5HUOA

Crystal structure of nadc deletion mutant in c2221 space group
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
283
structure length
283
Chain Sequence
TDLTPFQIDDTLKAALREDVHSEDYSTNAIFDHHGQAKVSLFAKEAGVLAGLTVFQRVFTLFDEVTFQNPHQFKDGDRLTSGDLVLEIIGSVRSLLTCERVALNFLQHLSGIASMTAAYVEALGDDRIKVFDTRKTTPNLRLFEKYAVRVGGGYNHRFNLSDAIMLKDNHIAAVGSVQKAIAQARAYAPFVKMVEVEVESLAAAEEAAAAGVDIIMLDNMSLEQIEQAITLIAGRSRIECSGNIDMTTISRFRGLAIDYVSSGSLTHSAKSLDFSMKGLTYLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Streptococcus pyogenes quinolinate-salvage pathway-structural and functional studies of quinolinate phosphoribosyl transferase and NH3 -dependent NAD(+) synthetase.
pubmed doi rcsb
source organism Streptococcus pyogenes ga06023
molecule tags Transferase
molecule keywords Nicotinate-nucleotide diphosphorylase (Carboxylating)
total genus 90
structure length 283
sequence length 283
chains with identical sequence B, C, E, F, H
ec nomenclature ec 2.4.2.19: Nicotinate-nucleotide diphosphorylase (carboxylating).
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01729 QRPTase_C Quinolinate phosphoribosyl transferase, C-terminal domain
A PF02749 QRPTase_N Quinolinate phosphoribosyl transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5huoA02
3.90.1170.20 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Quinolinate phosphoribosyl transferase, N-terminal domain 5huoA01
2GVJA 1DJQA 3NL6A 3UQNA 2RH9A 3EX4A 2V81A 3NQEA 1JULA 5HWNA 3E9AA 1LBLA 4ORMA 3LTSA 3UWVA 4BF9A 3LHUA 4IMDA 3FKRA 1GOXA 3S1XA 4AHOA 2HMCA 1FWNA 5AC7A 3P81A 3SIZA 1KFJA 1W5QA 2X1RA 3CEPA 4RKAA 5CSSA 1YADA 3B03A 3MW7A 4DF2A 3MHGA 4O57A 3NZ1A 3STEA 3O06A 2Y88A 2ZYFA 3F03K 3TW6A 2C6QA 3EX6A 2YPIA 2E68A 3HBLA 3F4WA 3WJXA 1W31A 2PC4A 3CM4A 1FWTA 1OYAA 1TV8A 3ZS4A 2EHHA 3FS2A 1R2SA 3TIMA 4LU0A 1XXXA 4OHQA 1EUNA 3DZ1A 3R13A 5DCDA 1N55A 3LCFA 1WAUA 1XL9A 8TIMA 3C2FA 5DXYA 3D0CA 4IUOA 3ZFHA 4XWUA 3NM1A 4RV8A 1MO0A 5F1UA 4DELA 3P5ZA 1VLWA 5FF4A 5E1QA 1LYXA 4O4VA 4I9AA 3VFLA 3W7DA 3P8JA 1A5CA 5IBXA 3L68A 4XQ6A 4PCFA 3KVKA 1GG1A 3W1TA 2XN0A 3NM3A 3PUOA 4O13A 4WY0A 1KA9F 4GNJA 3G0SA 3QYQA 4IMCA 3NQGA 4UR7A 1VYRA 3TX9A 2GVGA 3W7QA 2EPHA 2ZQ0A 2V82A 1LCOA 4X2RA 1J5TA 1JCXA 5G2IA 1DOSA 4N02A 3RMJA 2YGYA 3PG8A 1JCJA 5EA9A 4Z08A 2ZTJA 2FB3A 3ATZA 1XDMA 1FX6A 2WJZA 3W7JA 4AWSA 3W07A 1JCNA 4HKPA 3U8GA 1SO5A 3BK0A 1H7WA 1TO3A 5AHFA 1J4EA 3G8RA 2I1OA 3W7EA 2A7RA 5CPOA 3MP3A 4HIBA 1NAL1 3H54A 4MY9A 2CZEA 1RVGA 1TTIA 5A8GA 3RFAA 2X30A 3WFAA 1YDNA 1G7VA 3GKFA 4LT9A 3SR7A 1QCWA 1VRDA 1VCFA 2CLLA 4HN4A 3CWNA 1IF2A 3M16A 1G4EA 4X3ZA 1WYIA 3OVRA 4Z1CA 4WY0F 2GQ9A 4TMBA 4UFMA 5KITA 1G6CA 1JUEA 1NF7A 2ZA1A 2DP3A 4R33A 3W7MA 5D32A 5KTLA 1T0OA 4XKYA 4LW7A 2ZBTA 1ME8A 1GQNA 1LOSA 1OG0A 1H63A 3LCIA 5CZTA 4Z1AA 2ZRZA 3HMJG 2R94A 3P82A 3TAOA 3QC3A 2E6DA 4QQ3A 3PULA 3MI2A 3PBVA 4N2YA 5FF0A 2J27A 3RF9A 5G2HA 4HPJA 4NNCA 5DELA 1F6PA 3STCA 1SSDA 4BFAA 4OQVA 4XUGA 3FOKA 1SPQA 3BVJA 3EEGA 3WJZA 4N4QA 3SGUA 1R47A 1TIMA 4JTKA 4K7VA 4HNUA 2JGQA 2ZCGA 4N9EA 3GIYA 4HHPA 3M43A 3G3DA 1JUBA 3ANYA 3S5ZA 4K8HA 3W88A 4M7TA 1FDJA 1QWGA 3PB0A 1A5SA 2H8ZA 4OWGA 4JX6A 2E6AA 4A29A 2R8WA 1C8VA 3EWZA 1LTDA 4MZYA 3TR2A 4ALDA 2O7SA 2I14A 3PVFA 1LRNA 3DU0A 2F7FA 3W76A 3FLUA 5EBUA 5LNSA 4YXGA 3THQA 3T78A 1LRQA 2NXGA 2VEMA 3WK3A 3C2VA 1AW2A 1FDZA 3C52A 2WSYA 1WDWA 4MFDA 3CPRA 1O94A 2BTMA 1YTKA 3PR2A 2Q8LA 3GR8A 3LHYA 4NJHA 2ABAA 3QEZA 2NX1A 4ZMGA 1ZCOA 3WJYA 2DZTA 3LHZA 4MIMA 1OK6A 3BW3A 4PEKA 3TXVA 1KM4A 1GPWA 3AJXA 3LXBA 5K2ZA 2CLKA 5LSMA 1YTDA 2VFFA 3SW6A 1OVDA 3GDRA 2EF9A 5D02A 4FNQA 2JKPA 1G69A 1KV5A 3QQ1A 5D2WA 1EIXA 2V9DA 1OF8A 3W70A 1VHCA 4FX7A 4FNSA 5BRBA 3GK0A 3QQ0A 1FCUA 5HULA 2ZRWA 5EL1A 4Y96A 2NLIA 3BW2A 3M5VA 1QR7A 1KTNA 3LHVA 2ZDRA 4Y6GA 3WK2A 3HGRA 1W8SA 3LTYA 4JXCA 3KAOA 1JRBA 2ZZ2A 1GTHA 1F05A 3IV3A 3T44A 1KV8A 1LP6A 1S5VA 4UMAA 1VJIA 1KFBA 4MPQA 2VENA 4NNBA 2NUYA 2Z6IA 3CIWA 4DBEA 3M41A 1LRTA 1ZFJA 1FCVA 5CZSA 5KMYA 1V5XA 3EX3A 1I2RA 3C0JA 4AF0B 1GVSA 2NWSA 2H3DA 3H55A 5L9FA 4O53A 3L5LA 1KM5A 4GJ1A 3W1XA 2RHGA 2A85A 3STGA 2A7NA 2QF7A 3M6YA 1AW1A 4MZ1A 4BI6A 3L2IA 3TSDA 1KM2A 3KFTA 4EOUA 1X7FA 1VS1A 1YYAA 4DQWA 2Z1BA 1OFOA 4RCXA 1GTEA 2A6NA 4LVDA 3IGSA 1YXYA 1KM3A 1LOQA 1DHPA 5G1TA 4AHPA 3NQ7A 3G1DA 5D04C 4O0ZA 1MXSA 3F1QA 3M7WA 3W2KA 5K7JA 3H53A 3LXAA 4LVGA 3L21A 4BWLC 4O0KA 4X9SA 4O10A 1AMKA 5F2IA 1S5WA 5CPLA 4AWTA 1F76A 3I7RA 3KHJA 3PUDA 1I45A 1PCKA 1Y0EA 2X1TA 2B7OA 3PSWA 2YYTA 3C61A 4UXDA 5E0KA 5D2YA 2WQPA 1UJPA 3O63A 3KRUA 3PBYA 4HNNA 3NQCA 4K8EA 2OJPA 3B04A 3OA3A 2R14A 4GFSA 5DY2A 4TX9A 1H50A 1VHNA 3CWOX 2CLHA 1W37A 3FKKA 4E38A 4IX2A 3W85A 3AO0A 5EYWA 4N9DA 2QCLA 4ZL1A 2P1FA 1TPC1 3ABSA 3M0ZA 4O19A 3C2RA 2QDGA 1HG3A 3C6CA 1N8FA 2XN2A 1KM0A 2ZZ6A 1H60A 3S5NA 3L66A 3NPXA 2B4GA 2BX7A 3N9RA 3HGJA 2F84A 2ATSA 3P74A 3GXPA 2RFGA 3MP4A 4CCDA 2AQWA 1C29A 1NFBA 1XUZA 1KFEA 2QDHA 4FNUA 4UNKA 3KVMA 1G67A 4BWLA 4GUHA 5SWUA 4JIPA 3E49A 4HSNA 3G0UA 3ELFA 4N9CA 5DBUA 2JBMA 4HNVA 5K9XA 1YPIA 2YZRA 5AOUA 2QCNA 1FWWA 3C2EA 4IPJA 3GNDA 2GUUA 2CLFA 1SO6A 1WQ5A 3B0UX 4UC5A 2Y85A 1W5MA 5C55A 2HS8A 3PM6A 3GX9A 3DHDA 2DZUA 1DVJA 2VC6A 2FJKA 3FJ6A 3IIOA 5J5DA 3CHVA 3P62A 2FPTA 4FF7A 4R34A 1IGSA 3M9YA 4H6KA 5GVJA 2TMDA 1DKWA 2NZLA 3O6DA 1F6KA 4UTIA 1TQJA 1OHLA 1LLZA 4N6FA 4KFOA 1BKSA 1NF0A 2ALDA 4CCCA 3RK8A 2C0AA 4CCEA 3GAKA 4QAIA 3S0CA 4IMEA 3W23A 3LLFA 5G4WA 3UXAA 1VCVA 2J24A 1JVNA 3G24A 3NQFA 4EF8A 2C18A 2V30A 2E6FA 5AHNA 3YPIA 4PH6A 4LRSA 4K6AA 4JS3A 5AYYA 3VE7A 3N73A 2HTMA 4IMFA 5DY3A 1H7NA 3TAKA 1ZHAA 4XZ9A 1K03A 3TE9A 1KLYA 4JN6A 4RR4A 4UTKA 2RKXA 4IWWA 1OX4A 4RZ4A 4O1DA 4LS0A 1MEWA 2Y63A 3UZ5A 1N7KA 2QAPA 4WY0B 5BOOA 3WJWA 1QNVA 4LRTA 1JQXA 1YXDA 4LV9A 3B06A 4XTIA 1F2JA 1JUKA 3I7SA 2A6LA 4D2JA 3LDVA 1AG1O 1EB3A 1JRCA 1WV2A 1HL2A 2DZSA 4NZFA 5ABTA 1FY6A 5F1VA 2W6RA 1LZOA 2BXVA 4JYEA 1GT8A 1FWRA 3LI0A 1RQEA 3DI1A 3G1XA 3A5VA 4DF1A 2EKCA 1I2QA 1EX5A 2V2DA 3CB8A 1W0MA 1W56A 3TC7A 5LGXA 4NJGA 2OMAA 4RK8A 4UTHA 4JY8A 3R12A 4GUJA 1QO5A 4UTUA 2OZ0A 5F2LA 4K37A 4WUIA 4Z0JA 4RZ6A 4KKXA 4PC8A 1SZFA 3GDTA 1ZAHA 4AVFA 1K02A 3NPWA 2VOMA 1F7BA 1H61A 1SZGA 3DFQA 3R2GA 3TUUA 2X1SA 5FF7A 1AW5A 3CU2A 5FEWA 4LOCA 2WPBA 1ICPA 3BW4A 2QUVA 3DHFA 4ADTA 3ZWTA 1A5BA 2CWNA 3N34A 3W86A 3TU9A 2VELA 3IEBA 5D33A 1Z48A 1VZWA 3W73A 3GDKA 2NX9A 4KWVA 4M5PA 2WSRA 1BEUA 1FXQA 1TTJA 4HT3A 4JTJA 3QPZA 3G8EA 2Z0IA 4OE7A 3IGXA 4UTMA 1XM3A 3DI0A 1OABA 2NV1A 3W72A 3NO5A 3VI2A 4K7YA 4GUFA 4G1KA 1KFLA 1AL8A 4O1AA 5HR6A 3LBMA 1L6YA 3B4UA 2HS6A 3O15A 4CLMA 1TPB1 3EXTA 1PHWA 3JR2A 1KBIA 2DZPA 5I3IA 2QCDB 3DAQA 1XI3A 1FBAA 1QDSA 1VPXA 3BPWA 3TK7A 4H3DA 1ZALA 3NEVA 3IVUA 3M47A 4JTLA 3W3OA 4M6QA 2DJLA 3QM3A 1CW2A 1LBMA 2AGKA 2YW4A 2NX3A 4LS2A 4TR9A 1OFQA 1IXQA 1M7OA 4U28A 3VNDA 4J9JA 3HJZA 3DH7A 4NJKA 3S1WA 3USBA 1IXNA 4JDBA 5CZJA 2QKFA 1NVMA 1TREA 3QMRA 2H8XA 3PC0A 1B9BA 1GYNA 1JCMP 3S6DA 4NXSA 2G95A 2TSYA 4FX6M 3ZR4A 4ZZ9A 4Q32A 1LDCA 4O52A 4ZQCA 4M6PA 1KTBA 3GZ3A 3P7YA 1UUMA 2YSWA 1Q3NA 2FIQA 5F4WA 4M6VA 3UWWA 1AL7A 4NJJA 5C2XA 1Q6LA 2PE4A 3Q58A 2TYSA 1OYBA 2OT0A 3QJAA 4UMCA 2CLIA 4XKYB 2NV2A 4O54A 3GKAA 1P0NA 1KW1A 4E0CA 3UZJA 5HR7A 2NWRA 1X6UA 1SUXA 3UWZA 1D3HA 1G4TA 4QJ1A 5D09A 3QRHA 4MLRA 3CT7A 3L65A 3MYPA 4Y8FA 2ZZ4A 5D38A 2XFWA 1JCYA 5I3KA 1QPOA 3EXRA 1P0KA 5FI8A 3W22A 1KM1A 3NQ6A 1YXCA 1U83A 1QAPA 4QIUA 4NXKA 1TPH1 3DFTA 3G1YA 4FHAA 5A5WA 4O50A 4PFMA 3U6WA 1L9WA 2ZRUA 4YMZA 1SZEA 1HFBA 3NQ8A 3NOEA 4JTEA 1WXJA 2EAWA 5C5YA 1W3NA 4ADUA 2V0TA 4C1KA 1OFPA 3SGZA 3T7VA 2X2GA 4JTFA 3INPA 3EKLA 4PL1A 5FF2A 1U5JA 3O07A 1I4NA 1PIIA 5G4EA 3FYPA 4L4MA 5U4NA 3EWUA 3TSBA 3DFOA 5H2ZA 1K7FA 3HG5A 1EP3A 3JRKA 3O8AA 1TMHA 1KFKA 4N6EA 3GB6A 4ONVA 3VE9A 2ZRVA 2FPVA 4QM1A 1O4UA 1Q45A 3DFSA 4JEQA 2ATMA 1WOBA 3LTPA 3WK1A 2ZZ3A 4GRSA 4Y9AA 1W1ZA 1XBXA 2Y89A 2W0UA 3HG4A 5BNKA 1EP2A 4O28A 6ALDA 1KBJA 3DXIA 1B4KA 2GJNA 3L0KA 1ICSA 2VKZG 1LLWA 5BW6A 3LV6A 2WNNA 1TPFA 3I7QA 3MP5A 1QOPA 3FYOA 2CLMA 1QPRA 3IIXA 4HNTA 3TFCA 1GYLA 1TB3A 3IIPA 5AHEA 1YTEA 5D30A 3HPZA 3NNTA 3EWBX 2YW3A 5G5IA 2C16A 3MWAA 1YPFA 3BG3A 1FCQA 2ISSA 4MJMA 6TIMA 2A5HA 3MBFA 1PE1A 4IXXA 2DZWA 3UWYA 3PWAA 1Q6QA 4O8RA 3FFSA 4JY9A 5AHIA 3W7GA 4FB7A 4IGHA 3IRDA 3STFA 4JTUA 4AH7A 2LLEA 2VFDA 4AXKA 4LVAA 2Z2UA 2RDTA 2VFHA 4AAJA 2V5LA 3NL5A 2D73A 3V1PA 3IVSA 4RJEA 2DZVA 2DJXA 5G2WA 3LGEA 3HQ1A 5TIMA 3TKFA 2HSAA 4LWWA 1ME9A 4K38A 3TMLA 2ZTKA 3CTLA 4KFPA 4YL2A 1JQVA 1KFCA 1XDLA 3BLEA 3W1LA 1ZJIA 3TCEA 1HTIA 5K4XA 1OFDA 3P5YA 1R46A 3QH2A 4O15A 4DXVA 4DO4A 3F4NA 1YLVA 1MEIA 2JKEA 4K36A 1EP1A 4WXZA 5DN1A 1TV5A 3TQKA 4JGDA 4PTNA 4AHQA 4JICA 4JTHA 4JYDA 5I3FA 4WXYA 3OG3A 1L2UA 1R2RA 5DXXA 4JYFA 4FIRA 4GE8A 2Y7DA 2DU2A 3LXCA 3SFKA 1XBYA 3N9SA 5EMUA 4W9TA 1H62A 3B0PA 5LHFA 4LV4A 4HSOA 1ADOA 1TSIA 2Y7FA 2VFIA 5F4SA 3N19B 3UY7A 4NUWA 1Z42A 3LCXA 2GOUA 4IMGA 3LERA 2WKJA 4TU1A 4DBDA 1RPXA 3CLMA 3RU6A 3LV5A 4MYXA 5HUPA 4UUIA 3GDLA 2RDUA 2QUUA 4A2SA 2J9XA 2WOQA 3VKJA 3P80A 4LUJA 1JJKA 3LM7A 3L0GA 2JGYA 2E77A 1G4PA 1R2TA 2A4AA 1GWJA 2H90A 2B7NA 3L67A 1TV7A 2ISWA 2Y6ZA 2YFNA 3HOJA 2QCMA 3IGUA 3W6YA 3TNOA 1KLZA 4EVZA 2KZHA 2PRHA 1K7XA 3M5YA 1IIGA 5L6UA 1V7YA 3PF3A 1VGAA 3S5YA 4ZQRA 1RV8A 2Q3OA 1O5KA 3W1QA 1T8XA 5E93A 4PL2A 1H51A 3NG3A 2ZRXA 2FPYA 2EGZA 1ZAIA 1D3GA 3BARA 2FTPA 1H7OA 2GJLA 4JNMA 3B05A 3SECA 5K3VA 5IBXC 4LC8A 3WJSA 4MUZA 4QITA 1SR9A 4DO5A 1TPUA 1EWEA 1SQ7A 2Y7GA 4WZHA 1IXPA 2C15A 1VYPX 3W7KA 5I3GA 2CZFA 2E6YA 4I7UA 5KINA 1B3OA 2Q3RA 2DZXA 3P60A 3DFNA 3RLVA 3G1AA 4DPPA 4L4LA 3BLIA 3T4CA 2A21A 3C3NA 4EIVA 3K30A 4IXHA 2Y62A 4Z1DA 2ZZ7A 4CNNA 3W87A 2YX0A 1O5XA 4DO6A 1P4CA 3E12A 1BTMA 1YDOA 1XFBA 3G18A 1J2WA 1DQWA 3QMSA 2J9ZA 3GR7A 4NX0A 4QNWA 2Y7EA 4P2VA 3S5OA 2BWGA 2X1UA 3W2MA 1WA3A 3BLFA 2C1HA 4P61A 4ZQOA 3HG3A 1XBVA 3KRZA 1K3UA 3P8IA 1SW0A 2J6XA 2QCFA 5D37A 2QAFA 5CG7A 1W5PA 4AF0A 5FF3A 5D2VA 1FQ0A 5CSRA 3O05A 3M5ZA 4UFLA 4POCA 2G5WA 3G1HA 3LRMA 1L6SA 3LCLA 3R5EA 1VYSX 4MKNA 3GDMA 4IPIA 1QO2A 2C13A 3TH6A 3IIVA 3W2LA 1YDVA 2A2IA 1GVQA 2V5BA 1UASA 1WOAA 3CEUA 2ABBA 4FO4A 1GEQA 4LTSA 3N2MA 1EA0A 3Q2DA 1IXOA 3N2XA 3C8FA 3L5AA 1FDYA 1W5NA 4ZVJA 3EX1A 4NU7A 3O16A 5I3HA 3W7LA 1TQXA 3MMTA 4ZQNA 3GVGA 3W7IA 1IIHA 3GXTA 1SSGA 2WSQA 3W1PA 3OEXA 4LS1A 1JCLA 4NQ1A 5F2MA 1H7XA 3TJXA 3C4UA 1L6WA 4MZ8A 1FXPA 1F74A 1OFAA 3W7HA 5HJLA 3A23A 5IM51 3DENA 3DKLA 4MY8A 2V8ZA 4WQ6A 2VEIA 5BMWA 1SU5A 4MLJA 3W7PA 5KSWA 2YDAA 2ZFAA 3NQMA 3TJLA 4MYAA 2QCEA 1JR1A 4O11A 3Q94A 1F73A 4CQAA 1UB3A 1TCDA 4FIQA 1NSJA 2CLOA 1BWKA 5LGZA 1EEPA 4OBTA 5AB3A 3DBPA 1SZNA 3HGSA 3LX9A 1VC4A 1H7RA 5AN7A 2C14A 3PUEA 4UTTA 2G96A 3MBDA 5FESA 3SJ3A 3TFXA 3W83A 3LLDA 4JDYA 4IJBA 3LCWA 3WK0A 4OV4A 4KWWA 4OU1A 1OFBA 3UYCA 1FCBA 5AHMA 1EUAA 1M6JA 2BSLA 1OFEA 4XTDA 3PAJA 4AWUA 4B5NA 3LHTA 3SSJA 4I7WA 4LVBA 1HO1A 2VEKA 3A5FA 2NUXA 1W3IA 2P10A 3NYZA 4BK9A 1GJPA 3N14A 4JTTA 4M7SA 3QMTA 2GQAA 1TJRA 5DCEA 4RX0A 5CPNA 2QCCA 3QPYA 4FXSA 3NXFA 5H91A 3O1NA 4IX0A 3HPSA 4A3UA 3I65A 1MSSA 1H1YA 4JTIA 3RNDA 1PL9A 2QJHA 1OX4B 1WBJA 1THFD 3GAYA 3NVTA 2E1DA 2VFEA 1VCGA 4Q33A 5BMXA 4S1FA 3T55A 1MZHA 4HPXA 3QSTA 3S1UA 4TIMA 2H3BA 4DEFA 4JX4A 4Q4KA 1FWSA 2Q8ZA 5TQLA 4MVAA 2FLIA 5LKYA 2ZZ5A 3G0XA 3S42A 5AC6A 1A5AA 1LROA 1VLIA 4FNPA 1T99A 3LI1A 1S3HA 2VXNA 3MI6A 3P61A 2GVLA 3HG2A 3W7RA 3IVTA 5D2XA 3V75A 2PURA 5EPDA 2CZDA 4QNEA 5AHLA 4QISA 4ORIA 4A22A 5D05A 3Q37A 4A2RA 3N3MA 2R91A 1Z41A 4S2CA 2TPSA 4UFKA 1UUOA 4C1LA 1RD5A 1LBFA 1SW7A 2B0MA 4UTWA 1QPNA 3OVQA 4XBSA 2P0OA 3FA5A 5T26A 5I3JA 1HUVA 3W71A 3W1AA 3UPWA 3TW7A 2ZRYA 3HGOA 2C3ZA 3I68A 5FEXA 1P1XA 1OX5A 3NQDA 3IIZA 3LOTA 4MOZA 4PA8A 4UFJA 3PG9A 1X1ZA 1RQHA 4RZ5A 3W75A 4O1CA 4FXRA 4GUIA 1B57A 2CZ5A 1ML1A 4UCGA 2GQ8A 2ZA2A 4JD4A 4LUIA 3W1RA 3ABOA 5G1YA 4DPQA 4O4WA 2RDWA 4O1BA 3E96A 3W1UA 4UFIA 5EKYA 1I2NA 4GXMA 3NQ2A 3P84A 4MY1A 5LHEA 3EX2A 4YCOA 3A24A 5DBTA 2A7PA 3CIXA 3TV8A 3FJLA 5F4XA 4ADSA 1CX9A 5LNUA 1TYGA 1VH7A 3GXNA 4BI5A 3FEMA 3KXQA 2NXIA 1DQXA 4LC6A 1R30A 2QJGA 3PSVA 1LOLA 1UCWA 3P67A 4K39A 2WNQA 2BZNA 4OGZA 3QF0A 3W9ZA 3LHWA 4JIQA 2C19A 2V2CA 3L5MA 5TBOA 1SO4A 2V2HA 3EWXA 2NUWA 1XBZA 2CLEA 4RLIA 1GVFA 1DL3A 2Y61A 4KFNA 2QUTA 4TO8A 3TXZA 3TSMA 2CFFA 2TRSA 3M1ZA 2QCHA 1C9DA 1QMLA 1WBHA 3M44A 2ZA3A 2ZZ1A 3O6CA 4Y90A 2B7PA 4NX5A 3BO9A 4TMCA 5D03A 2NXHA 4O17A 3QW3A 5HNRA 1M7PA 3QSRA 3UPBA 3KVLA 1PVNA 3G1SA 4AEOA 1TTQA 4UTLA 2YCEA 1LORA 1X8FA 3PBWA 4O12A 3DGRA 3O6YX 3TQ0A 3I6RA 3UY8A 5C6MA 4BI7A 1B4EA 5HUOA 4E2DA 3G1FA 4NNAA 7TIMA 4OT7A 2X16A 2IQTA 1D9EA 3LB0A 2E5CA 4CNOA 4MJZA 2QCDA 2VEPA 3QZEA 5HMSA 1K7EA 4FX8A 5MHBA 3W7NA 1VQTA 4GUGA 4XBKA 4BR1A 2YXGA 4ZQPA 3PY2A 4S2BA 3W1MA 3W7OA 4M19A 5FEZA 5CGQA 3MYOA 1H7PA 4NJIA 4Z0SA 5KZMA 3S8HA 3A21A 2WNZA 3KX6A 5DLCA 3B8DA 3GLCA 3UWQA 2OX1A 3TDFA 3HF3A 2E5BA 3NA8A 5FEPA 1ZENA 2YYUA 3LRKA 3TMQA 4LVFA 4UIOA 1W5OA 1XUUA 3ATYA 1PHQA 3LCHA 1ZAJA 1LM1A 4LY8A 1EWDA 1G7UA 2YR1A 1QPQA 4O14A 1GVRA 3OHIA 4FEZA 3TROA 4R7JA 5EY5A 3EWWA 2B7QA 4N9BA 1CI1A 3GNNA 1SFJA 2Y70A 2QCGA 4H4IA 4LNYA 2G97A 3KVJA 4IOTA 3DKJA 5AYXA 4YWIA 4N4PA 1G4SA 3UNDA 3VCRA 4WD0A 4UR8A 2E09A 4R53A 1Q6OA 4ML9A 1I8JA 2GPTA 5HWMA 1DV7A 4EF9A 2I9EA 3T40A 3KOFA 2PRMA 1OJXA 1HO4A 3LBCA 3EB2A 2FQIA 4ICNA 2PRLA 2JK2A 3FIGA 1XC4A 1TPVA 2AAMA 1X1OA 4AMAA 3GYEA 3W74A 1E51A 1FUYA 3MHFA 1ZNNA 3LCGA 1KM6A 5CKSA 2XN1A 3W2NA 1H5YA 3G22A 3MO7A 1SO3A 1ME7A 1P5BA 2A0NA 3M5XA 2QJIA 1TRIA 1A50A 1XKYA 4JX5A 3L0NA 1XCFA 1Q6RA 5K9CA 3C2OA 5C54A 3E0IA 1GZGA 3LRLA 3UWUA 4GWEA 3UXDA 1PV8A 4WOZA 1AK5A 4IQLA 3B0VC 1RR2A 2O7QA 1SFLA 4RXGA 1UBSA 2OCZA 4UTJA 2BLEA 4AB4A 3W7CA 4O18A 3SY5A 3QW4B 2YFOA 4X22A 2QEZA 1GVOA 5LNRA 3W2UA 3TA6A 1OFRA 2CW6A 3OBKA 1ALDA 1O95A 4WX2A 2PCQA 3EWYA 4I7VA 1PCWA 5J5RA 2WV8A 5LNWA 1K8YA 4UTTC 3BG5A 5D2TA 5K9DA 1QOQA 3SI9A 3ZWSA 1EPXA 3CC1A 1OK4A 3NPUA 1F5ZA 3W84A 3OIXA 3C56A 2FDSA 4E2BA 1TJPA 4YLWA 2J88A 1TPWA 1NEYA 1GG0A 2ISVA 5CZ0A 2CU0A 4DF0A 4EWND 3TC6A 1RQBA 4JTSA 1ZY9A 1TPEA 3NL2A 3NQAA 3EXSA 3NDOA 3HIJA 4UMBA 4JTGA 1TRDA 3NQVA 5DCBA 2W79A 3OVPA 5CPMA 4ZQMA 3HPXA 4UTWC 1QFEA 5F2GA 3MUXA 4YCPA 4UNLA 3NR0A 3KRSA 1MEHA 1WX0A 1I2PA 3NPVA 4A21A 1OYCA 4RXFA 3THAA 3CQ0A 3S1VA 3W1NA 3UD6A 3MI3A 1O60A 1SW3A 1M5WA 3NGJA 3TQVA 1Z44A 1DBTA 4FNRA 5HWJA 4NZJA 1ICQA 3G1VA 4JR5A 4WOQA 5HINA 4NVTA 3NAVA 3HO8A 3NZRA 5KZEA 1ONRA 3BGJA 5LNVA 4CNPA 4UFHA 3R8RA 1K8XA 1W54A 3PBUA 3SZ8A 1A53A 4CQ9A 2J9YA 4OV9A 4NT0A 3NL3A 5AYZA 3BV4A 5AC8A 2OT1A 3PS7A 3G3MA 4O16A 2WO5A 5HQEA 2FB2A 3QFEA 3MJYA 2DORA 1TTPA 3EKZA 3E02A 3BG9A 5K4ZA 1S5TA 4Z1BA 3RLUA 1I2OA 1BWLA 1H1ZA 5U7SA 4CQ8A 3MHUA 4U4MA 3R89A 3HB9A 3ABQA 1W3TA 2FFCA 1TPDA 3JS3A 3U2OA 5LZLA 2A1YA 4GBUA 1VR6A 2VFGA 1PS9A 2E5DA 1OF6A 3ABRA 1DORA 1K8ZA 3A22A 2UV8G 3S9YA 2H6RA 1T96A 3BGGA 3W2JA 3PB2A 5KZDA 4PODA 2QR6A 3L9CA 1KTCA 3DFPA 4WJEA 1OX6A 3A9IA 1RZMA 2JKAA 4FNTA 2Z6JA 4QSHA 1DJNA 4MFEA 5AFDA 4GC4A
chains in the Genus database with same CATH superfamily
3C86A 2GVJA 4F79A 1DJQA 3NL6A 2RH9A 6CGTA 2HNEA 1E3XA 5E09A 4B90A 4IPPA 2ZUSA 2IXVA 1NJJA 3LHUA 1JD7A 3FKRA 1GOXA 1LWJA 3W24A 3KBJA 4QTGA 3ZMRA 4KERA 5JBFA 3VIFA 3NZPA 1CLVA 3GIPA 3SIZA 4O8AA 1YADA 3CUHA 2XJ7A 3NZ1A 3NO3A 1JI2A 1E4NA 4KIEA 3HBLA 3NVVC 1FWTA 4EPDC 2IXUA 2CBVA 3TIMA 1XXXA 3QPEA 1EUNA 4B2DA 3K8LA 2XHYA 2EPLX 3ZFHA 1OIFA 1SVDA 1VLWA 5E1QA 5BWAA 1F8IA 3VFLA 3P8JA 3FX4A 2HK0A 3QHNA 1UOZA 4XQ6A 4X60A 1XLAA 4PCFA 3NRZC 4GC3A 1WKYA 2XN0A 3HV8A 3PUOA 4O13A 2Z24A 5AY7A 4IMCA 2PP0A 3IGHX 3TJ4A 2VX4A 1JD9A 1VFLA 3WF1A 1JCXA 2XISA 4KRUA 1DOSA 2XG9A 4JN7A 1O1HA 5A2AA 4S3GA 3KDNA 4HHHA 2ZTJA 2XVGA 4D8ZA 1BF2A 1CLKA 1JCNA 4HKPA 3BK0A 3VKKA 1AQ0A 1J4EA 3V7PA 1E0VA 4DWSA 2XIQA 2A7RA 4KF1A 3VNLA 5CPOA 4FAMA 4Q8PA 3N4AA 1IEQA 2DT3A 2DW6A 2CWXA 2CZEA 1TTIA 5BXSA 5A8GA 3E0FA 4GO8A 4WLCA 3UXIA 1BHGA 4OOUA 3GKFA 1QCWA 3CWNA 3OW2H 4EPKA 3RUBL 1WYIA 2HCVA 3RG6A 3M0LA 1BVNP 3B9OA 5D32A 4QG8A 3BTNA 1T0OA 1GQNA 1OG0A 3WSUA 1XH0A 3WF3A 4HA3A 2C1GA 3MDWA 1UIPA 3FVDA 3QC3A 3PULA 1JPHA 4N2YA 3U9IA 3RF9A 4HJFA 4KQNA 5DELA 1FH8A 2OEJA 2BHZA 2FZ8A 3NGFA 1AFSA 5CXPA 5A3HA 3SGUA 4K7VA 3K1DA 3LG3A 4HNUA 3RPTA 3GIYA 1M53A 3KCJA 1R85A 3MY9A 3ANYA 2X40A 1QWGA 3PB0A 3PFRA 3PPCA 4AZIA 4NY2A 1A5SA 1VKFA 2E6AA 4NIRA 3PNZA 3NVDA 2WHMA 4IIEA 3EWZA 1LTDA 4ALDA 2O7SA 3GTIA 1HKIA 5LIWX 1E6RA 1U5VA 2W61A 3K8MA 3THQA 1ZBCA 3L12A 3T78A 3KTCA 1PKMA 1V3HA 1FDZA 1FWHC 4XV0A 4FLRA 2Z7GA 3EOEA 4MFDA 1E6XM 3CPRA 4GIEA 9RUBA 3B8VA 3DC0A 2JQXA 1BD0A 4MWAE 3LHYA 4NJHA 1KKOA 2ZUWA 3UR5A 2NX1A 1ZCOA 3LHZA 4DXXA 2FZBA 3KLLA 1VQ6H 3TVAA 1OK6A 2P3EA 1B0IA 1O66A 4UOQA 3AMZA 3GHUA 1EHAA 4TV5A 3GYCA 3EZ4A 4AP8A 2VUNA 2EF9A 5D02A 2JKPA 3FC4A 4XISA 2JIEA 2BGNE 4FX7A 1FCUA 3P3BA 1IZCA 1ONWA 1QR7A 3W6MA 4F8XA 3WH5A 3ORWA 1CXFA 1P6WA 3GTXA 3GTNA 4JXCA 5HXMA 4D9PA 1T40A 3AOFA 3IV3A 3T44A 1LP6A 3FSUA 2O9TA 3AU2A 3OOQA 1W2VA 3E2QA 4PUMA 2PDUA 2VENA 2Z7KA 2Z6IA 4A8IA 3CIWA 4DBEA 4LUTA 3AI0A 5CCZA 1CYGA 4P8VA 4L6HA 5AZ1A 4ECLA 3TYZA 4GJ1A 3FV9A 3STGA 4MZ1A 4BI6A 3NWRA 4V28A 3T2OA 2FVMA 4LF1A 2REQB 4IO9J 1L6GA 2W66A 3IGSA 4PYSA 3NFUA 3UEQA 2PDYA 2Z00A 1YXYA 1H2JA 2W91A 3PZUA 1QBBA 3GVWA 3IPWA 1KM3A 3MZNA 3CL6A 4AX6A 1TMQA 4AHPA 3NQ7A 3G1DA 2WSKA 3T0BA 4I5RA 5EMMA 1I1XA 3M7WA 3GH5A 4KWOA 4O10A 4X9SA 4U5KA 5F2IA 2TODA 5JUVA 2EPNA 5CPLA 5GAGN 2VR4A 4Q6JA 3AIBA 5DM6J 1AD1A 3SEPA 1I45A 1Y0EA 1L2QA 5HQLA 2X1TA 1OZQA 3LLXA 5E0KA 4LAZA 2B31A 4HNNA 2Q8XA 1BQGA 4WKFA 4W7UA 4GFSA 3UG8A 4TX9A 3M0VA 3OB8A 3B8IA 4LCRA 2WWDA 1ZTVA 4NAFA 5ABFB 3UU0A 3RIKA 2P1FA 2OX4A 1R9ZA 3C6CA 3GIQA 2VI0A 3WF2A 1H60A 2O92A 4JQ1A 3L66A 1XIMA 1F4AA 3N9RA 3H6OA 3SRHA 4CCDA 1UR3M 4NF7A 2EPKX 4N42A 1WYGA 1KFEA 4FNUA 2ACRA 4NP7A 5DANA 3SRDA 3KVMA 1SJAA 3S9ZA 4PB4A 1R3RA 3G0UA 3ELFA 4N9CA 3GVRA 5DBUA 4DNMA 2JBMA 1PZ1A 4ZTYA 1QNPA 4F0HA 3RJXA 3EDKA 3VFCA 4EPBC 4HMCA 1WQ5A 1HKKA 4GZ7A 3B0UX 4XSLA 2A79A 1Q2RA 1VLBA 3GS6A 1DE5A 5C55A 3DHDA 3FDKA 4USAA 3PP7A 3P62A 2VZUA 4R34A 3C2YA 4Z2IA 1KQSH 2X2YA 3LBOA 2D2HA 4H6KA 2WMIA 4I9TA 1QWKA 2XH2A 1W1B1 2R82A 1DKWA 2HEJA 3O6DA 1QJWA 5A2CA 1OG6A 1XYLA 1NF0A 2ALDA 3RCYA 1GQJA 4CCEA 3LYEA 3GAKA 3VOIA 4QAIA 4PR4A 5G4WA 1H41A 1XIFA 3WQGA 1UR8A 3NQFA 3YPIA 1JZ7A 2QUNA 3VE7A 4IGMA 4UOZA 5DY3A 1K4HA 3TAKA 1ECEA 3TE9A 5AN9F 1KLYA 3S2CA 5CBJA 5DEZA 4RR4A 1AQFA 2FH8A 2RKXA 3TTSA 1OX4A 4LS0A 2Y63A 5BOOA 1JQXA 1KWKA 4AIEA 4EKJA 2DW7A 4LAUA 2OZ8A 1I75A 2DQXA 2GL5A 2FGBA 4JFTA 3GTHA 4YHGA 1XGZA 1UR1A 2FFIA 1BQCA 4EXQA 1JRCA 1J12A 2DZSA 2QULA 5ABTA 2DV0A 5F1VA 3BOXA 3F4VA 4UQAA 4AZHA 4JYEA 1FWRA 1NWUA 3G1XA 1O12A 3T07A 3ZLFA 4DF1A 1EX5A 2V2DA 3CB8A 3JZEA 1UKSA 3ARZA 2HRWA 1XYBA 1XICA 2OMAA 4UTHA 4EAYA 5J04A 2OZ0A 3S6OA 4K37A 4Z0JA 4PC8A 3WL1A 2NLYA 3JZUA 3GDTA 1ZAHA 3NPWA 3F5KA 1ESWA 1F7BA 1H61A 4OUIA 4F0RA 3LK6A 4XD4A 3AXXA 5EMJA 2Y8VA 4H8UA 5FF7A 3CU2A 5I23A 4FI4A 4ZXOA 3N34A 5FJTA 3IEBA 5D33A 4B5SA 3GDKA 4M5PA 3W81A 1NVJA 3S3GA 1VAHA 1JNDA 1MW3A 2Z0IA 2ZUUA 4DNHA 4AC1X 3XINA 1SJBA 1P43A 2DGAA 3BMWA 1RM6A 3WF4A 4B3LA 1PHWA 3E6EA 3WD1A 5FJOA 5AVHA 2D24A 4MNJA 2PSNA 4G6CA 4JTLA 4M6QA 2DJLA 1UD2A 3QM3A 2VGBA 5D9PA 3N11A 4K8GA 2YW4A 2E67A 4LS2A 2OTJH 3AAMA 3UG4A 3EDDA 4LXFA 1IXQA 3VNDA 3OP2A 4H8NA 1U33A 4NJKA 5LIUX 3UA4A 3S1WA 3USBA 3FGCA 2QJMA 2QKFA 3EDEA 5GNYA 3WBXA 3RPMA 2H8XA 1VFMA 4DUWA 3BGAA 2NQJA 2OFJA 1JCMP 3S6DA 3L4ZA 2UY2A 4NXSA 2G95A 2OELA 2QGYA 1LDCA 1Y5XA 3PPFA 4ZQCA 1PIGA 4GXWA 2D0FA 4F4RA 1KTBA 3GZ3A 3P7YA 4DUVA 1ZL1A 5EMLA 1YPXA 3REQA 3UWWA 4HYVA 2D0GA 1XCXA 2PE4A 3Q58A 1OYBA 4Q3MA 3QJAA 2NV2A 1U2YA 3CMJA 1ISWA 1P0NA 3QLDA 3UZJA 4EE9A 4ACZB 3LN3A 3ZJ7A 5CJ5A 4R88A 2OO6A 1GOWA 4DI9A 1IEWA 1MQQA 2ESCA 4LF2A 4Y8FA 3VKDA 4AD4A 2CBIA 5I3KA 3QR1A 4Q22A 2XFYA 4JL1A 1J01A 3RCMA 3Q4DA 1U83A 2J77A 1TPH1 3EBVA 1K9TA 3DFTA 4GY0A 5EFFA 3SB0A 2OZTA 1L9WA 3ITOA 2VOTA 4R9OA 2Z25A 3JU2A 5JVHJ 1JXKA 1XLFA 4REQB 3WELA 7REQA 1W3NA 3D47A 2IPFA 1JZ8A 4C65A 1NFPA 2FZ9A 4TV6A 4JTFA 4PL1A 5AZ0A 2NV9A 4PUNA 3ITTA 5A6LA 4ICMA 3FYPA 2X0SA 4L4MA 3TSBA 3DFOA 5M3WA 3O8AA 2IQ0A 6REQB 1U22A 4GQBA 1K8CA 3KZSA 2L5HA 4N6EA 4ONVA 3VE9A 4W93A 2FPVA 4X0NA 1O4UA 3DFSA 4JEQA 5EMKA 3UCQA 3MMDA 3LTPA 3WK1A 3WO8A 4GRSA 1UD8A 1BKHA 2W0UA 1EXPA 4O28A 1O7AA 4E5TA 3T42A 4H9UA 4F66A 1PIFA 1LLWA 1M01A 4J7RA 4Q8NA 2V67A 3LV6A 1YX1A 4RW3A 3I7QA 1ISZA 1A4LA 1QOPA 1XLEA 1CGUA 5C71A 1GYLA 3W27A 5I77A 5D30A 5FA5A 3HPZA 3EWBX 4JTQA 5G5IA 3KP0A 4Y9NA 3WH8A 3GC2A 1FCQA 2C7FA 4IXXA 3UWYA 4O8RA 2XINA 1RCOB 2PU0A 4WCJA 4Z2GA 1MI3A 1CB2A 4AH7A 2LLEA 4AXKA 3J7ZM 2WHJA 3S5SA 1W3KA 2WVVB 5TIMA 1V02A 3TKFA 2UY5A 5I5RA 1RVKA 1M3UA 1G94A 4HPHA 4PSPA 1XFCA 1TR9A 1JYWA 2J13A 4KFPA 1V6WA 1V6XA 3IARA 3NDZA 3P5YA 2PLKA 3UWEA 1K8AJ 4H2CA 4Q8QA 3F2DA 4JBRA 1VFOA 1TV5A 3TQKA 1P0EA 4J28A 2WCSA 3HFYA 1R2RA 5DXXA 2PBOA 2XM2A 4GE8A 1DPMA 2JIWA 4H1ZA 1HJQA 2WHKA 3R7MA 5I78A 5IDIA 1OIMA 4AMCA 3S2NA 2Y7FA 5F4SA 1XG3A 3BSHA 2XFRA 3FYYA 4J35A 3DBNA 4DBDA 2Z1VA 3RU6A 1XLKA 3LV5A 5HUPA 2GVYA 1B9ZA 3LPFA 4E8CA 2QUUA 5A2BA 3UJSA 3H2MA 4A2SA 3BAYA 3L0GA 3V5FA 5C2CA 1WUFA 3WQWA 1G4PA 4F48A 1VEMA 1VJZA 1K9FA 4IOAJ 1TV7A 2ISWA 2Y6ZA 3L2MA 1LT8A 1S2AA 2YFNA 4B5UA 1GOMA 1LQ2A 2OSXA 3W6YA 2KZHA 2PRHA 1X6NA 2ZJPJ 3WNPA 1IIGA 1Q7MA 1YBQB 3PF3A 4NI3A 2BVWA 3S5YA 4LX4A 1RV8A 3WLTA 2Q3OA 1O5KA 4HD5A 4CQCA 3W1QA 5DFAA 2XU2A 4UQ9A 1Q2SA 1EC8A 1TFVA 3GVVA 1XRFA 2ZRXA 1X97A 4PFHA 2Y5SA 3IJQA 1ZP3A 3TYAA 3SO7A 3WIJA 2GJLA 2YIHA 4LC8A 4XX6A 3WJSA 4Y9OA 4QITA 1AZ2A 2Y7GA 1E73M 3KL0A 2E6YA 3R0DA 2IW0A 4H8HA 3P60A 2VZTA 3P0XA 4PUWA 2GUYA 1V03A 3RLVA 4DPPA 3BLIA 4LYPA 3NSXA 1GGOA 5DMMA 4XZNX 1VJSA 4UBPC 4ZE5A 1J0YA 2WANA 2YX0A 5I79A 3W87A 1NP0A 1P4CA 2ICSA 4URIA 1BTMA 2PBGA 1J2WA 4PMYA 2J9ZA 3PZGA 1XH1A 4P2VA 2BWGA 2E9MA 4PUDA 4PTXA 2CC0A 1QNOA 2C1HA 3BLFA 3KWXA 1XBVA 2J8TA 4H9YA 2WJEA 2R1LA 3B3DA 2Y8KA 5CG7A 1UD5A 4JNYA 4AF0A 2IS7A 1QHOA 1EJTC 4ROPA 5D2VA 3KP1A 3LRMA 1BVZA 4L56A 3LCLA 1RD6A 3BC9A 3GDMA 4IPIA 1QO2A 3TH6A 3W2LA 1YDVA 3IRSA 2A2IA 1FWGC 1GVQA 4GYKA 1BWVA 2V5BA 1W1PA 2PTWA 3BUVA 1KB3A 2ABBA 3O0KA 1J0IA 4FO4A 3N2MA 2YL6A 1RA5A 3TYBA 1IR1A 1QRQA 1KXTA 1X1NA 4ERIA 2AOSA 2XYLA 3QOMA 4ZVJA 3W7LA 4IIGA 4IUGA 4ML4A 4J4KA 3VZYA 3EPMA 2XVPA 3GXTA 3DG6A 4GI6A 3VOGA 1L6WA 3SCVA 4DJDD 1FFVB 3RM4A 2Z2BA 1OFAA 2WQDA 3DHPA 2DIEA 7PTDA 2QJNA 4WQ6A 1F9CA 2PDHA 4DO7A 3GH4A 5LA1A 1VQ4H 2QCEA 1JR1A 3B8WA 4M6UA 2VX5A 4KMQA 3H2CA 1UZDA 2X8RA 3MSGA 1K9MJ 4GMEA 4Q8WA 1CXKA 1NSJA 1BWKA 3KHDA 3SUVA 4WKAA 5AB3A 1KBBA 4R7OA 1S2VA 5JVGJ 2C14A 1H3GA 4QS5A 3MBDA 5CC5A 1DQUA 2SFPA 4GI9A 4WGXA 2QV4A 1B3ZA 1OFBA 3UYCA 1J93A 1M6JA 4JFVA 2OYKA 1OFEA 4XTDA 1UP3A 4AWUA 1W2PA 3A5FA 1W3IA 3SN1A 3VGFA 3NYZA 3QMTA 1RP9A 3QBUA 4RX0A 5CPNA 1C92A 3UG3A 3O1NA 1M65A 1TX2A 2OO0A 3EA2A 3CH9A 1S5MA 4JQ4A 5BRPA 1GW1A 1SB3A 5FJRA 3MUAA 1QXLA 4YIWA 3CPGA 1H1YA 1EBHA 4MKSA 1JZ4A 3HFTA 3NVTA 3S2MA 1UW9A 5ENLA 2VFEA 2Z2AA 4JIRA 3TTQA 3M64A 3QSTA 5EY3A 3QQWA 3TYEA 1KR0A 3QGKC 4HNLA 3M0IA 1JXJA 1R3WA 1UP0A 2FZDA 3G6MA 3RRXA 6A3HA 5TQLA 3WEZA 5AC6A 2I56A 1N2VA 1A5AA 1UC4A 1EC7A 4FNPA 1HF6A 2EJAA 4PUUA 2DSWA 4A4AA 3IK4A 2BY2A 3RLGA 2G3NA 4QE1A 1KGWA 3SUWA 4H6RA 3NEHA 4RE4A 1ELSA 4US8A 1AJ0A 4RE3A 5D05A 1QK0A 3WNOA 1T8QA 5CSYA 1E0WA 1GORA 2TPSA 4R9XA 1NFGA 1RD5A 1X98A 2B0MA 2GJRA 1RCXB 4UTWA 1Q6EA 4DX3A 1FH7A 2VQUA 1CDGA 5I3JA 4W5ZA 5I03A 3ARTA 3RM8A 2ZRYA 4KCWA 3HGOA 3I68A 4W85A 2CHOA 4IGSA 3MTWA 4HP5A 4C5ZA 1P1XA 3NZQA 3ITLA 3SBFA 3NZGA 4WKHA 1UKQA 4UFJA 4PZVA 2UWFA 4GK8A 4GUIA 1NQ6A 1R3SA 3NJ3A 1A80A 1ML1A 4UCGA 2GQ8A 1LG2A 4JD4A 4WSHA 3RU8X 5HPOA 3W1RA 4DPQA 1JAEA 3W1UA 1M7XA 2XTKA 4UFIA 4G5DA 1I2NA 2HPMA 2J8FA 2V5JA 2F9RA 3NQ2A 3ALGA 4INFA 4LYRA 5LHEA 3B9EA 4GGBA 3G6LA 3RN6A 4ADSA 3NDYA 3GXNA 4BI5A 3FEMA 3W6LA 1R30A 1HKJA 3OGRA 3VGHA 4QLLA 3P67A 4K39A 2BZNA 1QVBA 3AYRA 1L8PA 3QF0A 2HWGA 3LHWA 1DWIM 2XH7A 1M9HA 4JIQA 4M8UA 2Z1WA 3KOYA 5EGRA 1U5HA 3EWXA 5B7ZA 1XBZA 4BF5A 2Y61A 2QUTA 1CENA 5I07A 4I6KA 3CCSH 1MQRA 4Y90A 1P6BA 2Y5JA 3VKAA 5ABHA 1W17A 1OB0A 3BAXA 4XAPA 4O17A 5DQPA 5HNRA 1J96A 4LB4A 2ZC8A 3UPBA 7REQB 4AEOA 1Y5VA 4LAMA 4CD5A 2YCEA 3CV7A 1LORA 2REQA 3DGRA 1RJQA 3TQ0A 3I6RA 3UY8A 2ALRA 3A12A 3G1FA 1DTUA 4KETA 2D69A 2WJFA 3UJRA 3K8KA 2OYMA 4MB3A 2E5CA 2RJHA 3QZEA 3QV9A 4FX8A 4J3TA 4AD3A 4Y8EA 3ARRA 4GJIA 1H7PA 2NT0A 3E2SA 4GKLA 1R0MA 3TWBA 3CHEA 4AVNA 1LUCB 3OO2A 1K6WA 4IIHA 1POJA 2YYUA 4GYPA 3LRKA 3NSMA 1XUUA 2QXWA 1PHQA 1ZAJA 4LY8A 4IIBA 1FIQC 2YR1A 4G8TA 4L5ZA 1MW0A 4R7JA 2B7QA 1SFJA 4GY1A 2QCGA 4LNYA 4NYYA 3KVJA 4US5A 5FKYA 5AYXA 1S39A 3AQUA 4NG3A 4F3HA 1G4SA 3UNDA 1R3VA 5M5DA 2BGQA 4ML9A 1UR2A 1ZLPA 3TLQA 1DV7A 4PUKA 4QDWA 2R1NA 5C7VA 2V63A 2CLPA 1JFHA 4DJFA 2QDDA 1RJRA 2FQIA 3FIGA 1XC4A 4MJ4A 3WCZA 1X1OA 3U57A 4EXBA 4KRTA 1E51A 1FUYA 1CXEA 5E0CA 1PXGA 1TMLA 2XN1A 1LJYA 3TC3A 6PTDA 4TXEA 4L9ZA 1SO3A 1ME7A 3M5XA 4AY7A 2INZA 1JPMA 1A5KC 1CB7B 3PZ9A 4UZUA 1Q6RA 1A3WA 2W63A 5GAHN 3OU8A 5C54A 1UR4A 3LRLA 3UWUA 5BOEA 1UJQA 4PBEA 4KEMA 4Q4QA 1H0IA 2VX7A 1YQ2A 3KBWA 4IQLA 3B0VC 1Q8AA 2HV5A 1MXGA 2O7QA 3PZQA 4RXGA 1UBSA 3T08A 4C6EA 4BHYA 1Y7VA 3SY5A 2POTA 2QEZA 3TTOA 4HPGA 4D6GA 4I7VA 5GADN 4JTDA 3FXGA 4DBSA 5FAGA 1QUMA 1QOQA 3K5XA 3SI9A 4CGTA 1FP8A 4JCLA 1OK4A 1F5ZA 3SR6C 4ZFMA 4WSJA 3ZSSA 3R79A 3C56A 4UQCA 4DWDA 1TJPA 4YLWA 1S2TA 6XIAA 7A3HA 1DYSA 1ZJHA 4WHBA 1J5SA 4DF0A 4EWND 5AKQA 1TPEA 3NQAA 3QZ6A 5F7UA 3K2GA 3NYDA 3OLEA 1TRDA 3UESA 5DCBA 3DECA 5FSDC 4JIHA 3C3UA 1DGJA 1RY8A 2W79A 3OVPA 3HPXA 5BRQA 4UTWC 3R58A 4U10A 5F2GA 2E1WA 3MUXA 4HCDA 4UNLA 3NR0A 2P8CA 1AJ2A 3G1RA 4FALA 4ZBCA 4KEVA 2VCAA 1PTGA 3GD6A 2EKGA 3N4EA 1EF3A 4WVXA 4HQVA 3POHA 1QATA 3SCSA 3GQYA 3TTEA 3WQVA 1DIEA 5ABGA 2VX6A 3O6AA 1EJUC 3H26A 2DT2A 2DVUA 5HWJA 4NZJA 3LU2A 3LY0A 3BXWA 2PWGA 3BANA 4WOQA 4DWSB 3NAVA 5BCAA 1L0PA 1E9LA 2GJXB 4PBFA 5KZEA 3EWCA 3ABZA 2P5NA 1K8XA 1A4MA 1ONXA 2WBGA 2OLAA 2FGLA 2NQHA 3SZ8A 1ODUA 4NT0A 1RALA 2QYGA 3N6JA 4W7VA 1GYMA 4M24A 3E0WA 3BV4A 5AC8A 2GGHA 4B9YA 4XO6A 2WKLA 3MJYA 1Z6KA 3RLHA 3PAOA 2DDXA 1GEHA 3WQPA 3E02A 5K4ZA 1S5TA 2OEKA 3H8AA 4D71A 3R89A 1PO9A 3URNA 1VBGA 4L9YA 4WF9J 3P93A 3XISA 2E5DA 3ABRA 1K8ZA 4DLFA 2EG8A 3I3BA 1J0KA 2H6RA 1T96A 2ZUTA 1R87A 2PUZA 5KZDA 3NVYC 3L9CA 4BKNA 1EJ7L 1VEPA 4U2ZA 3QFWA 1RZMA 3A9IA 3THDA 2Z6JA 3ARVA 4MFEA 3FA4A 3PN8A 3UG5A 1E1EA 1XIEA 4X61A 3SRFA 1NDYA 3EX4A 4H04A 1EJXC 2V81A 1JULA 4A3RA 3CCRH 1UKOA 4HU0A 4BF9A 4PRRA 3WQOA 3S1XA 3EB4A 3IV8A 3ES8A 3P81A 1NIUA 4YTSA 4GA8A 4OIFA 5D8WA 4GVFA 4X0VA 3UP8A 1YRRA 1JGIA 4O57A 3MHGA 3STEA 3O06A 3UR7A 3TW6A 4HA1A 3EX6A 1EGZA 4KBXA 2E68A 1MWOA 3WJXA 3CM4A 1OYAA 2OTLH 1TV8A 5HPCA 3WNZA 3ZT5A 1S2CA 3DZ1A 2QMJA 1N55A 3U5YA 3LCFA 1XL9A 3D0CA 4XWUA 2PWDA 1MO0A 2ZUMA 3P5ZA 4GABA 2DZAA 1Q4WA 4O4VA 1ZUAX 3L4TA 4Q8VA 4B16A 4MDPA 2IKJA 3N4FA 1HT6A 5FD0A 2AMGA 3W1TA 1TE1A 1T41A 3GNRA 4R27A 1Z32X 2PDIA 2XZ7A 3TW9A 1HJVA 3NQGA 2PAJA 4UR7A 2CCRA 1Q4NX 4DI8A 1VYRA 4QGCA 4ZSUA 4WJ8A 3W7QA 3W01A 4YJ5A 1J5TA 5G2IA 4AD1A 1TG7A 4N02A 4LAOA 1X8CA 2YGYA 3ZLHA 1CXLA 2FB3A 4GQQA 3W07A 1SO5A 1XP3A 4Q4OA 1TWDA 3W7EA 2J8GA 1SJDA 1KWGA 3VDAA 1HJWA 4HNCA 4MY9A 2X30A 1EX1A 1YDNA 3SR7A 1GQKA 1W9PA 4JFUA 1B2YA 4LUTB 4WDUA 4X3ZA 3OVRA 2YKKA 2GQ9A 3OBEA 4J27A 3VC6A 5KITA 3WH9A 1G6CA 1NF7A 2ZA1A 4UNIA 3W7MA 1JPIA 4CD4A 1A5MC 4LB3A 3GO2A 4XKYA 3GG7A 1JPDX 4LW7A 1HVXA 1H63A 2VNCA 5JQ9A 3W26A 4Z1AA 1E9YB 4Y9PA 4G1NA 2E6DA 1Q82J 4RL3A 5FF0A 3KOXA 4GYJA 1F6PA 2O56A 1SSDA 5H1WA 4BFAA 4D1JA 3FOKA 1SPQA 4N4QA 1R47A 2QDEA 4P5UA 2ZCGA 2V5KA 4G7EA 5DF0A 1EH9A 1G0CA 4HHPA 3M43A 3G3DA 1JUBA 1N61B 1FDJA 1D7FA 2H8ZA 3ID7A 1V0LA 2GSEA 3H2AA 3ZR6A 1BXNA 1X7IA 5IFPA 1UH4A 1GPFA 3DIPA 2UZ9A 3MS8A 2DUZA 1LRNA 3FN9A 4MAVA 3DU0A 2XSBA 4QBXA 1E3ZA 1MXDA 3BJSA 5LNSA 2J7HA 1LL4A 3WN6A 1H4PA 1R86A 1A3HA 1E71M 1C7SA 1AW2A 3C52A 3ZJKA 2WSYA 1VFUA 2NSXA 4IQDA 3MUCA 3AIUA 2BTMA 1QT1A 1KRBC 1FKXA 1YTKA 2Z26A 4OUEA 3WO1A 3GR8A 1VF8A 1OM0A 4ZMGA 4C6FA 4PBGA 1NOWA 4MIMA 2DSVA 3BW3A 1KM4A 1F8MA 1GPWA 1S5NA 2AGTA 1N5WB 1UOKA 3U4AA 1W91A 4GZEA 5C7HA 4CCZA 3GDRA 1YE4A 4REQA 4FNQA 1GUVA 3QQ1A 3GUWA 1EIXA 1VENA 2V9DA 3WLIA 4PE8A 3W70A 3GK0A 4I5UA 5C9RA 1E15A 1VBRA 4WDXA 2NLIA 3M5VA 1VFSA 2W92A 2VRJA 4Y6GA 5M03A 1BYCA 4KS0A 3WK2A 4EX4A 1W8SA 3LTYA 1V3JA 1RJPA 1JPKA 4QLKA 1ENUA 1W1VA 1O1ZA 2OZ3A 1EDTA 3TN5A 4GBDA 1E40A 1GZ1A 2VTFA 4W8AA 2X09A 2DUXA 2D20A 3AC0A 3MUZ1 4RE2A 1EA9C 4J3XA 1XV8A 2NUYA 2EQDA 3CO4A 3M41A 1V5XA 4K68A 1J8VA 1I2RA 1Z9AA 4O53A 3WY1A 4US5D 2AQOA 1NH6A 2IKHA 3W1XA 2RHGA 5I00A 1VQ7H 1WPCA 3TSDA 1KM2A 4HBKA 4WK9A 5CC7A 1CEOA 1X96A 1US3A 1VS1A 1X7FA 3MO4A 1OFOA 3LENA 3PIOJ 2QPUA 5CZKA 1KBLA 4O1FA 4H19A 2A6NA 4LVDA 4M1RA 1TVNA 1J9YA 4IPLA 1N8RJ 2QUMA 5HANA 2PGFA 1FP9A 2CBJA 3VOHA 5GPRA 4US9A 5G1TA 1OT1A 2GSJA 4AEEA 4O0ZA 1HJSA 3KW3A 3GXMA 3ARSA 3F1QA 3W2KA 4KESA 3H53A 4TVCA 2GGEA 4BWLC 5MPOC 3F2BA 4O0KA 2XM1A 4GJJA 2WMGA 1S5WA 4RNJA 3IS4A 1UA3A 5A6SA 3F5LA 2B7OA 3C61A 1FHVA 3WLJA 5D2YA 3ZO9A 3AJ7A 3PBYA 2WZTA 4PTVA 1KD0A 3B04A 2R14A 1Q6FA 1UZHA 1H50A 4GNKB 5HMDA 1W37A 3FKKA 4E38A 4IX2A 3W85A 5EYWA 5A6JA 2QCLA 1KRCC 4ZL1A 1CCWB 2BY1A 3ABSA 3ARQA 2G3IA 3I6EA 3LD5A 1HG3A 1N8FA 1FHUA 2XN2A 2EXOA 2ZZ6A 1PUDA 2X42A 4HOZA 3D3FA 2GGJA 4PTWA 4W4QA 3APGA 1JDAA 2RFGA 3MP4A 3CXCH 4UQEA 4AZCA 2AQWA 3WQ8A 4QEEA 1C29A 3G5EA 1DWFM 4GOAA 3H70A 1ADSA 1NY1A 4DWSD 4GZIA 3GW0A 4BWLA 1TV2A 2D2OA 4LALA 3EDJA 4HNVA 3RXZA 5K9XA 3RRAA 1YPIA 1FWWA 3C2EA 3KCLA 2GDQA 4ERGA 1REQA 1SO6A 4IP5A 1MYRA 1XLGA 2X41A 1W9XA 2HS8A 4KIRA 3GX9A 2DZUA 1DVJA 2FJKA 1ISXA 3FJ6A 5J5DA 2A3LA 4KEZA 3VMPA 2HROA 3TTYA 3OHMB 2QS8A 1PYMA 2PWEA 4RPPA 4XZIA 1YI2H 1BF6A 2YOCA 4OTKA 3VABA 1F6KA 4N6FA 1TUXA 1LLZA 1CXHA 1BKSA 3WLHA 2C0AA 1P7TB 3S0CA 1HNYA 4PGLA 1JVNA 3BCFA 1KCZA 4BEUA 3ZT6A 3TA9A 3TYCA 5AHNA 4HMDA 3CNYA 4PH6A 3T2PA 2X7WA 4LRSA 4AWEA 1N8WA 4JS3A 5AYYA 1H49A 3KOWA 3WEOA 1H7NA 1ZHAA 4XZ9A 1E1CB 1UWIA 4AXNA 4J2PA 4HMNA 5E9XA 4PMJA 4RZ4A 3S2LA 4IGNA 1MEWA 3UZ5A 4JQ3A 4WFAJ 2V3DA 4ILSA 3E74A 3CJPA 2QAPA 4WY0B 1EOKA 3TP4A 1QVGH 1QNVA 4LGXA 3TQPA 1IEVA 4PMDA 1YXDA 2W67A 4LV9A 4GA4A 1JUKA 3A3XA 4PCTA 4S3CA 3KZPA 2PCEA 1KCLA 2J78A 3T9PA 1AG1O 3WEMA 4FZIA 1QHZA 4DBWA 1NDZA 4WFNJ 2CXGA 3M0JA 5HNTA 3T09A 2O4MA 4UQBA 1OCNA 1G01A 3LI0A 5E5CA 3DI1A 1UD4A 3ITXA 1MW1A 1KNWA 1SIJA 4AISA 2EEXA 1W56A 4KPLA 4NJGA 4RK8A 3SAZA 4GUJA 4UTUA 4LNCA 3E5BA 2GJXA 4XZHA 4C6KA 3VD9A 3GSMA 4B5VA 1SZFA 4A3YA 5JVLA 1V3LA 2DFAA 1SZGA 1JG9A 4FLOA 1BXCA 1V6VA 1E70M 2X1SA 1AW5A 4QQUA 2ANUA 2WPBA 2QUVA 3DHFA 3ZWTA 1A5BA 2CWNA 5T9CE 2QEXH 2PF0A 1FA2A 3MMWA 4KWVA 3L4PA 1A0EA 3EUB4 4JTAA 3C0LA 1BEUA 2BOFX 5LIXX 1OCJA 5MKGB 4G9PA 3QPZA 1ZQ5A 3G8EA 1XLBA 3CAKA 1S2UA 3R11A 3DI0A 3K46A 1OABA 3W72A 2GSHA 3OZPA 3NO5A 3A4XA 3VI2A 4GUFA 4G1KA 2OYLA 1KFLA 4KCVA 3VU2A 4B4FA 4F9DA 1DJXA 3RAOA 1L6YA 3SY8A 4CU8A 2P50A 2DZBA 2KAUC 1FWDC 4C6DA 2HDJA 2DZPA 3AM9A 3P0WA 4P7RA 1HJXA 3DAQA 1XI3A 4JQ2A 3ZLGA 1FBAA 3V5CA 4W88A 3BPWA 2QIEA 4GPNA 3TK7A 1YHQH 3NEVA 4M80A 1BGAA 3G6EH 1RBAA 5DM7J 3WMLA 1LBMA 1KXHA 2BHYA 1IV8A 1OFQA 1RY0A 1Z69A 3M46A 4MUPA 4DAIA 1IZJA 1XKJA 3EOOA 1E4MM 2OWCA 4JDBA 1Q7ZA 2J74A 1EPVA 3QMRA 1ZCCA 3VNJA 1XLHA 1C7TA 2VP8A 3ZR4A 4Q32A 1K73J 3V18A 1WXZA 3SY1A 2UBPC 1UMYA 1UUMA 2YSWA 1Q3NA 4EP8C 1JAKA 1WZMA 5F4WA 4M6VA 5C2XA 2OT0A 4LCSA 4UMCA 1HZYA 3GKAA 2DT0A 2PD9A 4W5UA 5HR7A 4U33A 1JYXA 1X6UA 2J79A 1W9VA 1EGVA 1MRQA 3WUEA 3CT7A 2HVMA 2WM0A 5GJPA 3N29A 3T8LA 1JCYA 3IUDA 4U3AA 2NQ9A 4FMVA 3QTGA 4JOMA 5FI8A 1KM1A 4HNOA 4RDZA 4V27A 3EB3A 1CXIA 1EIBA 3CCLH 3ENLA 2OKOA 2AMXA 1QAPA 4Z2KA 4GYPC 2IKGA 5FL1A 3U6WA 1TWWA 4AY8A 2DY3A 2EAWA 4BQ3A 3UF9A 2PF8A 4HPNA 4NZ1A 2JF6A 2V5DA 4ADUA 3DGBA 4DJDA 2X2GA 2FMNA 3INPA 5FF2A 5FACA 5G4EA 4S39A 3WLKX 1K7FA 3JRKA 4C60A 2W3SB 2ZRVA 4HTBA 1Q45A 3IJIA 2ATMA 1BRLA 3AWNA 3L7RA 1XBXA 2Y89A 1FVPA 3S46A 4BS0A 3VO0A 1B4KA 2GJNA 4FSAA 2V69A 4B5XA 2VT0A 3V0UA 3GR4A 1TPFA 1R7OA 4AD0A 2UY4A 2CLMA 4HNTA 3TFCA 3BLOA 5LYRA 1IWPA 2Y5EA 1PB0A 4QJ4B 1S1RA 3MWAA 2QNEA 1MNSA 1YPFA 3E38A 3L23A 1QW7A 6TIMA 3MBFA 1PE1A 1S3TC 3FJNA 2DZWA 1Q6QA 3FFSA 4JY9A 3UXLA 3OGSA 1Z3NA 2FZNA 3BAKA 4AZBA 2VRKA 4LVAA 3PBGA 2PS2A 3NL5A 3CZJA 3SUUA 2D73A 4HZ8A 3IVSA 2DZVA 2DJXA 2V6AA 3SFWA 4KH2A 2WVVA 2OGYA 1ME9A 4K38A 2ZTKA 3IJ9A 3I3EA 3EPNA 1DXEA 4XAYA 2WBKA 5K4XA 5D4YA 5ECVA 5H8UA 1WNOA 4QG6A 4X63A 2VGFA 4C6OA 1YLVA 1MEIA 3HTWA 4K36A 2XGZA 2XPKA 4WXZA 4B3KA 4H2HA 1JZ2A 1R9YA 3MCNA 5I3FA 1R38A 1N5XA 4WXYA 5D8ZA 4S23A 3M0HA 2E9LA 4TTUA 3SFKA 2DU2A 2OSWA 3U2CA 3N9SA 5HNNA 4TVUA 4AIOA 1UP2A 1CGYA 1JGMA 3USZA 2I17A 2PTZA 3LCXA 2GOUA 4L64A 3LERA 2WKJA 5FL0A 3SUTA 2JFEX 4UUIA 2ZJRJ 3WLQA 2RDUA 4FOKA 2OLSA 1DWHM 3GG1A 3GXDA 4IQJA 3QLLA 4BY3A 2JGYA 2E77A 4ZTXA 4ZOBA 1OT2A 4B5WA 2B7NA 3L67A 2WZMA 4D6JA 3N25A 1EFZA 3WMCA 3WL0A 3TNOA 1DWAM 1K7XA 3M5YA 4GD0A 1V7YA 3URBA 5E93A 1CT5A 4PL2A 4L6DA 1XGDA 3AIWA 1XLLA 2FPYA 1ZAIA 1W9UA 5EU9A 4H9TA 1DWJM 1Q7QA 1J79A 2FTPA 3CAQA 4I8DA 3SECA 1K70A 2BODX 5XIMA 4MUZA 2P53A 1TPUA 1SQ7A 1IXPA 3N3TA 2NQ5A 5I3GA 3BL3A 3UW6A 2Q3RA 4P8UA 2PDMA 3G1AA 1QI2A 1YKWA 2A21A 4XIAA 3C3NA 2DSUA 1WDSA 4CNNA 1DJYA 1O5XA 1YDOA 1XFBA 1A0CA 3NUKA 2P0IA 1ZGDA 3ARUA 4QNWA 3I55H 3IUIA 5CH9A 5GNZA 4MB4A 2A3BA 2XGBA 2GDUA 1SFTA 2XDFA 4I5XA 1MDLA 3KRZA 2J7FA 1M90J 1V0NA 1B3VA 2BDQA 3MC5A 2XWDA 3BAWA 2ACUA 2QAFA 5CEWA 3RYSA 4NKCA 1L6SA 3M5ZA 4UFLA 3WX7A 3GWQA 2ZVIA 3G1HA 3R5EA 4WJXA 1XW8A 3D3AA 3IIVA 3CV2A 4OBSA 1WOAA 5I02A 2X7VA 1CGVA 2O4QA 1GEQA 2XFFA 4GQ0A 2WAGA 2E4TA 2WP4A 3EPOA 4HU3A 1TE6A 3C8FA 3VUSA 2YXOA 3RR4A 1O6IA 5DMNA 1FDYA 1W5NA 3IJDA 4CU6A 4NU7A 5I3HA 3MMTA 3LMZA 3W7IA 1CBGA 3CH0A 1QI5A 3W1PA 1SSGA 1WXYA 4KCTA 1TKKA 4LS1A 1JCLA 1H7XA 2NT1A 3TJXA 4MZ8A 2ODOA 5KETA 4XO7A 5IM51 4MY8A 3DKLA 3ZIZA 4DM1A 1RPKA 2VEIA 4XD6A 3APTA 2ZADA 3VOFA 2XH0A 2NSOA 1DIOA 3Q94A 4NAFB 5ABFA 4KEUA 1B1YA 4HYRA 3PTKA 4XZLX 2CXEA 1X38A 5FJIA 4AZ7A 1SZNA 3PZNA 5AN7A 4CVWA 1CZ1A 1V3MA 3N17A 5FESA 3SJ3A 4ATLA 3U4FA 3LLDA 4JDYA 3LCWA 3ABXA 1U30A 1UWUA 4KWWA 4OU1A 4JHOA 5AHMA 4FF5A 3VDBA 2BSLA 5FAJA 1Q81J 3N2BA 4XAZA 3PAJA 3LHTA 2P76A 3WQCA 4W8BA 2RUSA 3H2OA 1E6NA 2NUXA 3JUGA 2CKRA 4BK9A 2GQAA 1TJRA 2YCJA 3ITCA 2QCCA 3HMCA 2G41A 3QPYA 4FXSA 5H91A 4WEVX 5A6KA 3STPA 1HKVA 4A3UA 3I65A 1VBHA 4JTIA 3I4EA 6REQA 3CCJH 2QJHA 4A8RA 1OX4B 1P1MA 2OU4A 4GIAA 2IQDA 4F2BA 3SSZA 4L80A 3UT0A 3T55A 4LUYA 4EXAA 4JZ5A 3R94A 5E6ZA 4TIMA 2ZE0A 3CUFA 2BXYA 4JX4A 4C6LA 2FJUB 2QF8A 4QE4A 3BICA 2Q8ZA 1IEXA 2FLIA 4F2TA 1LROA 2WMJA 1T99A 2OKTA 1DJGA 1Z8AA 4PCPA 3LI1A 4PSRA 2VXNA 1WB0A 4B15A 2DVXA 1NARA 4JKLA 2HPIA 4LEFA 3OIHA 4H8VA 3V75A 5EPDA 1V0KA 1DXFA 4ORIA 5BU6A 4A22A 1W3LA 2OXNA 1EDQA 4A2RA 4C6JA 4S2CA 4RZBA 5A6MA 4AIUA 1MVYA 4C1LA 3OVQA 4XBSA 2P0OA 4JL2A 5T26A 1HUVA 4RV3A 4I90A 3UYIA 3NOYA 4NSBA 1GONA 3W28A 1OX5A 3IIZA 4XG1A 3LOTA 4MOZA 1ODZA 2E0PA 4U5IA 3CUIA 4KWSA 1FWBC 2E28A 1NP2A 4DM2A 1EJRC 4O1CA 2CZ5A 2D3NA 2O0TA 2WZHA 2ZA2A 4QSFA 6XIMA 3THUA 3EOLA 4O4WA 2RDWA 4MDOA 1CECA 3E96A 3TZFA 1OD0A 5DMYA 4GXMA 3EEZA 4MY1A 4EAFA 3A24A 3CIXA 3TV8A 3GU9A 1W1YA 1HL9A 2E25A 1CX9A 5LNUA 1N63B 4BQ4A 4PCNA 2NXIA 3KTXA 4EAMA 2FHCA 1UCWA 1KXQA 2WNQA 3QGAC 1Y65A 4F0KA 1VRXA 1UIOA 1TZ9A 4EANA 2V2CA 1IYXA 1HKWA 4IJRA 2BFGA 3MZ2A 4C6CA 3TYDA 2NW0A 3E0LA 4TO8A 2QHAA 3CWHA 3A4AA 1RBOB 3VIKA 2O9PA 3LMYA 3V0TA 2ZZ1A 2Q6ZA 2BB0A 4GX9A 2HJPA 3AXKA 3BO9A 3M07A 3BJTA 1M7PA 3CQJA 3KVLA 3KBMA 3KLKA 4C91A 3BCJA 1KCKA 5I24A 5C6MA 1S38A 4BI7A 1B4EA 3LPGA 7TIMA 2JE8A 2BVYA 4U3CA 3V16A 3LB0A 2FKPA 4MJZA 4C7YA 1K7EA 3MMUA 1W3JA 3QOKA 3NQBA 1JZ6A 4BR1A 3CCEH 2J7EA 4S2BA 3W1MA 3CK5A 1TZZA 3HQOA 4M19A 4YU1A 2PMQA 1R3TA 3MYOA 1HW6A 1C8XA 3S8HA 4H83A 2WNZA 1SMAA 4I9MA 3GLCA 3UWQA 3HF3A 1GQLA 3NA8A 3BAJA 3UA3A 3WQ6A 4LBSA 2F6KA 7ENLA 2OWWA 5MKGA 1W5OA 3LCHA 4FP1A 1LM1A 3LZ5A 3VIMA 4FEZA 1XWYA 5DT5A 3WMSA 5EY5A 3EWWA 3BE7A 4N9BA 4YYCA 3VA8A 1JCTA 4L65A 4OFCA 2G97A 4IOTA 3CCVH 4YWIA 1AUSL 4F0LA 2HNHA 1LF1A 4GFIA 3K1GA 3VCRA 1YNQA 1NTHA 3PJXA 4HOXA 3UPMA 1I8JA 5HWMA 3UZYA 3T40A 3NS1C 1V4YA 1OJXA 1KBKA 3AFBA 1UKTA 3B0XA 4JPGA 2QPXA 1GNXA 2JK2A 3SCUA 1XF0A 1TR1A 4AMAA 4YTRA 3GYEA 4C6PA 3APYA 3IJ8A 1KM6A 3W2NA 3WQ4A 3WF0A 1H5YA 3G22A 1WO2A 2QJIA 1TRIA 4V33A 4D72A 4LQ1A 1XKYA 3L0NA 3OTRA 1PPIA 5GQBA 4JIEA 4NYUA 3CO8A 4WOZA 3RGTA 4W84A 1OC6A 2PA2A 1SFLA 2XH4A 4UTJA 2OCZA 4AB4A 3QW4B 4X22A 2R1MA 5LNRA 4Q4SA 1VQMH 2CW6A 4JAWA 3TN6A 3EWYA 1ZRQA 5J5RA 2WV8A 3QXBA 5BXTA 3LNMA 4UTTC 3BG5A 4AD2A 5K9DA 3ZZ1A 1OADA 2WYSA 3COTA 3NPUA 2NQLA 1AJZA 3OIXA 2VR5A 2FDSA 2BOEX 4G2DA 3VNMA 3CMGA 1MNZA 1P7TA 1ZBWA 1KC7A 4CD7A 1F6YA 1OINA 3VNZA 4JTSA 2BP1A 5C2GA 1HGWA 4IL0A 3HIJA 3N2OA 4UMBA 4S3FA 4OOZA 2O9RA 1FWCC 1EOMA 1IT8A 1PKNA 5CPMA 4ZQMA 1QU4A 3QY7A 1CWYA 2WC4A 1IEIA 2BMBA 4YCPA 1GZJA 1I2PA 2EJ1A 1OYCA 2RJGA 4A35A 3WNMA 5HOSA 5E0FA 3MI3A 1O60A 1SW3A 3CZLA 3NGJA 4DY1A 3IANA 4MWAD 1R9XA 2J7CA 2MANA 4JKMA 3OJGA 1W8GA 3QC0A 1ICQA 4IFKA 5HINA 3NSNA 4NVTA 3HO8A 3R8RA 1PWMA 5C9ZA 1OGSA 3W25A 3PBUA 2J9YA 2YDQA 3VIOA 2IKIA 1NWSA 3NL3A 4E8DA 4R7WA 4LCQA 5HQEA 3PS7A 4O16A 4QP0A 3CF5J 1QOXA 3QFEA 1M03A 1UA7A 3NTYA 3VD7A 1V51A 5I06A 5XIAA 3AXMA 3HA1A 1I2OA 3B8UA 2JF7A 1BWLA 3CPUA 4U4MA 3EA1A 3UZZA 3HB9A 2FFCA 4HCHA 4LBRA 1XLIA 3RHGA 2YLAA 3AIRA 3U2OA 2A1YA 3WG6A 2WK6A 4IG2B 3VTRA 5CPQA 3H24A 1DORA 2FDMA 1B3WA 3GU2A 3BGGA 4AIBA 1OSEA 2OB3A 2AKZA 2PWVA 5AC4A 1KTCA 4NRRA 1OX6A 1F61A 4QSHA 4UOJA 4GLEA 5AFDA 1XH2A 1PBGA 4J2MA 2YJQA 3NQEA 1EXBA 4HZ7A 3E9AA 4ORMA 3LTSA 1VB9A 4IMDA 4AHOA 8RUCA 1XDJA 4HMEA 5AC7A 1KFJA 1W5QA 3W02A 2G3FA 1UZ1A 3SQSA 4K1GA 4RKAA 1UQYA 3T4WA 1XLMA 3B03A 3MW7A 4DF2A 1B90A 4H6EA 1JDEA 4GVIA 2Y88A 3XIMA 4WDTA 2C6QA 2YPIA 3SIMA 2PC4A 3ZS4A 2EHHA 1M41A 4P8XA 3QY8A 4OHQA 4Z2LA 3B9JC 1WAUA 8TIMA 5DXYA 4IUOA 4AFYA 1XSJA 3RPDA 4DELA 1QW8A 3DCPA 1TJ2A 4HB7A 4IZGA 5FF4A 1LYXA 3TNBA 2NVDA 3AROA 3W7DA 1A5CA 5IBXA 4GHRA 3EDFA 1JF6A 3L68A 3SQMA 3KVKA 4K1WA 1MUWA 1GG1A 3NM3A 2NVAA 4WY0A 3KRBA 3TX9A 2GVGA 1GVIA 2EPHA 1ITQA 3TYUA 4DJFD 1LCOA 4X2RA 3IACA 3RX3A 5HL7J 4C7FA 3RMJA 3RX4A 3PG8A 1JCJA 3GFZA 2RGMA 3ATZA 3GC4A 1XDMA 4DVOA 2WHLA 2GUBA 4XUYA 1MW2A 2WJZA 3W7JA 4AWSA 4NAEA 3U8GA 4DZ5A 1H7WA 1TO3A 2I1OA 5I7GA 4ZB5A 4Q4MA 1NAL1 3RFAA 1RVGA 3CUGA 4HN8A 2BBFA 4LT9A 1VCFA 2CLLA 1KGXA 4HN4A 1IF2A 2W9MA 3GHSA 3M16A 4WY0F 1AD4A 1AH3A 3I56H 1JUEA 4KWUA 2DP3A 4R33A 1PZ2A 1PZ3A 5KTLA 3OBAA 4S3JA 5KZ6A 1KRAC 1YDYA 4OJYA 2ZBTA 1LOSA 3VGEA 2XVNA 2J7BA 3RJYA 2POZA 2CHRA 3GNPA 3LCIA 5CZTA 2ZRZA 4W7WA 4HK7A 3HMJG 3P82A 3WBEA 2W62A 4CUCA 4QQ3A 1WDRA 1WDQA 4L1XA 1UH2A 3MI2A 3H22A 3PBVA 3MSYA 1UWTA 3WD4A 5G2HA 3CZ8A 3WH7A 4OQVA 1ZZMA 3H4XA 4I6VA 1YNYA 4YVXA 4JEJA 4JTKA 2EO7A 1UKPA 4N9EA 1GW9A 1SR0A 4K8HA 2PODA 1POKA 5IHSA 3M6DA 4H9VA 4US6A 4OWGA 4KCUA 3QHOA 1V97A 5JH2A 4S3BA 2I7GA 4MZYA 3TR2A 1RK6A 2I14A 3T0AA 3H7RA 1UPMB 3H4WA 4FR6A 2F7FA 3FLUA 4GINA 1P0BA 1JFXA 4YXGA 4J1OA 1LRQA 4DAFA 3AXHA 3WK3A 3AZSA 3C2VA 1QI0A 2ZX6A 3DERA 3ZVIA 4E4PA 5FCZA 1WDWA 1PSCA 1ISVA 1O94A 3IWPA 5A6AA 4IP7A 1C91A 2Q8LA 4ATDA 2VUYA 1H09A 1N8IA 4A3QA 2I16A 3VUPA 4P7QA 3TXVA 1Q6DA 2YCIX 4NI8A 4ZR8A 3AJXA 3LXBA 3VDHA 2CLKA 3VDGA 1YTDA 3SW6A 5JH1A 2EPOA 3ES7A 4RNIA 2CETA 3N13A 1KV5A 4F40A 3UR8A 4IFKB 2WVSA 2MUCA 3QQ0A 3LQGA 5EL1A 3WDRA 4Y96A 1KXVA 3OODA 2W55B 1T5AA 3UCCA 3BW2A 4YYYA 4HCLA 1KRMA 1XIGA 4XD3A 4M1BA 3HGRA 3AWOA 3WQDA 5D9MA 5CBBA 2WMIB 4P7NA 3KAOA 2OQLA 1O68A 2KX9A 1F05A 4CKQA 4D6HA 1KV8A 2GOKA 3MT1A 1IT0A 2QV5A 1S5VA 3DYPA 4UMAA 4MPQA 1KFBA 4M51A 1NDVA 4CQBA 5LIKX 2VWTA 2VCBA 1LRTA 3WDHA 1ZFJA 4YN5A 3AUOA 4H9MA 5CZSA 2ACSA 3C0JA 4AF0B 1GVSA 2H3DA 3H55A 1F3EA 3L5LA 3U7VA 1B5TA 1X6LA 3SCPA 3WNLA 9XIAA 5BOFA 3OLDA 2QF7A 2W4XA 3M6YA 3U3HA 4D1IA 2QLYA 4AUBA 3L2IA 3EGJA 3W53A 2DVTA 2WJDA 3KFTA 5BROA 3MV01 3VZZA 4DQWA 4C6BA 4RCXA 4Q6XA 3CMEH 3R1ZA 4C7ZA 4RDYA 5BU9A 2ZX7A 3OVGA 3QGVA 1MDRA 3CGTA 1XIDA 4Q4RA 4NILA 5D04C 3URAA 1MXSA 1CTNA 3U5UA 4LVGA 4Y7EA 1HL8A 1FH9A 3QVQA 1AMKA 5CPSA 4GG9A 4EWJA 3BLDA 4AWTA 3KHJA 3SM0A 1I0DA 3VIGA 5CC3A 1PCKA 3PSWA 2G37A 3QV6A 2DQWA 2WQPA 3O63A 3KRUA 4GNVA 1TVLA 3NQCA 4K8EA 4Q8TA 2PA6A 2OJPA 1VQKH 5DY2A 3CC2H 3ARWA 1YJNH 3CWOX 2CLHA 3HJEA 3E1F1 3WFZA 2VVSA 3AO0A 1QNQA 4N9DA 1TPC1 1TCMA 3C2RA 3V5OA 4GA5A 1YIJH 3MKCA 5M17A 3PTDA 2W3ZA 2X05A 4DJDC 3HGJA 2WCAA 1EJWC 4IHCA 3GXPA 1V79A 2WVUA 5FJUA 3LZ3A 4IFRA 3K4AA 1G67A 1UWAA 1K6AA 3TOYA 4GUHA 4JIPA 4HSNA 2VO5A 2YZRA 3GFYA 5AOUA 2QCNA 2BASA 3GNDA 1FWIC 3H4GA 1CGTA 2GUUA 3DYOA 2OODA 2OOFA 2Y85A 4UC5A 1KQYA 5DX7A 1TUFA 1W5MA 4YVVA 4GI8A 4D8LA 3PM6A 1KO0A 2VC6A 3IIOA 4FF7A 1IGSA 4WSKA 3M9YA 1Q13A 3EWDA 3B9AA 5GVJA 1V3IA 1B54A 5KEZA 5HNUA 5E6YA 2TMDA 3AMDA 1TQJA 1OHLA 4H00A 3VD4A 4L61A 3GNXA 4CCCA 3RK8A 1Q85A 4YHEA 2PTYA 4NASA 1FWAC 3W23A 4HU4A 2PD5A 3SUSA 3UXAA 1VCVA 4MG4A 1GCYA 4Y9MA 2C18A 5H6HA 2V30A 4OECA 2E6FA 5XINA 3LGDA 5AC5A 3ANVA 3ICJA 4ZE4A 1R3YA 2WMKA 1E9ZB 1K03A 4XZWA 3CPWH 1EQCA 4E3TA 2O55A 1NOUA 3TLLA 4M3PA 4NZCA 3WLRA 1EJSC 3LA4A 3DDMA 2FHBA 1N7KA 1E0XA 2PPGA 4LSBA 3WJWA 2ZXQA 2PDQA 4LRTA 2BY3A 4DLMA 4XTIA 1F2JA 3SCWA 3CL7A 3W00A 2A6LA 4D2JA 4ZO6A 2R1KA 1EB3A 3FY1A 3FSTA 3W37A 1ZS2A 1HL2A 4NZFA 1US0A 1FY6A 3HM7A 2W6RA 1GT8A 1RQEA 3U7BA 4G56A 3VMOA 4LH8A 1PJ9A 1RLCL 1WAWA 2Q09A 3VC5A 4JY8A 1GVYA 2XIIA 5JIPA 4WUIA 3PJWA 4EADA 3HQNA 4LUSB 3VD5A 5I2UA 2ZXDA 1OWQA 3TUUA 2UY3A 5DT7A 3DG3A 3S6TA 4LOCA 3BW4A 1ICPA 1PZ0A 5FIPA 1TELA 3TU9A 1UR9A 1XRTA 3PK7A 3W73A 5EFDA 5HMEA 2NX9A 4M0XA 1J10A 5DMLA 1M1KJ 4JTJA 1BG9A 2E8YA 2G8ZA 3BCDA 1R8LA 4OE7A 2RDXA 2F6UA 3IGXA 1XM3A 5HQMA 1RBLA 1LUCA 3GM8A 4K7YA 4HSHA 4PMOA 1AL8A 3OA5A 3GU1A 1HGYA 2E40A 3B4UA 1UHVA 1GKQA 1REQB 2PB1A 3ALFA 2VQTA 3BWWA 3EXTA 3ZT7A 3JR2A 1E6ZA 4GI4A 5CBIA 3AMCA 2XVLA 5I3IA 1TX0A 3PBMA 3GHTA 3UVIA