5HUOA

Crystal structure of nadc deletion mutant in c2221 space group
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
283
structure length
283
Chain Sequence
b'TDLTPFQIDDTLKAALREDVHSEDYSTNAIFDHHGQAKVSLFAKEAGVLAGLTVFQRVFTLFDEVTFQNPHQFKDGDRLTSGDLVLEIIGSVRSLLTCERVALNFLQHLSGIASMTAAYVEALGDDRIKVFDTRKTTPNLRLFEKYAVRVGGGYNHRFNLSDAIMLKDNHIAAVGSVQKAIAQARAYAPFVKMVEVEVESLAAAEEAAAAGVDIIMLDNMSLEQIEQAITLIAGRSRIECSGNIDMTTISRFRGLAIDYVSSGSLTHSAKSLDFSMKGLTYLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nicotinate-nucleotide diphosphorylase (Carboxylating)
publication title Streptococcus pyogenes quinolinate-salvage pathway-structural and functional studies of quinolinate phosphoribosyl transferase and NH3 -dependent NAD(+) synthetase.
pubmed doi rcsb
source organism Streptococcus pyogenes ga06023
molecule tags Transferase
total genus 90
structure length 283
sequence length 283
chains with identical sequence B, C, E, F, H
ec nomenclature ec 2.4.2.19: Nicotinate-nucleotide diphosphorylase (carboxylating).
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01729 QRPTase_C Quinolinate phosphoribosyl transferase, C-terminal domain
A PF02749 QRPTase_N Quinolinate phosphoribosyl transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5huoA02
3.90.1170.20 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Quinolinate phosphoribosyl transferase, N-terminal domain 5huoA01
3W1UA 1H7RA 5CPNA 3TH6A 3D0CA 3L67A 4O15A 4BWLA 4ORMA 2ZZ1A 3WJZA 5F4SA 3N73A 4O14A 3ZFHA 2JGYA 4JIPA 1G7VA 3W6YA 3UWQA 2V9DA 3NQDA 4BF9A 5I3KA 1TMHA 2QR6A 4AWTA 4Z1CA 3DHFA 1H60A 3KFTA 2NUWA 3MBFA 2ZRYA 2YCEA 3G1AA 4BK9A 3W07A 3A24A 2VFEA 4UFJA 3L66A 5D37A 2Z0IA 3TAOA 3UNDA 3GNNA 4GXMA 1GEQA 5D02A 4HNTA 4MJMA 3FIGA 1H5YA 5E1QA 2Y6ZA 4Z08A 1VPXA 1R47A 1ML1A 1BEUA 3JR2A 4HPXA 1SUXA 1GVFA 4ONVA 3FKRA 1G4EA 1L6YA 1WOBA 4FNTA 1RZMA 3NL3A 2V0TA 3W85A 2TPSA 4A3UA 4C1KA 1Q3NA 4DF0A 5EYWA 1F74A 1P1XA 3O6DA 1ZAJA 4AEOA 2RDTA 1WBJA 1F5ZA 5ABTA 3E12A 2BSLA 2E5BA 1SW3A 3HMJG 4XWUA 1K7FA 3W2NA 1QO5A 1VHCA 3HGSA 3C2RA 4NJIA 3HGJA 3NDOA 2C18A 1AMKA 3G1XA 4RXGA 4JICA 4EOUA 2VFIA 5D2YA 1VJIA 1F6KA 5GVJA 4HHPA 3GNDA 4O54A 3UWUA 5AHNA 3P60A 1MXSA 1OX4B 5CG7A 3PG9A 3NYZA 4I9AA 1C8VA 3UXAA 4FX8A 4DPPA 3PUDA 5K2ZA 3G0UA 3OVPA 4NNAA 2WQPA 1I2PA 1RD5A 1JR1A 3LXAA 2BXVA 4NNBA 4UTMA 1XL9A 3KOFA 3NQ7A 1EA0A 1QPQA 2DZUA 2G95A 1A5AA 1ZALA 1P0NA 1TV8A 3P80A 2GVLA 3GKAA 4JX5A 3N2XA 4LS1A 1KFEA 3I68A 2GOUA 1VR6A 2O7QA 2QCEA 3C52A 4BFAA 1TPVA 1MZHA 4E38A 2E6YA 4FF7A 5C2XA 3MMTA 2B4GA 3QFEA 1KFJA 4WXYA 1LORA 3EKZA 3V75A 2JKAA 2WJZA 4NZJA 4HNVA 4IUOA 2P10A 2QEZA 1VH7A 4TX9A 2AGKA 1A53A 4DO4A 3EX3A 4UFLA 4J9JA 3TV8A 2FTPA 4NJKA 1YDVA 4S2CA 1OFAA 4GE8A 3Q37A 3L2IA 3DFTA 4R33A 3CQ0A 4U4MA 5D2WA 2A21A 3H55A 4UFKA 3QMTA 4HSOA 4PH6A 1X7FA 3EB2A 1WAUA 3QM3A 3DBPA 2PCQA 1A5SA 3OA3A 1BTMA 4H4IA 3PSWA 1V5XA 4UUIA 4ADTA 3HG4A 5G2HA 2QF7A 1GYNA 4MVAA 1SW0A 4IXXA 3LI0A 1TPH1 4CNOA 5F4WA 5LNSA 2DZTA 1Q6QA 1W37A 3M5VA 1OFPA 2RKXA 3PM6A 2RFGA 3VE9A 3I7SA 1XBZA 2GVJA 3T7VA 4WD0A 5I3JA 3LRMA 2YXGA 1JCMP 2VFHA 3M43A 4OBTA 1G7UA 3WFAA 2GPTA 5SWUA 4WUIA 5CSSA 3KXQA 4FX7A 5KINA 1ICPA 4WOQA 4DF1A 5FF7A 3TIMA 1N8FA 1HO4A 3W7GA 3R2GA 3C2FA 1UUOA 4HSNA 3JRKA 5D32A 5F2MA 1M7PA 4O57A 4O1AA 1IXNA 3DHDA 5F2IA 5KZDA 3W70A 2OT1A 5FEXA 3LCFA 2V2CA 3PSVA 3MJYA 4TR9A 5HUOA 1KTNA 3TUUA 4BI5A 1JUEA 2J9YA 1SZGA 2GJLA 3HG3A 2VELA 4ZQOA 2ZRWA 2J27A 3DFPA 4O8RA 2P0OA 3C4UA 3QYQA 4FEZA 1VYSX 3Q94A 3EXTA 4NZFA 3QSRA 2QCNA 4UTWA 4JIQA 3GR8A 3LXCA 3TU9A 1ZAHA 2ZRUA 3O05A 1VGAA 3P8JA 3LHUA 1FWTA 3QEZA 4LV9A 4NJHA 4KWWA 4PL1A 2E5DA 5F4XA 1VYPX 3DAQA 4POCA 4UC5A 3NQ6A 2BX7A 2VKZG 1GG0A 2R94A 3PR2A 3LHVA 4I7WA 2WPBA 5FF2A 5D2VA 5F1VA 5AOUA 1K02A 4LTSA 5K4ZA 4Y6GA 3THQA 4K8EA 5AHMA 3CU2A 4LNYA 2RDWA 1LTDA 3ELFA 1X8FA 2GQAA 1TTIA 3HPXA 1NEYA 5AHFA 3W2JA 2Z2UA 4FNPA 4IX2A 1S3HA 1G69A 3EX1A 2FPVA 3HBLA 4UTIA 1ME9A 3A23A 3UQNA 2ZTJA 2YW4A 3B0PA 3DXIA 1XUZA 2G97A 5FI8A 2NV1A 4JTIA 4OV9A 1B4KA 5AYZA 3P67A 4FIQA 2TYSA 5D05A 2A4AA 1JCNA 3B4UA 3RF9A 4KFPA 3QQ0A 1H50A 4XTDA 3W2MA 1JRCA 1I2QA 4IMFA 5HJLA 3HPZA 5KZMA 4KWVA 4O0ZA 4WQ6A 5BMWA 3HO8A 5DY3A 3GK0A 3SJ3A 4MY9A 4E0CA 4X3ZA 4YCPA 5I3IA 1LRTA 1F05A 4LVBA 1N7KA 1NFBA 2DZWA 2YDAA 2XN1A 1H63A 4R7JA 2DJLA 3DKLA 3M5YA 5G5IA 2Y7EA 5K9XA 3NXFA 3L0NA 4JTJA 1QMLA 3MHGA 3ZS4A 3DFNA 5TIMA 3S1WA 1AL8A 2ZRVA 4Z1AA 3LBCA 3M9YA 2G5WA 4GUHA 3QMSA 2ZYFA 2CLMA 3M44A 1PL9A 1I45A 4JTGA 3STGA 4GUIA 5G1YA 1UASA 1JUKA 3NO5A 3NM3A 3N3MA 2FQIA 3VFLA 2DORA 4GNJA 2QJHA 3TR2A 2BTMA 3GLCA 3N2MA 2H6RA 1XXXA 4QISA 3MP4A 3EWBX 3LV5A 1JCYA 5HR7A 2X30A 4R53A 2ZTKA 4KKXA 2E6AA 3RFAA 1YXDA 4NJGA 3U6WA 1A5BA 4JR5A 4Q33A 1H7XA 3NA8A 1OK4A 3L0KA 5D04C 3LHZA 5BW6A 3HPSA 4A22A 4LS2A 3IV3A 1O5KA 3UWVA 4ZVJA 3SFKA 2DU2A 3S42A 4DO6A 3L5MA 2WNNA 5KITA 1S5TA 1TPB1 1PS9A 4MFEA 4XZ9A 3RLVA 5L6UA 1OK6A 3R12A 4MPQA 1OYCA 4HT3A 3PS7A 2JKPA 3TSBA 2C1HA 1KM1A 3M1ZA 3I6RA 1W3TA 4UCGA 3WK3A 3LCXA 3W1AA 3K30A 3P62A 2F7FA 3QPYA 3C56A 2X1UA 3L68A 2VFGA 3NPVA 4IMDA 1WA3A 4O12A 4QIUA 4AH7A 3HF3A 5HQEA 1TTPA 3G0XA 4IMGA 1KFLA 1L9WA 3W7OA 3KHJA 4PEKA 1JVNA 3GDRA 1A50A 2XN2A 1ZFJA 3T44A 2PRHA 1YTEA 3VKJA 4Y9AA 3SIZA 4N9BA 1JCJA 3WJXA 2H8ZA 3NPUA 4IWWA 1GVOA 1GT8A 3W75A 1KFCA 2ZBTA 2BLEA 3GXPA 1OFDA 4GC4A 3L21A 2CZDA 3O07A 3TC7A 4DXVA 4S2BA 5HULA 2YW3A 5HMSA 3O06A 3I7QA 1FWRA 2C16A 1EIXA 1KM4A 3OG3A 1EP3A 4I7VA 2EKCA 3NNTA 2Y88A 5BNKA 1EWDA 1WYIA 4LV4A 2YFNA 1OYAA 2Y70A 1OFEA 3G1YA 1YXYA 1EUNA 4PCFA 5K9DA 4O50A 2QAPA 3FJLA 4EF8A 5F2GA 1H51A 2Y62A 4UTKA 3BG5A 5EPDA 1RQEA 4HN4A 3IIZA 4ZL1A 2WSYA 3WJSA 3LCWA 3WK0A 3I7RA 4M7SA 4A2SA 5LNWA 1OJXA 1N55A 2PC4A 3ZR4A 3GZ3A 3BARA 1ZNNA 3UWZA 2ZA2A 3DENA 4PC8A 4UTWC 3U2OA 3FYPA 3TX9A 2RHGA 2CZEA 4Z1DA 3TW7A 5U4NA 2B0MA 3BW3A 3KRUA 5AHEA 3O15A 2OX1A 1VCVA 1LBLA 3CEPA 5AB3A 3PAJA 1TPEA 3T40A 1ADOA 2YYTA 5CPOA 3C61A 2HMCA 4LVFA 1WX0A 4RK8A 4DBEA 3G3DA 3W7IA 3TFCA 3PBWA 3P84A 2EF9A 4IX0A 4NVTA 4U28A 3P81A 3PB0A 4LWWA 5HR6A 2DJXA 2B7PA 4AF0B 4Q4KA 5I3GA 1UB3A 4DF2A 5LSMA 5KSWA 3N34A 3MBDA 2NUYA 3SR7A 3F1QA 1GVQA 4OT7A 1M6JA 4OQVA 5AC8A 3CC1A 4LUIA 4NX5A 2H3BA 2VFDA 3W71A 3MI2A 1ZENA 2EPHA 4BI6A 1F6PA 2QUTA 2WNQA 1EEPA 2V81A 4AHQA 4LVAA 3EWYA 1TRIA 1LOQA 4LUJA 3BGGA 1SZNA 4UMBA 1K3UA 3W87A 4JS3A 4A21A 1TV5A 5G4EA 2CW6A 3VI2A 3UPWA 5D2XA 3TXVA 1T99A 2VFFA 3W7NA 4ML9A 1L6SA 2F84A 2NV2A 4RV8A 5DBUA 1XM3A 4TO8A 4LW7A 3L9CA 3W84A 3GVGA 1A5CA 1S5WA 1LBFA 2A1YA 2X16A 3R5EA 3TSDA 3BLEA 4M19A 1UCWA 3PG8A 3G1VA 1SO4A 3N14A 1PCKA 3GIYA 2C14A 3W83A 3S8HA 3TKFA 5HWNA 4NU7A 3G8EA 4AMAA 4FO4A 3T55A 3GXNA 5EY5A 2ZZ7A 3V1PA 3TW6A 3EWWA 4JY9A 2JK2A 4JTUA 3MHFA 1P5BA 1EPXA 4JTKA 4LC8A 3ABOA 1NVMA 1OHLA 2ABBA 5BOOA 2CZ5A 3LCHA 4O1DA 4YXGA 2QAFA 2TMDA 3IGSA 2GQ9A 3UWWA 3KRSA 4UTHA 1KM6A 1XFBA 1NSJA 1RVGA 2FB3A 4ZMGA 3HJZA 5DXXA 1SSGA 1YADA 1QPOA 4LRTA 4PL2A 1ALDA 4RZ6A 1MO0A 2YPIA 2WSRA 4MUZA 1XDLA 2CLLA 3QZEA 2Q8LA 4MY8A 3SY5A 1FCBA 1FCVA 2HTMA 3KX6A 3C6CA 3FA5A 1TPC1 3WJWA 3W9ZA 4UTUA 3CIXA 4WY0B 1YTDA 3PB2A 3TQKA 4O17A 4E2DA 4N6FA 3M6YA 5HNRA 2Y7FA 3A9IA 3RLUA 3SZ8A 4XBSA 1WOAA 3FYOA 3S1VA 3O63A 1FBAA 3GAKA 3W1RA 2EHHA 2AQWA 3E96A 2QJIA 4HNNA 4Q32A 1FDYA 2FLIA 3O1NA 3TDFA 2VEKA 3HGRA 1Q45A 2PRMA 5CKSA 5FESA 2YX0A 3WK1A 2J24A 3M7WA 4FB7A 3A22A 3CPRA 2CLEA 3W1XA 1Z44A 1JJKA 2P1FA 3O6CA 3W7RA 1SO5A 4FIRA 2ISVA 2Y63A 4JTLA 4O16A 1ME7A 3O8AA 4AF0A 1LCOA 1SZFA 3U8GA 1TIMA 2YZRA 3CWOX 3NPXA 4PTNA 3CIWA 2NWRA 1X1ZA 5BRBA 1PHWA 4IMEA 4CLMA 4G1KA 1YPFA 1WQ5A 3NEVA 3M47A 1EUAA 3W7LA 3KVLA 5CSRA 3EX6A 3NL6A 5TBOA 3CT7A 3B03A 3KVMA 1AK5A 2JKEA 1H7WA 1FX6A 1QO2A 1XKYA 2EGZA 5H2ZA 1I2RA 2NXGA 5D03A 1M7OA 4P2VA 4FNRA 4DELA 1GVRA 5DLCA 1DORA 2V5BA 2Q3OA 4LC6A 5FF0A 1VZWA 2V82A 4CCEA 4WXZA 3NM1A 2E77A 1LROA 4FNSA 2HS8A 1VYRA 2W6RA 2H8XA 3LCGA 1TJPA 3TC6A 3NOEA 4NNCA 2PURA 4O53A 3W23A 3MWAA 3SW6A 1QPRA 1YXCA 3N9RA 2Z6JA 3BO9A 5T26A 3W73A 4IMCA 1AW5A 2QCDB 3W74A 3TJXA 3LV6A 4LVDA 3GDKA 4RZ4A 4JDYA 3NQMA 4K7YA 2ZZ5A 3MP5A 3FFSA 1MEWA 1XBVA 5K4XA 2CU0A 4RLIA 1FWNA 4OGZA 1TRDA 1GWJA 1RV8A 1B57A 1OX4A 4TMCA 2LLEA 3ABRA 1F2JA 3M0ZA 5EMUA 2OCZA 2I14A 3KAOA 4QNWA 1XC4A 3L5LA 2ZFAA 3B8DA 3E0IA 3STEA 1QCWA 3NAVA 4JTSA 1AW1A 5LGZA 4UTTA 1VS1A 5IBXA 1JQVA 2V2HA 3L0GA 1SO3A 3MUXA 5DCBA 1VQTA 4H6KA 4LS0A 5HWJA 3B0VC 3BLIA 3NQVA 3CWNA 3EWUA 4BWLC 2FB2A 3NL5A 2DZPA 2CLFA 1PIIA 4FXSA 4IOTA 4A2RA 2I9EA 3HB9A 4UMCA 1LOLA 3DGRA 3SI9A 4RXFA 1G4PA 2NX3A 4XBKA 4GUFA 2Y85A 3DZ1A 4O1CA 4FNQA 5G2WA 5U7SA 4H3DA 4YL2A 4DEFA 1HG3A 2ALDA 4Z1BA 2Q3RA 3G22A 1TYGA 5DY2A 2R14A 1QDSA 3UWYA 2QKFA 4C1LA 3QF0A 4BI7A 3BG3A 2B7OA 3NQEA 1VCFA 4QAIA 4ORIA 1QOPA 3B05A 3UZ5A 1GTHA 3C2VA 1DL3A 1HO1A 4JD4A 1KBIA 3M41A 1H62A 5C54A 5K9CA 1K8YA 1T8XA 4K6AA 4GRSA 3KRZA 2DP3A 3Q2DA 3G1FA 3F4WA 5LHEA 4MLJA 4NQ1A 5L9FA 4EVZA 1DQWA 2NLIA 4XTIA 2J88A 3TNOA 1DHPA 3C2OA 1OFOA 1SSDA 4JEQA 1IGSA 4XKYB 3ZWTA 3HIJA 1ZAIA 1SW7A 2C15A 3EEGA 3S5YA 3W7HA 2CWNA 5AYXA 5D09A 3IIVA 3NQCA 1B4EA 2NWSA 4GJ1A 4JYEA 3L65A 1SFJA 3B0UX 1GZGA 4PFMA 3QH2A 2UV8G 3LBMA 1LRQA 4QQ3A 4X22A 3NR0A 4N9EA 1TPWA 1W8SA 4OU1A 1XCFA 4W9TA 4N02A 1I2OA 1L6WA 3UPBA 4Z0JA 4ZQMA 3C0JA 3P8IA 5CPLA 1D3HA 3TSMA 1QWGA 3LHWA 3YPIA 5J5RA 1GQNA 1FDZA 1CX9A 4DBDA 1TQXA 3G18A 3UZJA 3H53A 4N6EA 4M7TA 4NXKA 1KW1A 1KA9F 1LP6A 3LRLA 3W7KA 5A8GA 3GKFA 1FCQA 4RX0A 4MZYA 4A29A 5DCEA 2QCDA 3MYPA 4LRSA 2ZZ3A 3BG9A 3ABSA 2CLKA 3TA6A 3STCA 1F7BA 2DZSA 3M16A 1R2SA 2W0UA 4P61A 4JY8A 2JGQA 4HNUA 2J9ZA 2E6DA 3Q58A 1OX5A 1O94A 4MKNA 3DFOA 2JBMA 2A7RA 1KBJA 2Y7DA 3TMQA 1WV2A 2ZDRA 5D30A 1O60A 4AVFA 1P4CA 1FUYA 1KM2A 4GFSA 5CGQA 3LTSA 3TQ0A 2NXIA 3NQ2A 3W7JA 1SPQA 4UFMA 1O5XA 1IXQA 5EKYA 1U5JA 1IXPA 1VC4A 4BR1A 2ZA1A 1DV7A 3NZRA 5KTLA 5K3VA 1V7YA 1W5NA 1KM3A 1JRBA 1OVDA 3P74A 3W2UA 5DXYA 4O18A 3W76A 5AN7A 2YYUA 2NZLA 5LNUA 1AG1O 3OBKA 3HG5A 4K37A 4X9SA 5TQLA 1K03A 1X6UA 2C3ZA 4PA8A 2QCLA 1DKWA 3IGUA 4CQ8A 3I65A 3DH7A 4RJEA 1JULA 1LM1A 2HSAA 3C8FA 3ABQA 4TU1A 3IIXA 4Y8FA 3S5ZA 4CNPA 2VEMA 3DI1A 3W7EA 4L4MA 1UUMA 1IXOA 5CPMA 4Z0SA 4QJ1A 5AC7A 4N9CA 1M5WA 3G24A 4GUJA 4OHQA 3TXZA 3GXTA 2A6NA 3MYOA 1H7PA 1QNVA 2A7PA 4XKYA 2ZZ6A 5LNVA 1VHNA 5C55A 2QCHA 3MI6A 4CNNA 3S1UA 4JNMA 5CZJA 2A6LA 4IJBA 3W1LA 3W2LA 3STFA 2NX1A 2G96A 4QM1A 2FPYA 3W1TA 2Z1BA 2VEIA 5IM51 1HFBA 3DI0A 3E49A 2C0AA 4RKAA 2Y89A 5IBXC 1Q6RA 2OT0A 4O52A 1OABA 3RU6A 1XUUA 1JCLA 1G4SA 3F03K 1VCGA 1BKSA 3QJAA 3E9AA 3S9YA 2FPTA 3SSJA 1FCUA 1KFKA 2XFWA 2VC6A 1PE1A 4LOCA 4EF9A 1W3NA 3F4NA 3ANYA 3P5YA 3LHTA 3W22A 2WKJA 2NXHA 1GG1A 4MIMA 3P5ZA 2VENA 7TIMA 5LGXA 1W5PA 1YTKA 2B7NA 3W7MA 4RCXA 1ZJIA 4LU0A 4UTLA 1I4NA 2V30A 2C13A 3BW4A 1XDMA 2YGYA 1LOSA 3G1HA 5DCDA 4DQWA 4WZHA 1L2UA 1LZOA 3L5AA 5G2IA 1H7NA 3MW7A 1C29A 1H7OA 1LLWA 3N19B 2ABAA 4O4VA 2R8WA 1Z48A 3ATYA 3C3NA 4ZQNA 5EBUA 1IF2A 1TSIA 5FEPA 1DBTA 1EP1A 2HS6A 3LTPA 3TE9A 1WBHA 3OVQA 3W7PA 3NL2A 4AHPA 3LI1A 4IGHA 5LNRA 1YPIA 2QCCA 4MJZA 1G67A 2FFCA 1QPNA 4D2JA 1R30A 2VXNA 2YFOA 4O19A 1SZEA 3VCRA 2H90A 2ZZ4A 4WOZA 3AO0A 1LYXA 5AHIA 3S5NA 4HKPA 4ZQCA 3LRKA 5FF3A 1F73A 3KVKA 5F2LA 3W88A 2FJKA 1UJPA 2E09A 4M6VA 3QRHA 4FXRA 2WO5A 1BWLA 1TQJA 3R8RA 3O6YX 4M6PA 3UYCA 3FS2A 2OJPA 3W2KA 1W3IA 3NGJA 3W7CA 3G1DA 4XQ6A 4WJEA 4CCDA 3GDLA 4HIBA 4GWEA 1TPUA 3PULA 2PE4A 3FJ6A 2X2GA 1CW2A 1FY6A 2E68A 4N9DA 3HG2A 1JUBA 1Z41A 3CM4A 2C6QA 4UFHA 1MEIA 1Q6LA 2GJNA 1KV5A 3IEBA 4TIMA 2CZFA 4MOZA 3W72A 3C2EA 2Y61A 1TO3A 3EXSA 1U83A 4ZQRA 1W5OA 1EWEA 2DZXA 5I3FA 5K7JA 1LBMA 4GUGA 3GB6A 3NPWA 4N2YA 3PF3A 4WX2A 6TIMA 2QCFA 5DBTA 4JTHA 4GBUA 2C19A 2BWGA 1TTQA 3IIOA 3PBYA 1HTIA 3A5VA 4JX4A 2WNZA 4DPQA 3FEMA 3PUOA 2CLOA 4O10A 3QQ1A 3DFSA 4YWIA 2V5LA 1KLZA 2YR1A 3TQVA 1JCXA 2A5HA 5A5WA 2OMAA 8TIMA 3NQGA 3WJYA 3PY2A 4M5PA 1BWKA 3EX2A 1O4UA 3LM7A 1LLZA 5FEZA 5FF4A 3IVUA 4UIOA 3T78A 3P82A 2VOMA 3DU0A 1OF8A 3UY8A 4MYXA 4O28A 4ZZ9A 3VNDA 3BV4A 5C5YA 1D3GA 4S1FA 2ISWA 3W7DA 3WK2A 3OVRA 4UNLA 1H1ZA 1RPXA 3HQ1A 4X2RA 3G8RA 3GAYA 4ZQPA 3R13A 5DN1A 1B3OA 1TPDA 1FXPA 4Y90A 3ZWSA 5LZLA 3R89A 3M5XA 1QAPA 2QDGA 2QUVA 5C6MA 1KFBA 2I1OA 3TCEA 4JTEA 2V2DA 3QSTA 1W54A 1RQBA 3GDMA 3UXDA 4NJJA 4QSHA 4O11A 4ADSA 5FEWA 4NT0A 4YLWA 4JDBA 4O4WA 4YCOA 3NVTA 1OF6A 3W1QA 4HPJA 3P61A 1MEHA 2E1DA 4MY1A 1JQXA 1D9EA 3FOKA 2FDSA 1LRNA 3G1SA 1KM5A 4JX6A 1J5TA 3GX9A 3SGZA 2OZ0A 4IPJA 2XN0A 2CLIA 3GYEA 3M5ZA 3BLFA 3HOJA 2ZRXA 2GVGA 4ALDA 2RH9A 4PODA 1YDNA 3LTYA 4UR8A 2AAMA 3BVJA 3CTLA 1AL7A 1MSSA 1W31A 3SECA 1DOSA 5D2TA 3TK7A 4IXHA 1HL2A 2A85A 1B9BA 4WY0A 1EX5A 5I3HA 1XBYA 5KMYA 4OWGA 1XBXA 1ICSA 3SGUA 4JYFA 3TFXA 2QJGA 3DFQA 4B5NA 4E2BA 4YMZA 1ZCOA 2CFFA 4NXSA 5CZTA 3MP3A 1Z42A 3G0SA 3S0CA 2RDUA 4OE7A 1FQ0A 3OIXA 3W7QA 1ZHAA 4AHOA 1OFBA 1I8JA 2TRSA 1KM0A 1VLIA 1DVJA 3W1PA 3TROA 5LHFA 1W5MA 3A5FA 4AAJA 1UBSA 4O13A 1WDWA 5EA9A 1P0KA 3NQFA 3EWZA 1DQXA 3O16A 4NUWA 1K7EA 2WOQA 1OG0A 3S5OA 3QC3A 5D33A 3S1XA 3GDTA 4XUGA 1QOQA 1J4EA 4NX0A 1FXQA 4MLRA 1R2RA 4OV4A 1H61A 4M6QA 1NAL1 1K7XA 1WXJA 4LY8A 5MHBA 1FWSA 1THFD 4O0KA 3VE7A 1SO6A 2NUXA 3MHUA 2J9XA 3IIPA 4TMBA 4AB4A 1TB3A 4CQ9A 1T96A 3QMRA 4JTFA 4UFIA 3KVJA 1YYAA 3IGXA 1H1YA 3PBVA 3LHYA 2ZQ0A 3PVFA 1O95A 3PC0A 1G4TA 4Y96A 4WY0F 5EL1A 1VLWA 1GYLA 3EX4A 3IRDA 3A21A 4UNKA 3LCLA 1DJQA 1F76A 3HGOA 1RR2A 3IVTA 1EB3A 5G1TA 4JYDA 1KTCA 1K8XA 2FIQA 4K8HA 1KTBA 5CZ0A 5G4WA 1OX6A 1G6CA 1OFQA 2A0NA 4UXDA 1GVSA 5AC6A 1C9DA 4K7VA 1XI3A 5E0KA 3E02A 3EXRA 1YLVA 4L4LA 4CCCA 4UTJA 2EAWA 1CI1A 1GJPA 1TREA 2QDHA 2ZA3A 3CB8A 3LERA 1X1OA 1RQHA 1NF7A 3W1NA 4JGDA 2DZVA 3QPZA 3B04A 3CEUA 1FDJA 1GOXA 1K8ZA 2KZHA 6ALDA 2IQTA 2A7NA 2PRLA 1OFRA 3PWAA 3THAA 1AW2A 4AXKA 1OYBA 2E6FA 3NQ8A 4K36A 1HUVA 3TJLA 5D38A 3PBUA 1ZY9A 3MI3A 3PUEA 3BPWA 3AJXA 1W0MA 3JS3A 1PCWA 3LXBA 3NG3A 2QCGA 4IQLA 5DELA 3LDVA 2ATMA 2W79A 4IPIA 3G3MA 1KLYA 4MZ8A 2NX9A 2WV8A 1QR7A 3USBA 1LDCA 4MYAA 4QNEA 4FX6M 1I2NA 3INPA 2J6XA 4RZ5A 5CZSA 3FLUA 5BMXA 2E5CA 1TCDA 4LVGA 1ICQA 2Q8ZA 1Y0EA 3LX9A 1FWWA 5E93A 3CLMA 1TTJA 1NF0A 5AHLA 2X1TA 1T0OA 1DJNA 2QCMA 1PV8A 1YDOA 2H3DA 3W1MA 5AFDA 1PVNA 3W3OA 2GQ8A 2ZRZA 3N9SA 3W86A 3S6DA 4EIVA 4AWSA 1QFEA 3RNDA 3DKJA 1VRDA 3H54A 5HINA 4AWUA 3LB0A 4LT9A 4FHAA 3RMJA 3TMLA 4KFNA 3IVSA 1TJRA 4CQAA 4N4PA 3TAKA 3T4CA 4DO5A 3RK8A 2ZZ2A 5LKYA 5KZEA 2X1SA 1SR9A 5H91A 4JN6A 4K38A 3BK0A 2GUUA 1E51A 3QW4B 1GPWA 3LLDA 2YSWA 2QUUA 1GTEA 1PHQA 3UY7A 1TV7A 4R34A 2ISSA 1EP2A 2BZNA 2CLHA 3LGEA 1W5QA 3EKLA 4QITA 3LOTA 3B06A 5AYYA 3BGJA 1KV8A 3CHVA 2D73A 3OEXA 4ADUA 3BW2A 4RR4A 1SQ7A 3LCIA 4ICNA 4EWND 1ONRA 2Z6IA 4FNUA 4MFDA 2TSYA 1IIGA 5HWMA 4I7UA 5J5DA 1R46A 1SU5A 3FKKA 4JXCA 5HUPA 4K39A 2R91A 2B7QA 4UR7A 1S5VA 1J2WA 1TPFA 1SFLA 1W1ZA 2VEPA 3LLFA 2V8ZA 3ATZA 4JTTA 1Q6OA 2WSQA 4N4QA 2ATSA 4UTTC 2X1RA 1W56A 4UMAA 4MZ1A 3NQAA 1R2TA 3GR7A 3UD6A 2Y7GA 3MO7A 3QW3A 3OHIA 1ME8A 3P7YA 4KFOA 2ZCGA 1IIHA 2O7SA 3NZ1A 2A2IA 5F1UA 3EWXA 4O1BA
chains in the Genus database with same CATH superfamily
3W1UA 4UY8M 4AC1X 1XYFA 3D0CA 3WJZA 1WDPA 7REQB 2JGYA 1J6OA 3T0DA 2ZX8A 4XBJA 4NAEB 1QI5A 1LL7A 3TYAA 2QR6A 5B80A 1NP2A 4NG3A 1W9DM 3L66A 4BKNA 5JVHJ 3TAOA 4MJMA 1H5YA 4HA1A 5E1QA 4WLCA 4MAZA 1VFUA 1ECQA 2TPSA 4X2PA 4ACZB 4L56A 3CBWA 4QS5A 5EYWA 3GHTA 4XAZA 4HJWA 3NSNA 2W9MA 3QOKA 3O6DA 1ZAJA 3W6LA 2RDTA 1WBJA 2YA1A 1F5ZA 3F5LA 4YTTA 3E12A 5EGRA 4XWUA 3W2NA 1E6XM 1VHCA 3IJLA 5GAHN 1AMKA 3K4WA 1ZL1A 3MDWA 2PSNA 3QGKC 1D7FA 5ECUA 3GNDA 4O54A 4C7FA 3P60A 1MXSA 5CG7A 4GY7A 4L4OA 4I9AA 1C8VA 2OTLH 4DPPA 4FK9A 3PUDA 4AD0A 1FKWA 3VKDA 4AVOA 2WQPA 3LXAA 4NNBA 3WBEA 5MPOC 3VD4A 2NSOA 1XL9A 3TYDA 4DWSC 2GJPA 5GJMA 1EA0A 3A3XA 3I3BA 3PZIA 3TTEA 3IJ8A 3GKAA 4S3FA 1MWOA 2ZC8A 4EADA 3VIJA 4LS1A 3MJMA 1VR6A 2O7QA 3WH8A 4BFAA 1TPVA 3E0FA 1ZP3A 1U5VA 4E38A 4PEEA 2YXOA 2B4GA 4DUOA 4KS0A 5I06A 3SFWA 1KFJA 1XLGA 3EKZA 2JKAA 2FMNA 3IK2A 1A5MC 4HNVA 4JNZA 2QEZA 4IJCA 4TX9A 1VLBA 4GOAA 3PTQA 3EX3A 1M1KJ 5E0CA 2FTPA 3E2RA 3P93A 4C6KA 1OCJA 1K6WA 4S2CA 1IEXA 2R82A 3GNRA 2VZTA 3L2IA 3DFTA 3GDBA 1O6IA 3CQ0A 4U4MA 3EYPA 2A21A 4UFKA 4REQA 1WAUA 3KDNA 2Y4SA 3ITOA 2CZVA 2PCQA 3MCNA 4DWDA 2WMFA 2GOKA 1IGWA 1I60A 4H4IA 3PSWA 1F3EA 2WC7A 1XGDA 3HG4A 5AECA 1TPH1 2BY3A 3IAPA 4WCJA 4M8UA 2HE5A 3VE9A 1XIBA 3CHEA 2PGRA 1DWFM 1QNOA 4QS6A 1GW9A 2R1MA 2GPTA 2CXEA 1NELA 2ZWZA 4FX7A 1ICPA 5A3HA 2HK0A 4DF1A 4LFYA 3S9IA 5FF7A 1ITUA 1N8FA 3AAMA 3R2GA 1UUOA 3JRKA 3AHYA 4O57A 3DHDA 5F2IA 5KZDA 5FEXA 1JROB 4ZE4A 3PSVA 4TR9A 1NDYA 3ID7A 1AVAA 3CS2A 2X05A 2QJNA 1P0EA 4J35A 2J9YA 1CGXA 4DBWA 2PDMA 2V69A 2VL4A 5H8PA 3NUKA 3ARUA 4ROQA 2RJHA 1VYSX 3BURA 1FMAE 4NZFA 7CGTA 3U5YA 4WIWA 3TU9A 5GQBA 3O05A 1CGYA 2WPGA 4TVCA 3QEZA 4G2DA 4LV9A 5T8GA 4P8UA 2VKZG 2R94A 1PYMA 4I7WA 2WPBA 3BC9A 1C8QA 1S2TA 2R1PA 3FGCB 3WQVA 2PDBA 2W67A 2DIKA 4MNKA 4TTGA 4QRNA 5K4ZA 2CBUA 4ATDA 2HROA 3THQA 5A95A 4K8EA 3CU2A 1LTDA 1X1NA 1AZYA 1TTIA 2VCAA 3HPXA 1NEYA 4LCQA 2Z2UA 1UWUA 3RCYA 4IX2A 2W4XA 4E4UA 1S3HA 2XGBA 1KC8J 3CAKA 4YYFA 2ZVRA 2CITA 3EX1A 3AISA 3QHOA 3M0LA 1EQPA 4FAMA 2ZTJA 4IG2A 3RCNA 5I5RA 2BVDA 2CHOA 1XUZA 2G97A 2NV1A 3Q67A 3GTIA 3VKCA 3L4UA 1RA5A 3EPNA 5I02A 3P67A 4HVXA 2TYSA 2A4AA 1I0BA 4KFPA 2ZUNA 3I6EA 4EXBA 4Y9PA 2FVKA 3GC2A 1D8CA 3W2MA 4DO7A 1JRCA 1B0IA 5HJLA 3HPZA 4KWVA 3VM5A 3NVZC 5BMWA 3S4TA 2D2JA 3BOXA 2WM1A 1NM9A 3BSMA 4HOXA 5I24A 1CGVA 5LYRA 1PB0A 3M5YA 3B8SA 2Y7EA 5G5IA 1R38A 4GQRA 1J0JA 5LXEA 3L0NA 1QMLA 2PGEA 4ENLA 1MI3A 3D46A 5JH1A 1QASA 4IUGA 1AL8A 2ZRVA 4C6PA 4Z1AA 2ZE3A 3M9YA 2ZYFA 4BEQA 4GPNA 1TV3A 2F6UA 4JTGA 3NM3A 1RH9A 3VFLA 4HYVA 1XGEA 1AH0A 1DXIA 4GNJA 3OVGA 1LQAA 3GLCA 3OYXA 4H8HA 3SR6C 2H6RA 3CPUA 4GGHA 4V1YA 3LV5A 4C7ZA 2Y5JA 1KWKA 5HR7A 1KRAC 4R53A 5AVNA 3RFAA 2PGFA 2GVYA 3KM8A 1YXDA 8A3HA 2FGZA 4TV6A 4I5UA 4JR5A 1XH1A 4Q33A 5HA7A 5BW6A 1MFVA 2VQUA 1OGBA 2X1IA 1QW7A 5E09A 4KPLA 3UWVA 4B92A 3N4EA 3S42A 1XIIA 3VGEA 4DO6A 3C5QA 4YU1A 2IPGA 3TNBA 2OWCA 3LCXA 3W1AA 2F7FA 2HE8A 2X1UA 2INFA 4GISA 1D2KA 4N7QA 5HQEA 3G0XA 1E6ZA 1KFLA 1L9WA 1UKOA 4GVGA 4KGJA 3AS0A 3KHJA 3NTYA 3GDRA 2XIQA 3WNMA 3K4AA 3G2GA 1YTEA 3VKJA 3I3DA 1ZXIB 4AWEA 2VR2A 4IWWA 1E72M 1ZUAX 1GT8A 1IT8A 5A6BD 3RR4A 2BLEA 3R6IA 5CC5A 5BXPA 2ZUMA 5BXSA 2CZDA 4C65A 5HULA 2BMBA 2YW3A 1XPGA 3GTNA 2C16A 1EIXA 2WJFA 1KM4A 4I7VA 5C2GA 4Z2JA 2Y88A 4NHVA 1HJWA 4LYQA 2V68A 5FSEC 1WDQA 4JTCA 3B0YA 2XYLA 1EUNA 4PCFA 4EF8A 2WJEA 3WLIA 4KT2A 1NQKA 2ZC1A 4QDPA 2OEKA 4WK9A 2PDGA 2WSYA 3WJSA 2X0SA 4B90A 1W3JA 3WK0A 5PTDA 4NIRA 2VD9A 5LNWA 1OJXA 1R3YA 3ITXA 3WUEA 3BARA 4HTYA 4QG8A 4PC8A 3PBMA 2RHGA 3TW7A 3CGTA 4IH3A 3KRUA 4RNJA 2OX1A 1BYCA 1EZWA 2YYTA 2V67A 3H4GA 3C61A 4RK8A 1FWEC 1J93A 3L23A 1AZ2A 3G3DA 3BMXA 1CXLA 1LQ0A 1TZ7A 3P84A 4UB9A 4GABA 3P81A 4GIYA 2IKGA 4XB3A 5HR6A 4AF0B 1IYXA 1KCZA 2YCLA 2QIEA 1ZB5A 1K9TA 5LSMA 4IFKA 4GI9A 3MBDA 3SR7A 3AIVA 3HA1A 4OT7A 1KKOA 5AC8A 5BXTA 3WD3A 1Q65A 1TWSA 2QULA 3AS2A 1F6PA 1E55A 1EEPA 2V81A 2F8QA 1Q6GA 2WMGA 4LVAA 1M53A 1LOQA 1SZNA 1ZU8A 1KD0A 1Y65A 2E28A 5G4EA 2CW6A 4M82A 4XZWA 1NU5A 3VI2A 4NZ1A 2OLHA 3QR0A 3KZSA 3AUOA 3TXVA 1UW9A 1FFQA 5BWFA 3H2EA 4ML9A 3VO0A 2NV2A 3SIMA 3AWNA 3BLEA 3PG8A 3JUGA 4JTRA 3GU2A 4DJED 1PCKA 2EPKX 1H41A 1PZ2A 4Z2LA 3S8HA 3G8EA 3CL8A 2BHZA 2C8NA 4U31A 3GXNA 1EF3A 1K8AJ 1GKRA 4ZFCA 3QV8A 2HBXA 1DJHA 4IGSA 2AKZA 3VOIA 4PSRA 1SR0A 3ARPA 3B40A 2Z7KA 2ABBA 1MW2A 2VGIA 4KQNA 1B90A 3N2TA 4W7VA 3IGSA 3U57A 1NY1A 1XFBA 1RVGA 1QUMA 4ZOCA 5DXXA 1YADA 1QPOA 2VCCA 4O1FA 3VKKA 1QBBA 4LRTA 3AOFA 3MZNA 1MO0A 1E4MM 4I8DA 4CD6A 1KNWA 4J28A 2CLLA 4PGLA 4XG1A 1DIOA 2GQ3A 4MY8A 1E70M 3K13A 3SY5A 2NV9A 3BAXA 2HTMA 3KX6A 3C6CA 3FA5A 1TPC1 3MV01 3W9ZA 4WY0B 3TQKA 3GXIA 4DY1A 4X61A 3BAWA 3M6YA 2J4GA 4PUWA 1LUCA 5DMLA 3U7VA 4HU8A 4AD2A 3FYOA 4RPPA 2EPLX 1QOXA 1FBAA 1LL6A 1VPQA 4E3VA 4GGBA 2J6VA 5CC7A 2EHHA 3GYCA 4AZ6A 3CMEH 1FDYA 2VEKA 3GHRA 4Q4RA 3WY1A 4EAMA 4X60A 5CKSA 3WNPA 3CZ8A 3B8WA 1K77A 3DGBA 4FB7A 4CNSA 3A22A 3MKKA 1W9UA 3H7VA 3O6CA 3W7RA 1C92A 3QFWA 2OZ3A 2ISVA 2Y63A 5CPSA 3V0UA 3O8AA 3CWOX 1LT8A 3REQB 3BSGA 3CIWA 3F2CA 4LANA 3G6LA 1WQ5A 2X7VA 4A8IA 4AIUA 3GY1A 3NEVA 3A13A 3WLJA 3KVLA 4DN1A 5CSRA 3PZVA 3VTRA 3CT7A 1FX6A 1XKYA 1I2RA 5FSDC 3KBMA 2WP4A 5CC3A 1J5SA 4P2VA 4PBGA 4JAWA 1E43A 3PPGA 5CBJA 3HU7A 4LC6A 5FF0A 2AOSA 1PTGA 3SQMA 4CCEA 2E77A 3BLLA 2HS8A 4H7VA 1VYRA 3OZOA 4Y9NA 1YIJH 1DE5A 3GH5A 4I90A 4UZSA 4MKVA 3NOEA 3EB4A 4NNCA 4EPBC 3UR8A 4GQQA 1YXCA 4DBSA 3BO9A 2PZ0A 2QCDB 2VZOA 3S6TA 3LV6A 4XD3A 3B8IA 2XH2A 3FFSA 2CU0A 4BF7A 4OGZA 4C6NA 1TRDA 2PDCA 3ABRA 4C80A 4QNWA 1RVKA 1CEOA 3L4TA 3CAWA 1R7AA 3L5LA 4WDUA 1QCWA 4JTSA 1M65A 2VVSA 5HJXA 2V2HA 3L0GA 4XISA 3BDKA 4WDWA 1E9YB 4XX6A 4IQDA 4GI4A 4FI4A 3BLIA 1ZLPA 4NZCA 4PMXA 1PIIA 1VQ4H 3DGRA 2NX3A 3CH0A 4IMAA 4XBKA 4GUFA 3EDFA 3DZ1A 2FDMA 3GUGA 4ERAA 5U7SA 1H11A 2QUMA 4AIEA 1HG3A 1LQ2A 1JRPB 5A2CA 3ANUA 5FJUA 3UWYA 1XD1A 4C1LA 3QF0A 1V6WA 3BG3A 2PFHA 4ORIA 1QOPA 3UU0A 3ARTA 1GTHA 2OG9A 4Q7NA 1KBIA 1QI2A 5K9CA 5DQPA 4OOZA 3MCMA 2CIPA 4K6AA 3KRZA 3LPFA 3RO6A 4CEUC 5LHEA 1TKKA 3LS9A 3C2OA 3MMUA 3VFCA 1SSDA 2DH2A 5EMMA 1YNPA 4WF9J 3TN4A 1RJRA 3W7HA 1OTPA 5D09A 3IIVA 4XR5A 3WF0A 1BRLA 2NWSA 3GNXA 5HANA 3K2GA 1C91A 1VEMA 3B3DA 2J8FA 2WKLA 4U5IA 3TEVA 1LRQA 4IIGA 3TC3A 3ZVHA 3LSCA 1VDVA 5A6SA 2Z2AA 4MB1A 3R8GA 4N02A 4QFUA 1TFVA 3B4YA 2J79A 4I8YA 4ZQMA 4DYJA 5HPCA 3KDOA 4QG6A 2KAUC 4DBDA 4M7TA 4J3VA 3THDA 1LP6A 1VFFA 3C3UA 3CQIA 4MZYA 3HJEA 4MGGA 4Y9MA 3B9OA 3MVIA 2ZDSA 3M16A 2GYIA 4D9PA 4RE0A 3B9AA 3DECA 1ISYA 3DC8A 2E6DA 1Q6FA 1OX5A 1BVWA 5A6LA 2JBMA 3T0CA 4NZ3A 1J11A 2G41A 1JXJA 3BE7A 2FMOA 2Y7DA 5JIPA 2ZDRA 5D30A 3TOPA 4PR4A 4JTAA 5H8MA 5GAEN 3RR1A 3HQOA 1PWMA 2WXDM 3OHMB 3ZO9A 4JHOA 1IXQA 5EKYA 3HPAA 2VYOA 5KTLA 1S2WA 5AZ1A 3XISA 3OJGA 2C71A 5I0DA 1JDFA 3CHCA 5CPQA 4O18A 1XF0A 1EPVA 2WNWA 2NW0A 4RDWA 4AEFA 3APYA 3AHVA 3HG5A 4K37A 4JIHA 2HQAA 5TQLA 1PTDA 3I65A 3TLLA 1EL3A 4WRHA 1LM1A 1FHLA 1UQYA 3ABQA 4TU1A 3OTRA 2VEMA 7TAAA 4ZENA 3BAJA 4Z0SA 3VD9A 4N9CA 3PN8A 1EJRC 3HV9A 3GXTA 3ARZA 3MYOA 4XKYA 4DI9A 2FTWA 4M56A 1M3UA 4IJBA 4HP5A 3PUGA 2V5CA 2J66A 3N2CA 1IV8A 2NX1A 5I23A 1XYZA 2VP8A 4KCUA 3EWDA 4QM1A 3W1TA 2ZUVA 3DI0A 3E49A 2NSXA 1Q6RA 2QLYA 2R6OA 4O52A 1OABA 4REQB 1XUUA 1G4SA 1VCGA 2J7GA 4DNHA 3E9AA 1F3TA 3SSJA 1KFKA 1KCLA 1HP5A 4LOCA 4J2MA 3F4NA 1PZ0A 3ANYA 2WKJA 2OKOA 1GGOA 4MIMA 3AS3A 4PMOA 1ODZA 1Z89A 7TIMA 3GH4A 2WZTA 1U2YA 1ZJIA 4LU0A 3J7ZM 3E2VA 5REQA 1XDMA 2YGYA 1MYRA 3VGHA 5DCDA 4DQWA 5JIWA 5CH9A 1I0DA 1L2UA 5JU6A 1LZOA 1JD9A 3P0WA 2JFEX 2XHYA 5CBIA 1J18A 1H7OA 4O4VA 1LLWA 3PZMA 4K8GA 3ATYA 3C3NA 3OG2A 4ZQNA 3U48A 5FEPA 3RCMA 5CSUA 3TE9A 3BL3A 4M1RA 2OB3A 1WBHA 3W7PA 4HU3A 3LN3A 2XJ7A 7ENLA 3LI1A 4IGHA 1YPIA 2QCCA 3PFRA 3HQNA 3U2EA 2VZUA 1SMAA 4DAIA 3KBVA 2VXNA 3ZQ9A 1SZEA 3DG6A 4DJFA 8XIAA 1O68A 5B7ZA 2YA0A 3S5SA 3S5NA 1AQ0A 1PTAA 3NWRA 3UNTA 5H8UA 4P7QA 1UJPA 2E1WA 3MANA 2EPMX 2WO5A 1TQJA 3QPEA 4KWSA 2VDIA 1JD7A 3O6YX 3VMPA 2OJPA 3LGGA 4D6EA 3WFZA 4IPPA 4HBKA 3AXIA 1W3HA 3RLHA 3G1DA 1DWJM 4QAWA 1FTXA 4CCDA 2VEGA 1OZMA 2VX5A 4PUMA 3PPFA 4GWEA 3IUDA 1DJWA 3C0QA 2WCGA 4NYUA 1A5LC 2PF8A 2C6QA 3VIOA 4D6DA 3RM9A 1Q6LA 3IK4A 2AL1A 3WMSA 4EANA 1KGXA 1DHKA 1PXGA 1TVLA 1XLIA 3N6HA 4U5KA 1FOBA 1TO3A 4IG2B 4AD5A 5GAGN 4ZQRA 1JPMA 1R9XA 5CG0A 4LALA 4GXPA 5K7JA 3UVIA 4QX4A 3GB6A 3NPWA 2W54B 2Y24A 1VBRA 4WX2A 4QJ3B 2VT0A 2OZ8A 4C6IA 4GBUA 3V36A 5ECVA 3LEPA 1A0DA 1DXFA 1TTQA 4PTXA 1T40A 5JBFA 2WNZA 3MTWA 3FEMA 3CL7A 2OTDA 3IARA 2WK6A 2ZIDA 4L6DA 3KS5A 3CYJA 4OUIA 3ZVIA 4RE4A 2DUAA 3ZJ6A 2R1NA 3A4AA 5H6HA 2Q8XA 3QZAA 1O4UA 5FEZA 2QVHA 3GG7A 3IVUA 2HVNA 1Q7QA 4K3ZA 5T9BG 4GINA 4O28A 2G3IA 1TV2A 4FLOA 1R85A 3FK4A 3BV4A 2ICSA 4AG0A 1D3GA 5BXRA 5C5YA 7A3HA 3W7DA 4CNUA 4AZBA 4EWJA 4HGXA 4JKKA 3HQ1A 3GAYA 3NVDA 4IL0A 3OZYA 3WQPA 4BQ5A 5DN1A 3VOGA 4JQ2A 4LCSA 4MNJA 1FXPA 3ICJA 2NT1A 4LUSA 3M5XA 2QUVA 3DYOA 1DWGM 1M7JA 2AL2A 2D0FA 1TWZA 3TCEA 1W2VA 3QSTA 5A94A 4WKAA 3MUZ1 3FCPA 1XGZA 4IL2A 4F0HA 3EDDA 2F6KA 3WDHA 4O11A 4CQBA 1EOMA 2EPOA 4ADSA 4JNYA 4NT0A 5C9WA 4YLWA 4JDBA 1UPPA 3H2MA 4HPJA 3P61A 2J0FA 1UR2A 1XC6A 4F0LA 3FAWA 2WMKA 4WF7A 2XSAA 1XLCA 3GX9A 2XM1A 3SY8A 3SGZA 2YCIX 2OZ0A 4IPJA 3S2NA 3EBVA 4YIWA 2XZ7A 3M5ZA 2XIIA 1A3WA 4A8NA 2UY3A 2ZRXA 1DJYA 2GVGA 1YDNA 4JHMA 4UR8A 1MSSA 4RE3A 4O1EA 3GSMA 5I00A 4F8XA 4IXHA 4F79A 4P8WA 3MSGA 3SGUA 4GIAA 4JYFA 3TFXA 2QJGA 1EF2A 1ZCOA 4NXSA 5CZTA 2GLKA 4UOJA 2OOGA 3S0CA 4OE7A 1FQ0A 3ENLA 4AHOA 2BOEX 1I8JA 2TRSA 1KM0A 1RA0A 1FA2A 3PIOJ 3Q4DA 1VF8A 4AAJA 3QGVA 1RBOB 1UBSA 1Q82J 1P43A 4O13A 4QEEA 1XSKA 3NQFA 1VIZA 1DQXA 3E0WA 2WOQA 1AFSA 4JQAA 1P0DA 3A4WA 1B3WA 2BG5A 4NX0A 4A4AA 1WKEA 3OIHA 4MB4A 1XLDA 1AD4A 4GHRA 1H61A 4M6QA 1NAL1 1K7XA 5MHBA 4IIDA 1FWSA 3AMDA 4LAUA 2Q09A 4RNFA 2WVUA 3VE7A 1SO6A 3AMLA 2VO5A 1PAMA 2NUXA 3IIPA 2QDDA 2VOTA 4XZMX 2XPKA 2CKSA 3MUIA 2ZQ0A 1O95A 3PC0A 1DE6A 4WY0F 5H1SO 3F4CA 4C6CA 3IRDA 3A21A 3SJNA 3LCLA 4NRSA 3ZIZA 2IMRA 5G1TA 2W55B 4GQBA 4AQLA 4DBUA 4DWSD 1UMYA 4RPQA 4ERIA 3N25A 3OQ8A 4JTQA 1XDJA 4K7VA 2YCLB 2ZJQJ 2IS7A 4H8VA 4L4LA 5D9MA 4CU7A 4HN8A 5A8OA 1IWPA 4CCCA 4EKJA 1CI1A 1AMYA 1GJPA 1TREA 3LERA 1OY0A 4Y9OA 3B04A 4KCTA 4M24A 3VYLA 1K8ZA 2G4JA 2ZWYA 2PRLA 3PFMA 1Q7ZA 1AW2A 1OYBA 1UOKA 3NQ8A 1J8VA 3OGSA 4K36A 3TJLA 1TJ1A 4C6OA 2VRKA 3MI3A 4FOUA 4AX6A 1UQZA 2HEJA 2OQLA 1C90A 2ZX6A 4WDTA 1HNYA 1ZBKA 4BA0A 2QCGA 2W79A 1K6AA 4PTDA 1VPYA 1N2VA 2EG8A 2UZ9A 1HJUA 4QNEA 3WEMA 4PUUA 4FXFA 1UBPC 2JE8A 4IIEA 1OC5A 3FNDA 5BMXA 2O0TA 2E5CA 1FWGC 1ICQA 4CU6A 3CO8A 2UY4A 3MWCA 3VD7A 3CLMA 3CASA 5AHLA 4W93A 3S2CA 4Q7IA 5C8BB 5HNTA 2DV0A 3SAZA 7PTDA 3F2DA 1PV8A 1KD1J 5DT5A 1RALA 3W3OA 1NJIJ 2ZRZA 2Z24A 4AWSA 3VGFA 3DKJA 1V3MA 1VRDA 1S72H 1UP3A 3BUVA 5M1TA 1NARA 3RMJA 4YHGA 1I9CB 2HNEA 3RITA 1E0VA 1XJBA 2BB0A 4CQAA 1TWIA 3TAKA 4DO5A 3RK8A 4GC3A 4RDVA 4UNIA 4JN6A 1R3VA 2ZXAA 3BK0A 2GUUA 3SRKA 3LLDA 2W63A 2QUUA 2HNHA 4QE1A 2QMKA 1PHQA 1TV7A 5C71A 3N17A 4KERA 3LGEA 2W3ZA 4G7EA 1XCWA 3EKLA 3B06A 5AYYA 3ORWA 5EFFA 1XYBA 3VDBA 5T91A 2BY0A 6XIMA 4FPSA 4FNUA 2PP3A 5AZ0A 1EGVA 1IIGA 5J5DA 1R46A 1Q81J 2E0PA 2OPJA 2O9OA 1RSCA 1W1ZA 4Q4MA 2VEPA 3H2AA 2VD8A 4BJHA 1OIFA 1RBLA 1Q6OA 3SQSA 4QE5A 1NVIE 5C9UA 2X1RA 1IEVA 4UMAA 1R2TA 4KCVA 1UR8A 2Y7GA 2PDPA 3UD6A 1BAGA 4JOMA 3P7YA 1VB9A 1IR1A 2A2IA 4Q4SA 1XP3A 5CAHA 4O1BA 3GBEA 4Q7BA 4ECLA 5CPNA 3W29A 4O15A 4ORMA 4CVWA 2ZZ1A 5F4SA 1CLVA 2F38A 4O14A 1VQMH 4M51A 1HJQA 2XISA 1G7VA 2OLSA 2BVWA 3H22A 3WX7A 3W6YA 2V9DA 4BF9A 1TMHA 5HNUA 3SBFA 1V7AA 2JEQA 4U10A 1H60A 5HOSA 3MBFA 2ZRYA 2YCEA 4BK9A 2RAGA 2L5HA 2I5QA 1MVYA 2CETA 4CD4A 3ARXA 5HJYA 1GOMA 4Z08A 4PMRA 2HV5A 1BEUA 1E0XA 3JR2A 4HPXA 1HKMA 1GVFA 4ONVA 1G4EA 1L6YA 3CUGA 3L4ZA 4FNTA 2P50A 3UJEA 3W85A 4C1KA 4C6EA 2GUBA 5DF0A 1P1XA 3D5HA 1KXTA 4RUBA 2UY2A 4AEOA 2BSLA 4RZBA 1OCQA 1IZKA 1SW3A 2ZUTA 1VBUA 1K7FA 3FY1A 4CD5A 3HGSA 3URQA 4GZ7A 4GX9A 3KOWA 3HGJA 4NJIA 3H8AA 1R7OA 4EOUA 2VFIA 4GK8A 2BV9A 1H49A 1F6KA 1IEWA 3F4DA 4HHPA 4X0VA 3M0HA 1REQB 5AHNA 3BLKA 4FX8A 2PWDA 2V3DA 3OVPA 4GY1A 4NNAA 3MSYA 2R1LA 1Z3NA 1WYGA 1XQKA 4UQDA 2BGNE 2DSVA 2NQ5A 3KOFA 1QPQA 4JPGA 3WQDA 1A5AA 1TV8A 1I1XA 3UXIA 1UIOA 1VKFA 4HHMA 2OGYA 1KFEA 3I68A 3LUTA 1EHNA 5C2XA 5M2FX 3PPHA 4WXYA 3IS4A 2WJZA 1J0IA 2P10A 1A53A 3GXMA 4C5ZA 4LUTB 1VQLH 4E6MA 4GE8A 4P7LA 5E5CA 4R33A 6CGTA 5A6MA 5ABEA 3QMTA 1BYAA 4PH6A 4ROPA 1BFNA 3AIRA 1SFTA 3QM3A 3NVWC 2PAJA 3DBPA 4PB3A 1A5SA 4DZ5A 1X97A 2HXTA 4ICCX 3T08A 4UUIA 4ADTA 2QF7A 1DTNA 4CNOA 4S3JA 1HKIA 1K9FA 5GJNA 4B3ZA 5F4WA 1UH2A 3M5VA 7REQA 3OLIA 2GVJA 3LY0A 1ZQ5A 3T7VA 3W53A 5I3JA 1BRLB 1J0YA 4K68A 3NDYA 2BP1A 2YXGA 4NAEA 1P6WA 5SWUA 5CSSA 2XVNA 4QHRA 1Z9AA 3KXQA 4J27A 5KINA 4GVHA 1AJ2A 1AJ0A 3OGRA 3TIMA 3W7GA 3C2FA 2ACQA 4R9XA 2PDJA 3WDIA 5D32A 5A2AA 3KWSA 4XO7A 3OPSA 5HL7J 3LCFA 3WD1A 4AIBA 4Q8VA 4B15A 5HUOA 3L7RA 4BI5A 4HNLA 2GJLA 1QRQA 4TV5A 3SCNA 4ZQOA 3J7HA 5DRIA 3DFPA 2OLAA 3GU9A 3KBNA 3WEZA 4DZIA 3Q94A 2QCNA 4UTWA 1N63B 3LMZA 3P0XA 1ZAHA 4I9JA 1VBJA 1FWTA 3QXBA 3TP4A 2E5DA 5F4XA 3DAQA 2PA2A 4OVXA 4ERGA 3O0FA 4QXIA 2Z2BA 3RGTA 4X46A 1TA3A 2YA2A 1WAWA 3BANA 5D2VA 3PP7A 1K02A 1GOIA 2UY5A 2XVKA 2Y8UA 3WO1A 4Y6GA 3H26A 2OVLA 4LEFA 1QHPA 4KRTA 3MMWA 3VIIA 4LF2A 1GJWA 3U9IA 1W1PA 4NAFB 5AHFA 1M9HA 3V4BA 3OOQA 4WHBA 2Q6ZA 3GZAA 1NJJA 3CUFA 2REQB 1G69A 1D8WA 5A6TC 3RJYA 3HBLA 4UTIA 2VEFA 4D1IA 4G9PA 5AKQA 1E1FA 3L2LA 5HBFA 1ISXA 1C8YA 5AYZA 4PBEA 1EC9A 4JN8A 4FIQA 3DUGA 3VKBA 1JCNA 3B4UA 4ZB0A 3I4EA 3QQ0A 1KCXA 4WFBJ 3WQ4A 1YI2H 3T9PA 3T0TA 2P3EA 1I2QA 3OU8A 4PUJA 3BCFA 4WQ6A 2OYLA 3HO8A 5DY3A 1QNPA 3AYSA 3GK0A 1LRTA 1TZ9A 4DJFC 3RXZA 3HFTA 1N7KA 2CHNA 1H63A 2G8ZA 4R7JA 2DJLA 2PUZA 1J01A 3DKLA 2P53A 3LD5A 1J0KA 5TIMA 4GKTA 4DYEA 3WDRA 5BOFA 4GKLA 3M44A 2YL5A 1LT7A 3EDKA 2GSHA 1I45A 2WMIB 4DAFA 1W3KA 3W38A 1RY8A 3BMWA 5G1YA 3ES7A 2DORA 2QJHA 2QZRA 2JF7A 2H9AB 3TR2A 1TX2A 3N2MA 2D20A 4QISA 3MP4A 4WCEJ 4CGTA 1BYDA 1KQYA 4GNKB 2E6AA 1BHGA 1E6SM 1A5BA 1H7XA 3L0KA 5D04C 2EJ1A 3HPSA 3WUFA 4M1BA 1MMFA 2J74A 2KX9A 4ZVJA 2DU2A 2Y8KA 2BY2A 2IKJA 3L5MA 4JFUA 1XYLA 1S5TA 1EXPA 1PS9A 5DRCA 4TX6A 4MPQA 1POKA 4XAFA 3PS7A 1JFXA 3TSBA 2XG9A 2C1HA 4UQEA 3WK3A 1Q4WA 4Z2KA 3C56A 4QIUA 2VFGA 3SN4A 4AH7A 2QDEA 3HF3A 1JNDA 3CF5J 1UA7A 1TTPA 3QLDA 2YL8A 5EFDA 4PEKA 1JVNA 2XN2A 2YDRA 3W28A 2PRHA 1P48A 3ALGA 4GCXA 3TCSA 3SIZA 1JCJA 3NPUA 1GVOA 4HSHA 3GVQA 3W75A 1KFCA 3SCVA 1OFDA 5A6BA 2ZADA 3W81A 2WB5A 4KCWA 4Q6JA 4MWAB 3O06A 4GJJA 3ARSA 2AMXA 1IHIA 1Z8AA 2QUNA 1EWDA 3DERA 3G1YA 5CJ5A 2D69A 1IWAA 1YXYA 4O50A 3H7UA 4DRSA 2E40A 3AXKA 3HFYA 1KB3A 4HN4A 3CHDA 3IANA 4ZL1A 1Z6KA 4EAFA 5M03A 1IEQA 4MDPA 1FFUB 2XIOA 3TN5A 2CLPA 1B30A 3VZZA 3N29A 1ZNNA 3SUUA 4F0MA 3UWZA 2ZA2A 5CAKA 1FWDC 3FYPA 2ODOA 4C91A 3CC4H 4Z1DA 1UR9A 5U4NA 2B0MA 3BW3A 4RDZA 5TAOA 5AHEA 2Z29A 1TUXA 3O15A 1R6WA 1VCVA 1LBLA 1Z7AA 3R79A 1TPEA 3T40A 1MDLA 3MB9A 1ADOA 3VNYA 3EMZA 3WQFA 2C91A 3VM7A 3RX3A 3RN6A 2CKRA 2VJXA 3IJQA 1NOFA 2QMJA 4DBEA 3S47A 3W7IA 3TFCA 3CLWA 2EF9A 3WQWA 3ZOAA 3TONA 4QLJA 2B7PA 1XIGA 3UWEA 5I3GA 5KSWA 3N34A 3W01A 1EJTC 4A8RA 3M4HA 1R87A 4PBFA 4PMJA 3K46A 5A2BA 1P7TB 2IXUA 1BGGA 4NX5A 2VFDA 3P14A 1ZENA 1U1HA 2WNQA 3AC0A 3QR3A 1OADA 1YRRA 3BJTA 3BGGA 4W84A 1K3UA 3LMYA 3FXYA 4EACA 4P7NA 2XVPA 2E8ZA 1T99A 3W7NA 1XFCA 1POJA 4TVDA 3QTPA 3H2FA 3L9CA 3W84A 4XD6A 2D23A 3GVGA 3CH9A 5D9OA 1S5WA 1LBFA 2O9TA 3L2MA 2NVCA 3R5EA 5I7GA 3DLLJ 1UCWA 2YB4A 4LUSB 2PWEA 1YITH 2NQLA 1SO4A 3QY8A 2BY1A 3CUZA 1S3TC 4H2HA 3W83A 4BQ2A 5HWNA 2A3AA 4DJEA 4AMAA 3R0DA 4HPGA 2ZZ7A 3GC4A 4WEVX 3TW6A 2FTYA 3CL6A 1U1UA 4JTUA 3MHFA 2Z00A 3W26A 1P5BA 2BODX 2EPNA 2AKMA 2GDVA 5FOOA 3FN9A 3WNLA 1YMYA 2TMDA 1AQHA 1JAKA 2GQ9A 3KRSA 2WHKA 2CC0A 3R43A 3HJZA 3NSXA 3WLQA 3LK6A 3V7PA 5J8LA 3USZA 3CK5A 4PL2A 2NVDA 4RZ6A 3BWWA 1OQFA 5FKYA 2BOFX 5EMJA 2VC7A 4MUZA 1Q85A 3CCEH 2BGSA 2WBGA 3ITCA 3THCA 1A0CA 1FFRA 4ZOBA 4Y8EA 4PCTA 4N6FA 4GY0A 3UP8A 4LEQA 3A9IA 3K1GA 3RLUA 1BRWA 4L5ZA 3FXGA 1WOAA 3QC0A 3W1RA 2AQWA 3HMCA 4Q32A 1DWHM 3O1NA 3TDFA 4D71A 1Q45A 2PRMA 4AP8A 2QF8A 2E9LA 1Y5WA 4C7YA 3K8KA 2J24A 3M7WA 1JYXA 4D6CA 3CPRA 1Z44A 1JJKA 3BLOA 4FIRA 2YL6A 4YHEA 3FA3A 4AF0A 3MY9A 4R7OA 3O0KA 2JIEA 3NPXA 2OOFA 4PTNA 2HPIA 1K4GA 5LA1A 2NWRA 1X1ZA 2V5JA 1ZBVA 4IMEA 4RNHA 3V16A 1YPFA 1UIPA 1N62B 1G1YA 2GDQA 3KUMA 3VZYA 4KRZA 2D0HA 2W27A 2G3JA 5TBOA 4XIMA 3N4FA 4URIA 2EGZA 1EC7A 2GJRA 3B8UA 1KBKA 4FNRA 4DELA 1GVRA 4QJ5B 3SO7A 2CYGA 2V5BA 4AZ7A 2Q3OA 1XLLA 3QZ6A 4J3XA 4GYJA 1LROA 3AXXA 2QQ6A 2Q01A 2W6RA 1XRTA 1EBGA 1CNVA 3APTA 1MRAA 3W23A 2JEPA 3SW6A 4YYYA 3N9RA 2FZBA 2Z6JA 4ZFMA 4QDMA 4IMCA 1AW5A 1MUWA 3TJXA 3NURA 3GW0A 2ISFA 4JDYA 2D0GA 4PUDA 3NQMA 3MP5A 1XBVA 2MANA 4WVXA 4ZEPA 5K4XA 4WFNJ 5JQ9A 1FWNA 4D6GA 1VFSA 1WZMA 1RV8A 4L1WA 5EMUA 1F2JA 6XIAA 1XLFA 2I14A 1AD1A 2NQHA 2ZVIA 3STEA 3E0IA 1C7TA 1VFTA 1JQVA 3WEOA 3ZSTA 4XKMA 5CSYA 2CNCA 1G0CA 5BROA 3R0KA 3ZYZA 1TR1A 5HWJA 3B0VC 3NQVA 3CWNA 3EWUA 3SN1A 2DZPA 3QYSA 2PCEA 4J7RA 4PMZA 1BKHA 2CLFA 4D72A 2WSPA 3I3EA 1FHDA 4YWSA 1G4PA 3PPCA 2FZ8A 1VQ6H 4FNQA 3KOZA 5G2WA 2FHCA 4NRRA 4DEFA 3KTCA 4YL2A 3R8HA 2Q3RA 2YZ5A 1E0WA 1GVYA 4HK7A 1RCOB 2R14A 1T7LA 4BI7A 3NQEA 3AU2A 4CVUA 1VCFA 1HL9A 3KHDA 3B05A 4FOJA 3ERPA 2WC3A 2XVGA 1DL3A 2J7BA 1HO1A 3WNZA 1H62A 5C54A 1N8IA 1K8YA 1UP2A 4OBSA 1PKYA 2DP3A 3F4WA 4MLJA 4NQ1A 3EDEA 2CCRA 1DQWA 1NWRA 2DSWA 3OW1A 1DHPA 3C86A 5LIXX 2BXZA 5GADN 4JEQA 3REQA 3TYBA 4IHCA 1JDAA 4GJ1A 4JYEA 3H23A 1OSEA 2R9RA 3O2LA 2YKKA 1V0MA 1CGWA 1HXJA 1O1HA 2PU1A 4FP1A 4PZVA 3XINA 4HYWA 1U1JA 2J62A 3QH2A 2UV8G 4MPKA 4ZXLA 2GJXB 4X22A 1XCFA 5BRPA 3AN1A 4G1NA 1I2OA 2ZUUA 5D8ZA 1D3HA 2GWGA 1PIFA 1QWGA 2QVNA 3YPIA 1GQNA 3IJDA 1N61B 3DOPA 2ACSA 3UCQA 3UJ2A 3CD6H 4TUFA 3U2ZA 3H53A 5JXQA 1YDYA 3PNUA 1BF2A 4NXKA 1QI4A 1V3HA 1UD4A 1UKSA 1KA9F 3LRLA 4XZHA 2I5IA 2PI6A 3NZQA 3MQTA 1E73M 2X40A 1B54A 2GDUA 5DCEA 2QCDA 2I9UA 3ABSA 2CLKA 3BMVA 3MUY1 1F7BA 2DZSA 2W0UA 3A4JA 4ZO6A 4JY8A 4WSHA 2BHYA 2J9ZA 1FWAC 2VRJA 3HZ3A 3VX1A 1CB7B 3RYSA 1P4CA 2RGMA 4BQ4A 4AZHA 1KM2A 3ZJKA 3WQ6A 2I7GA 4F9DA 3B9EA 3LTSA 2NXIA 4E8CA 4W86A 3GFZA 1SPQA 1O5XA 1U5JA 4Y7EA 1VC4A 1DV7A 3NZRA 1SJCA 1V7YA 3OYZA 1E6RA 1KM3A 3ETRC 1JRBA 3P74A 1G9HA 2C0HA 3W76A 1WZLA 1KCKA 5BU9A 5IXEA 2WK2A 1XLBA 3B8VA 4QCEA 3IGUA 4CQ8A 4TVUA 4JQ4A 4Y8FA 4KH2A 3S5ZA 1YBQB 3DI1A 3PK7A 5IHSA 4QJ1A 2Z28A 1B2YA 1OM0A 2ADAA 1M5WA 4OHQA 1RBAA 3TXZA 2A6NA 4ZB5A 4A8LA 3G6MA 2ZZ6A 5LNVA 2YDSA 2A3BA 4PTVA 2JIWA 3WFLA 3PZNA 4DIAA 3BQ5A 3W2LA 1GKPA 4V33A 1V51A 2Z1BA 1J10A 5IM51 1HFBA 4E8GA 3JW7A 4I6VA 2Y89A 1W1A1 5IBXC 3D47A 1DJXA 4R5EA 4DX3A 3W02A 4US9A 1RJPA 3F03K 1O12A 4HZ6A 3CCUH 1FWJC 1JPHA 3EZ4A 3S9YA 2FPTA 4TXEA 2XFWA 2VC6A 2PWGA 4EF9A 1BGAA 3H2CA 4MSSA 1W8GA 3KRBA 1VAHA 3GNPA 3GVVA 1IWBA 4N0RA 3W22A 3F7JA 1NDWA 3WLPA 5CXPA 3P5ZA 4L7ZA 4J3ZA 1HT6A 1W5PA 2WW5A 3W7MA 4RCXA 1VBHA 3LM3A 3KLLA 4UTLA 4C6DA 4GYKA 3MKVA 4CD7A 2DVXA 3G1HA 8XIMA 2PZNA 4W8AA 3L5AA 1TUFA 1E15A 1WDSA 3N19B 4L1XA 2R8WA 3W00A 1IF2A 1V8EA 2WKGA 3WF3A 1DBTA 1ADSA 2HS6A 3G6EH 3LLXA 4B3KA 1QK2A 3CQKA 4MJZA 4KEZA 4QLKA 2FFCA 1L6FA 1R30A 4O19A 2PB1A 3VCRA 4J2PA 1ZS2A 2H90A 3VIHA 2ZZ4A 1S38A 1J6PA 1CIUA 1LYXA 4LGXA 1E56A 2DZBA 3ME3A 4ZQCA 3LRKA 3FHQA 5FF3A 1N82A 3KVKA 2DT1A 1XD0A 4JIRA 3QRHA 3JZUA 3V3WA 3VIMA 1TX0A 4H2CA 3EEZA 4IICA 1E1EA 4M6PA 2CESA 1TA3B 2WWCA 3W2KA 1MUMA 2DVTA 4BF5A 3UXKA 4HIBA 1TPUA 1BD0A 1KRBC 1F9CA 4JQ3A 1P6CA 1CW2A 2OO0A 3II1A 3HG2A 3UCCA 1Z41A 4Q4OA 3E2SA 3A6OA 2GJNA 3QN3A 1KV5A 3IEBA 5DT7A 4TIMA 3BGAA 2CZFA 4FR1A 3VVGA 4IP4A 1FH7A 4MOZA 4MWAE 1QW8A 1I75A 3C2EA 3T4WA 1U83A 1EWEA 2QXWA 5I3FA 3VGGA 3CMJA 1UD5A 4DNMA 1VFHA 4JZ5A 3PZOA 5D9PA 3FHAA 3U0HA 4JKLA 4GZJA 4RW3A 4DPQA 4GZIA 4H6RA 2QPUA 1WKYA 2CLOA 3QQ1A 3DFSA 1UWQA 4H9TA 4GYPA 1GQJA 1PX4A 4D6JA 4Q8OA 1UKQA 4JFVA 1BQCA 3TQVA 3ITTA 1JCXA 1K4HA 3VZXA 3CCJH 1VQKH 4ZO8A 3WJYA 1OCNA 3PY2A 4M5PA 3WBAA 4AU0A 1BWKA 3EX2A 4DHGA 2Y2WA 1LLZA 4GG9A 1OD0A 3ONCA 5FF4A 5G4HC 4UIOA 2QS8A 2EO7A 2VOMA 4S3AA 4H9XA 4FZIA 3VINA 4AX7A 3EOOA 4ZZ9A 3EPOA 3VNDA 1VBGA 2AGTA 4S1FA 2ISWA 4C60A 3OVRA 1PKNA 2WHMA 3N4AA 1VEPA 3GXDA 4US5D 2D2HA 4HOWA 1V3LA 1QJWA 5KZ6A 4HMNA 1B3OA 4LSBA 3BLDA 2PBOA 1VQ7H 2ZICA 3WL0A 3ZWSA 1QVBA 3R89A 2QDGA 1DTUA 5C6MA 1V02E 1QPKA 2J7HA 2O4MA 3UT0A 1W54A 1XIEA 3GDMA 1PSCA 3JU2A 1M41A 4IQJA 3WLNA 3AHXA 5FEWA 4TQTA 2FFIA 5M3WA 4O4WA 1OF6A 5CJNA 1MEHA 3KE0A 1GZJA 3V0TA 3FOKA 3G1SA 2Q71A 1KGWA 3IJ9A 4NKCA 1YJNH 2XN0A 2WZEA 2CLIA 2OMDA 5DMNA 4GBDA 4ALDA 1DGJA 4PODA 1ODUA 1VQ9H 3VNMA 3CTLA 5J04A 3GO2A 4F3HA 1W31A 3VDCA 4KIEA 5D2TA 4ZB2A 4LBRA 1HL2A 2A85A 5I3HA 1XBYA 5KMYA 3G4SH 3DG7A 3PZTA 3GFXA 4OWGA 4P8XA 1JYVA 4PMYA 3HV8A 1VP5A 3DFQA 4E2BA 2CFFA 3CWHA 5XIMA 4IP7A 4XAPA 4K1WA 1M01A 1PDYA 4AW7A 4AZCA 1EA9C 1GQLA 1AH4A 5JBDA 4V27A 5LHFA 3CHFA 2OODA 3WQEA 3WZ0E 1JDEA 1QW9A 2HVMA 3TR9A 3SM0A 3WH9A 1MNZA 1CZ1A 5D33A 3S1XA 3AMZA 4MAVA 4DJEC 1FXQA 1WKDA 3V5CA 2FGLA 1GOKA 1THFD 4O0KA 2GGGA 3DN5A 4W88A 3VA8A 3KOYA 3VNIA 3RO8A 5ABHA 3CYVA 4TMBA 1TB3A 4CQ9A 3IWPA 3KVJA 4ZODA 3PBVA 1CWYA 4EPDC 3PVFA 2GL5A 1W6TA 4KWUA 1G4TA 5M17A 4Y96A 1VLWA 1ZPTA 1GYLA 1J0ZA 3DIPA 2HVOA 4UNKA 4DXKA 4U67J 2RJGA 2PDYA 2X0YA 1DJQA 3R25A 4MHBA 4QQUA 1EB3A 1QWKA 4AISA 1EZ2A 4DZHA 3NOYA 1EJUC 2WLZA 3VAVA 3FVDA 1G6CA 1OFQA 2A0NA 3IGHX 3KP0A 1F8MA 1T8QA 2VX4A 3PWGA 1GVIA 3TYEA 1XH0A 2GGHA 2XIMA 2EAWA 4AEEA 1GUVA 4JGDA 2DZVA 1FDJA 2VC9A 1WZKA 1TMQA 2IQTA 3AJ7A 3DESA 2FH6A 1OFRA 3PWAA 3CCVH 4AXKA 4OZOA 4EP8C 2OELA 3URBA 3KCJA 5D38A 1V6UA 1ZY9A 5A6JA 3PUEA 1W0MA 4H00A 1KXHA 5CEWA 3WKZA 4DXXA 2P8CA 1WE5A 2VC5A 4IPIA 2OYKA 5FCZA 1YNQA 4Q8PA 3HURA 4HD5A 2IPWA 2NX9A 4PMDA 2VX6A 5FJOA 5CZSA 1U5HA 2OX4A 2DSJA 2TODA 4LVGA 1EDTA 4DM2A 3SURA 4E3TA 2I56A 3LX9A 3NIYA 3WLTA 5E93A 5LA0A 2PBGA 1PDZA 1JDCA 1T0OA 4FLRA 3FVMA 2QPSA 1YDOA 1N8WA 4IOCJ 1G01A 3GR4A 3TW9A 4DUWA 2BDQA 3N9SA 3WLKX 3S6DA 1QFEA 3RNDA 1HF6A 1JYNA 2IXVA 4WR3A 3H54A 4MNLA 4AWUA 3LB0A 1DWIM 3CMAH 4D6FA 5LKYA 5KZEA 4HNCA 2X1SA 3QV7A 5G1MA 5H91A 2VHLA 1OGGA 1E5NA 3GG1A 4Q6XA 4Q8QA 4W85A 3D3AA 2Y8VA 3FDGA 3B9NA 4JFWA 1W5QA 3CXCH 1LWIA 6REQB 3NS1C 3N1AA 2D73A 4ADUA 1SQ7A 3LCIA 1W9BM 4I5XA 1NWUA 1V3IA 2TSYA 4MFDA 1OD8A 4QR6A 2J75A 3FKKA 4K39A 5IFPA 4UR7A 1J2WA 3WH7A 3CIVA 1SFLA 3WLHA 2HBVA 4JTTA 1GYMA 1AQMA 4N4QA 2ATSA 2DVUA 1W56A 4WDXA 4MZ1A 3CCQH 1R3QA 2SFPA 3VNZA 2DQWA 4KFOA 1EJ7L 2ZCGA 2EBNA 2O7SA 1HVQA 1RUSA 5DM7J 3UF9A 3IV8A 3WNOA 1B31A 3ZLGA 1H7RA 4AY1A 3TH6A 4BWLA 3N73A 4LB3A 3RHGA 4JIPA 1ADDA 3BH4A 1V4YA 3AZTA 1SYTA 3NQDA 1H1NA 5I3KA 5JVGJ 3WLLA 1KO0A 2PGWA 4AWTA 3DHFA 1NOUA 4MM1A 3OODA 1R3TA 3SY1A 3A24A 3W07A 4CEXC 1OCBA 4UFJA 3PJXA 4M3PA 1FVPA 3SGGA 1SFSA 3GNNA 4GXMA 3DYMA 3MA8A 1HIZA 5D02A 4HNTA 3FIGA 1VPXA 4JIIX 3PZQA 4MJ2A 3EUB4 3FKRA 1WOBA 4A3HA 4DJFD 3OP2A 3NL3A 2V0TA 3UJRA 4A3UA 4DF0A 3CTTA 1F74A 4LBUA 3ZJ7A 1A47A 3M0XA 4KF1A 1XX1A 4B4HA 2J7CA 3HMJG 4IM4A 1QO5A 5E9AA 3N3TA 2C18A 2BXYA 3G1XA 4RXGA 4ZBCA 3R10A 2V3GA 1VJIA 4IPLA 3CZGA 2OSYA 3EA1A 2ON3A 1O5RA 1XV8A 3UWUA 1UZDA 3PG9A 3VABA 3R94A 3UXAA 2PWHA 3OZPA 4PRTA 3G0UA 3MMDA 1I2PA 3WH6A 1JR1A 4UZUA 4UTMA 3GRIA 1TWDA 9XIAA 3E38A 2XTKA 3RPTA 2DZUA 1ZALA 5AC4A 3P80A 4IGMA 3D3FA 3IJ7A 3CJPA 4AVNA 3ALFA 3N2XA 4PB5A 5CGTA 4ZTXA 1F3WA 1XIDA 2QCEA 1XG4A 2A3HA 1MZHA 3KTXA 4AD1A 3D6NA 2E6YA 2VUNA 3QFEA 1XHGA 4A3YA 2C79A 4B5TA 1BYBA 4NZJA 3GH7A 2P76A 1VH7A 1MXGA 3P2VA 2AGKA 5AVHA 4DO4A 1P0BA 1ZTVA 3KL3A 3TV8A 1RD6A 1YDVA 4PE8A 5D9NA 5ENLA 1OFAA 4DZAA 2PTXA 3M6DA 2XWDA 4GO8A 5LIYX 4E4PA 3PWIA 3S9ZA 1X7FA 3EB2A 4LQ1A 2EQDA 1BTMA 3UERA 1KXQA 1V5XA 3N9KA 1GHSA 5G2HA 2X42A 1GYNA 4MVAA 3LI0A 5LNSA 3LQLA 2I57A 1Q6QA 1FHUA 1OFPA 3C2YA 2RKXA 3PM6A 4D1JA 2VWTA 3I7SA 1XBZA 3UG4A 4WD0A 1AJZA 4NASA 1JCMP 4OBTA 2ANUA 2A79A 1QT1A 3MSDA 2FHFA 2V38A 4GQGA 4YN5A 4HSNA 3S6OA 1BVNP 1JG9A 1X39A 3S2LA 4O1AA 3UESA 3W70A 2OT1A 2PDFA 3WYZA 4DLMA 1UC4A 3MJYA 3WNKA 1EJWC 1V6YA 2V5DA 1KTNA 3AWOA 1SZGA 2GVEA 1K8CA 2OWXA 2VELA 3HG3A 5HDRA 1YEYA 4PMVA 4Q8WA 3GQYA 1DYSA 1A5OC 1HW6A 2P0OA 3C4UA 3QYQA 4M6UA 2XH4A 4V2XA 3EXTA 1EYWA 3QSRA 4PN2A 2DGAA 4JIQA 2HJPA 3SADA 4LB4A 3M64A 4PUKA 2QGYA 4NSBA 3W24A 3LHUA 4HOZA 3LGDA 5I09A 4KWWA 1FWHC 1WXZA 3BJSA 4PL1A 1PUDA 5IDZA 4X9YA 4POCA 3NQ6A 2BX7A 3BAYA 1REQA 1US2A 3LHVA 4JN7A 2UWFA 5F1VA 2GWNA 5AOUA 4WGHA 3WQCA 4JL1A 1C3FA 4B5WA 2AQVA 4LNYA 2RDWA 2W61A 1CT5A 3QKEA 3W2JA 3ZZ1A 1YE6A 1ZZMA 4U2YA 2FPVA 1ME9A 3A23A 2POZA 3IJIA 2YW4A 2D1ZA 3B0PA 3DXIA 1KR0A 5AN9F 1EXBA 1B4KA 2FZDA 4Z2GA 4LUTA 4CN6A 1TG7A 3WO0A 1FH9A 3A4XA 2Z4GA 4XTDA 2EJAA 4WJXA 1CLKA 4IMFA 3QKZA 3O7UA 1TIWA 4DI8A 3B8TA 3V18A 3AROA 4X3ZA 2ZXQA 5BZAA 1F05A 2NVAA 4GVIA 4LVBA 2WVVB 1MW3A 2DZWA 4PSPA 4GX8A 1N5XA 3BJFA 1A80A 1AA1B 4A3QA 4AY8A 3NXFA 3QGAC 4JTJA 1XIFA 1U22A 3MHGA 1UP0A 3OZMA 4DB7A 3LBCA 2G5WA 3W27A 1QU4A 2CLMA 1PL9A 3UCDA 2PTYA 1VFOA 3I4KA 1UOUA 1IQ8A 1UASA 1JUKA 2ACUA 1PZ1A 1FKXA 2FQIA 2VZSA 3G77A 3GG8A 2PS2A 1GOQA 2E8YA 1SJDA 3RUBL 2WK5A 2BTMA 1T5AA 2XVLA 3EWBX 4H04A 2HDJA 1JCYA 2YB1A 3GTXA 3M0KA 2X30A 4Z2HA 5EMKA 4KKXA 1VEOA 3WMBA 3N11A 4YVXA 3EB3A 1WUFA 4ATWA 3CZKA 3NA8A 1OK4A 4RNIA 1IEIA 1PKLA 4LS2A 5C0QA 3IV3A 1K9DA 2Z27A 4UQCA 3STPA 2YBUA 1HVXA 3UGRA 2W92A 1TPB1 4MFEA 1A5UA 3RILA 5L6UA 4EPKA 3MV11 1OK6A 2EG7A 2EXOA 5MKGA 1US0A 4S3EA 3K1DA 4XD5A 2PP0A 2X41A 3M1ZA 3I6RA 4J5NA 3SCUA 4UCGA 3CUIA 3O6AA 2DT2A 1V08A 3K30A 4O12A 3W2UA 4IMDA 1VJZA 3NPVA 3VGDA 1WA3A 3KLKA 1JF5A 2FZNA 4GYPC 2DQXA 3LZ5A 5ABFB 3E0VA 2PTZA 1A50A 3CUJA 3K8LA 1PWLA 4NYYA 1GEHA 1PZ3A 4IO9J 3AI0A 1BF6A 3WUGA 4N9BA 3O9NA 4NAFA 3ARWA 4I9TA 2ZBTA 4GC4A 2REQA 4HMEA 4DXVA 4A3RA 3CB3A 5I78A 3I7QA 2INZA 1FWRA 1X38A 1QK0A 3NNTA 1QTWA 5BNKA 3UZYA 2Y70A 2FJUB 1OFEA 3AU6A 3KWXA 3CCMH 3T0AA 2QAPA 3FJLA 2DT3A 5EPDA 1RQEA 1B3YA 3U5UA 3AS1A 1UOZA 3MUCA 4HHLA 3IIZA 3CZJA 1E6QM 2EKGA 4IGNA 2OXNA 1MNSA 2PC4A 3ZR4A 3GZ3A 3U2OA 3TX9A 5CJMA 3DC0A 1MW0A 1KBBA 1PIGA 3E1F1 4CU8A 1ZBCA 3CEPA 4F0KA 2VUYA 4MKSA 1NFGA 5CPOA 2X8RA 4J3TA 2HMCA 1EO5A 1UPMB 1WX0A 4ZSTA 2WMIA 4Z17A 3N6QA 3VX0A 1CGTA 1E5JA 1IT7A 4U28A 4NVTA 3APGA 4FA3A 4Q4KA 1UB3A 4DF2A 3T09A 2H9AA 1GOWA 1MFUA 2NUYA 3F1QA 1GVQA 1W9VA 3EOUA 3JZEA 4UBPC 4OQVA 1YHTA 3CC1A 4LUIA 2H3BA 3W71A 1I6NA 3T6CA 2EPHA 4PRRA 5EY3A 3PZUA 4GH3A 5CLTA 3WF2A 3CNYA 4FS9A 4ZSUA 1TRIA 4LUJA 1GHRA 2GSEA 3W87A 1EFZA 1OT2A 3UPWA 1ONEA 5D2XA 5MLCO 2IPJA 2ALRA 1MZRA 2J8TA 1L6SA 5DBUA 4RV8A 1XM3A 2CWXA 4TO8A 2WZIA 4LW7A 5JUVA 1UR3M 3H2OA 3RPDA 2A1YA 2X16A 4HU0A 3IUIA 4TX8A 3G1VA 3N14A 3C0SA 3GIYA 3GTHA 4HMCA 2C14A 3RX4A 2A3CA 3L4VA 1X7IA 4FO4A 1XINA 4H9UA 1ONXA 3T55A 3V1PA 5BOEA 1BVZA 3EWWA 4JY9A 2JK2A 4HCLA 4PRWA 3A12A 3TTYA 3UG3A 2PLMA 1EPXA 4LC8A 3HM7A 3ES8A 3ABOA 2NT0A 1NVMA 4HZMA 1SIJA 5BOOA 1VIWA 1WB0A 1XISA 3LCHA <