWA 4Z2IA 4EOUA 1QHPA 3DFOA 3G24A 3AQUA 4XO7A 1HKJA 3UWUA 3ZR6A 2BVYA 4JTLA 2V68A 3MS8A 2OT1A 1O6IA 4LGXA 5HDRA 3W9ZA 4HN4A 3W7LA 3NVDA 3OB8A 5A8OA 4IWWA 3QSRA 4V28A 3ATYA 4LS2A 2QIEA 1VQ8H 2J47A 5JBEA 2HXUA 2OYKA 4G56A 4PMOA 2W3RB 1FUYA 1UUOA 4BEQA 5LNVA 3UWWA 1YNPA 4C65A 1W54A 1WKDA 2W91A 3S1XA 4XKYA 5D09A 4PSRA 5DMYA 4PCSA 4PUEA 5REQA 4D6FA 2C0HA 4C6IA 1XGDA 1E51A 5A2AA 3BLFA 5JMUA 1UOKA 2PDWA 2C6QA 3ZLGA 3JVAA 1S2AA 4DPPA 1VQ6H 1XINA 3FDGA 3TJIA 2FZNA 1JD7A 3CWOX 3VOCA 2E77A 2XH0A 4HHPA 3W74A 4NQ1A 1G7UA 1CXIA 1GG0A 4EF9A 1HKVA 3DHFA 3NQAA 2HBXA 2D2GA 2WSKA 2VELA 2DORA 4Q8NA 1AQFA 3AYTA 5KITA 1LTDA 2VVNA 3A21A 4FR6A 4KGJA 1WX0A 4NJHA 2E3TA 1H7WA 2R1NA 3TYUA 1O68A 3VD9A 3V35A 1U83A 1DTUA 5EMLA 2EJAA 3SZ8A 4O1CA 1TMQA 3PWAA 3VIPA 4O0ZA 3AYVA 2JE8A 4CUCA 2X09A 4R9OA 3SUTA 1M41A 2Y0FA 3GW3A 2EO7A 4XAPA 5FL1A 5H8PA 4W4QA 4P2VA 2YXOA 4DN1A 1DE5A 2QUVA 2YCIX 3GKAA 3BH4A 3SCVA 4ZTXA 1KTNA 5E6YA 2HSAA 1LL7A 4FX8A 5I06A 3WFLA 3TN4A 4NVTA 3S1GA 2R14A 3NZRA 1W1A1 2YBUA 2GSJA 5GNXA 2QCCA 1XD0A 1GW1A 3WEMA 2Q8XA 3BGJA 6TAAA 3P93A 2V5KA 2OLSA 4KF1A 3MA8A 1W5MA 4ZOCA 1DBTA 4FX6M 2QA4H 4O4WA 3S6OA 4F3HA 4K6AA 4XSMA 3GDBA 3HBLA 3B0PA 3VMOA 2WVVA 3N2BA 1NF0A 4LX4A 1OIMA 5A6BD 3KHJA 1DJNA 3IIVA 2DSJA 3CV6A 2JEPA 1R3QA 2I5QA 1P4CA 3L4YA 4P8UA 3NCOA 4BY3A 3HGOA 2DPEA 4HPXA 2VKZG 3N12A 1FWHC 3LG3A 4L4PA 2UV8G 4V1XA 3P81A 4JTCA 3GG7A 5EGRA 4EPEC 1FWCC 2J7BA 2IXVA 1E0XA 2QYGA 3RPTA 4DJFD 4BR1A 3FCPA 3I7SA 1CDGA 4PL1A 1MXDA 2QJIA 1HJWA 3UG5A 1ZU8A 1E0TA 4R53A 4JY8A 1N5XA 1YIJH 3PTMA 2QVNA 1VQ5H 4C90A 1WKYA 4MM1A 2J62A 3FOKA 4WFBJ 3UVIA 1I2NA 4Q4OA 1AJZA 4X9SA 4QS6A 4W88A 2WYSA 1N5WB 2REQB 1C8YA 4F48A 3IUIA 3M46A 3E0LA 1PX4A 3TMQA 4JQ2A 3MKKA 3QV7A 1C91A 4ZOBA 2OTLH 1PX3A 4GUJA 3BZJA 1DQWA 4IFKA 4TU1A 3VKJA 4O8AA 2J7HA 4HSNA 1PIGA 4H2HA 3KS6A 3W1AA 3GM8A 1WZAA 3CEPA 1YE6A 4DXVA 5I5RA 3CL6A 4KQNA 3T81A 4UNKA 3PM6A 5LNWA 3NYZA 1O5QA 1FWEC 1YTDA 4XUYA 4S23A 1ZLPA 5FEZA 1J0KA 4JCLA 2Z25A 3NDYA 3M6YA 1BXCA 5JH1A 5K9CA 2GJNA 1ELSA 2HISA 2R91A 4UC5A 1JZ3A 1W3NA 1WZMA 2ACRA 1W3JA 3TSDA 2Z00A 1HT6A 1OGSA 3M44A 4I6KA 1SPQA 3ZIZA 3GU2A 5D33A 3CIVA 2NXIA 4AIEA 4ZL1A 2ZWYA 3C4UA 4Z2HA 3GY1A 1QVBA 3GVQA 3QSTA 5EPDA 1HKWA 2JK2A 1SZFA 3DG3A 3LHUA 4U28A 3BAIA 1O5KA 2BXYA 2E8YA 2FMNA 3HM7A 4EK7A 2ZC1A 1UYQA 1J9YA 5GNYA 5A2BA 4HK7A 3CCLH 1VAHA 4GY1A 5A8NA 1H1NA 3S5OA 3PTDA 4JTQA 4HSHA 2C8NA 4KEVA 1TQXA 2V2DA 2NQ9A 4O0QA 5IRPA 4NZFA 4XIMA 1ZUAX 4HGXA 1UUMA 6PTDA 1WKEA 3WNMA 1EZWA 1UUQA 4BJHA 4IGSA 3W2JA 1UMYA 2GGJA 1K8AJ 2ACQA 1Z41A 3BVJA 3B9DA 2O9TA 3NUKA 4NYUA 4QITA 2G3MA 2YFNA 1KGWA 5D2XA 3CL8A 4QJ4B 5D9MA 1R7OA 1OCNA 4POCA 4AIBA 4UNIA 1S2WA 5H1SO 2HEJA 1WCGA 4JYEA 2WC7A 2E3ZA 5G5IA 4E0CA 7PTDA 3S9YA 3GH4A 3B8DA 5CSSA 4IQLA 1BRLB 1A0CA 4C6DA 3DFHA 1CB7B 4H8VA 3IANA 3KDOA