1YIJH

Crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
171
structure length
160
Chain Sequence
b'KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 39
structure length 160
sequence length 171
ec nomenclature
pdb deposition date 2005-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00252 Ribosomal_L16 Ribosomal protein L16p/L10e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 1yijH00
5GAHN 4WF9J 3CF5J 5JVGJ 1NJIJ 1S72H 4UY8M 4U67J 1M1KJ 3G4SH 5JVHJ 3PIPJ 3CC4H 1Q86J 2OTJH 4WFBJ 3J7ZM 5H1SO 3I55H 3PIOJ 1M90J 3CXCH 3CCUH 3CCMH 4WFAJ 1K73J 1Y69K 1VQPH 5DM7J 1KQSH 3CCRH 2ZJRJ 2ZJQJ 1YIJH 1Q7YJ 1VQ6H 1VQ5H 5HL7J 1VQ8H 3G71H 3CCQH 2OTLH 2PA2A 3CCSH 1YI2H 2QA4H 4IOAJ 1YJWH 3CD6H 5GADN 1KD1J 1W2BH 1VQLH 1JJ2H 1VQ9H 3CCLH 1Q82J 4IOCJ 1Q81J 5MLCO 1K8AJ 3CPWH 1K9MJ 3I56H 5GAGN 3CMEH 5AN9F 1VQOH 3OW2H 1WKIA 4WCEJ 3CMAH 3CCVH 1YJNH 1QVFH 5GAEN 5DM6J 3CCJH 4IO9J 1VQNH 3CC7H 2QEXH 1KC8J 1VQKH 1VQ4H 1N8RJ 1YITH 3G6EH 1VQ7H 1YHQH 3CC2H 3DLLJ 4WFNJ 1QVGH 3CCEH 1YJ9H 1VQMH 2ZJPJ
chains in the Genus database with same CATH superfamily
5GAHN 2W54B 4WF9J 3CF5J 1DGJA 1FM0E 1X1OA 5JVGJ 1NJIJ 1YTEA 1S72H 5AYZA 4UY8M 4U67J 3L4PA 3G4SH 1N60B 1M1KJ 5JVHJ 2JBMA 4C7ZA 3PIPJ 3CC4H 3WNZA 3C2VA 1Q86J 2OTJH 4WFBJ 3J7ZM 5H1SO 2B7PA 3I55H 3PIOJ 1M90J 3AMZA 3CXCH 4US9A 3CCUH 3ETRC 1N5XA 1UOUA 3CCMH 4US8A 1K73J 1Y69K 1VQPH 4X46A 4KWVA 1NVIE 5AYYA 1JRPB 2W3SB 5DM7J 2ZJPJ 3FC4A 1KQSH 2E3TA 3CCRH 2ZJRJ 3H5QA 2ZJQJ 1YIJH 1SB3A 3B9JC 3NVVC 3PAJA 1SIJA 1FFUB 1V97A 1Q7YJ 1VQ6H 2I1OA 4YYYA 1WYGA 4C7YA 4YEKA 4LHMA 1VQ5H 4I9AA 5HL7J 1VQ8H 2I14A 1VDVA 1AZYA 4EAFA 3G71H 3CCQH 2J0FA 4USAA 2OTLH 5HUOA 2PA2A 2W55B 1QPQA 4XR5A 3CCSH 2QA4H 3C2FA 3VMMA 1YI2H 1YJWH 4IOAJ 5HULA 3CD6H 1QPOA 5GADN 1VLBA 3NRZC 1KD1J 1FFVB 2B7QA 1W2BH 2WK6A 1VQLH 1JJ2H 1VQ9H 3NS1C 1FMAE 3GNNA 1ZXIB 3CCLH 1Q82J 4IOCJ 1N62B 1Q81J 3AM9A 2B7NA 5MLCO 4KWWA 5MPOC 3NVWC 1QPNA 1K8AJ 1NVJA 3CPWH 3L0GA 3TQVA 3I56H 1K9MJ 1RM6A 5GAGN 3CMEH 5AN9F 2DSJA 3SR6C 5HUPA 4AP8A 4GA4A 1WKIA 3OW2H 2WP4A 1VQOH 3AN1A 3C2EA 4C80A 4WCEJ 3CMAH 3CCVH 1YJNH 1QVFH 5GAEN 5DM6J 3CCJH 4GA6A 4IO9J 1VQNH 1JROB 1BRWA 3CC7H 2QEXH 1KC8J 2OMDA 1QPRA 3BIIE 2TPTA 3WO1A 1VQKH 1VQ4H 2QIEA 1OTPA 1N8RJ 1O4UA 1N61B 4GA5A 4ZOHA 3G6EH 1YITH 1N5WB 1YTKA 4EADA 3C2RA 1VQ7H 3FAHA 1YHQH 3C2OA 2Q5WE 5AYXA 3CC2H 3DLLJ 1N63B 4WFNJ 1YTDA 1QAPA 2WK5A 3WO0A 1QVGH 1FIQC 3CCEH 5EY3A 2W3RB 3RPFA 1YJ9H 3EUB4 1FO4A 1VQMH 5EP8A 4WFAJ 3NVZC 3NVYC
chains in the Genus database with same CATH topology
5GAHN 4WF9J 3CF5J 5JVGJ 1NJIJ 1S72H 4UY8M 4U67J 1M1KJ 3G4SH 5JVHJ 3PIPJ 3CC4H 1Q86J 2OTJH 4WFBJ 3J7ZM 5H1SO 3I55H 3PIOJ 1M90J 3CXCH 3CCUH 3CCMH 4WFAJ 1K73J 1Y69K 1VQPH 5DM7J 1KQSH 3CCRH 2ZJRJ 2ZJQJ 1YIJH 1Q7YJ 1VQ6H 1VQ5H 5HL7J 1VQ8H 3G71H 3CCQH 2OTLH 2PA2A 3CCSH 1YI2H 2QA4H 4IOAJ 1YJWH 3CD6H 5GADN 1KD1J 1W2BH 1VQLH 1JJ2H 1VQ9H 3CCLH 1Q82J 4IOCJ 1Q81J 5MLCO 1K8AJ 3CPWH 1K9MJ 3I56H 5GAGN 3CMEH 5AN9F 1VQOH 3OW2H 1WKIA 4WCEJ 3CMAH 3CCVH 1YJNH 1QVFH 5GAEN 5DM6J 3CCJH 4IO9J 1VQNH 3CC7H 2QEXH 1KC8J 1VQKH 1VQ4H 1N8RJ 1YITH 3G6EH 1VQ7H 1YHQH 3CC2H 3DLLJ 4WFNJ 1QVGH 3CCEH 1YJ9H 1VQMH 2ZJPJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAH N;  4WF9 J;  3CF5 J;  5JVG J;  1NJI J;  1S72 H;  4UY8 M;  4U67 J;  1M1K J;  3G4S H;  5JVH J;  3PIP J;  3CC4 H;  1Q86 J;  2OTJ H;  4WFB J;  3J7Z M;  5H1S O;  3I55 H;  3PIO J;  1M90 J;  3CXC H;  3CCU H;  3CCM H;  4WFA J;  1K73 J;  1Y69 K;  1VQP H;  5DM7 J;  1KQS H;  3CCR H;  2ZJR J;  2ZJQ J;  1YIJ H;  1Q7Y J;  1VQ6 H;  1VQ5 H;  5HL7 J;  1VQ8 H;  3G71 H;  3CCQ H;  2OTL H;  2PA2 A;  3CCS H;  1YI2 H;  2QA4 H;  4IOA J;  1YJW H;  3CD6 H;  5GAD N;  1KD1 J;  1W2B H;  1VQL H;  1JJ2 H;  1VQ9 H;  3CCL H;  1Q82 J;  4IOC J;  1Q81 J;  5MLC O;  1K8A J;  3CPW H;  1K9M J;  3I56 H;  5GAG N;  3CME H;  5AN9 F;  1VQO H;  3OW2 H;  1WKI A;  4WCE J;  3CMA H;  3CCV H;  1YJN H;  1QVF H;  5GAE N;  5DM6 J;  3CCJ H;  4IO9 J;  1VQN H;  3CC7 H;  2QEX H;  1KC8 J;  1VQK H;  1VQ4 H;  1N8R J;  1YIT H;  3G6E H;  1VQ7 H;  1YHQ H;  3CC2 H;  3DLL J;  4WFN J;  1QVG H;  3CCE H;  1YJ9 H;  1VQM H;  2ZJP J; 
#chains in the Genus database with same CATH topology
 5GAH N;  2W54 B;  4WF9 J;  3CF5 J;  1DGJ A;  1FM0 E;  1X1O A;  5JVG J;  1NJI J;  1YTE A;  1S72 H;  5AYZ A;  4UY8 M;  4U67 J;  3L4P A;  3G4S H;  1N60 B;  1M1K J;  5JVH J;  2JBM A;  4C7Z A;  3PIP J;  3CC4 H;  3WNZ A;  3C2V A;  1Q86 J;  2OTJ H;  4WFB J;  3J7Z M;  5H1S O;  2B7P A;  3I55 H;  3PIO J;  1M90 J;  3AMZ A;  3CXC H;  4US9 A;  3CCU H;  3ETR C;  1N5X A;  1UOU A;  3CCM H;  4US8 A;  1K73 J;  1Y69 K;  1VQP H;  4X46 A;  4KWV A;  1NVI E;  5AYY A;  1JRP B;  2W3S B;  5DM7 J;  2ZJP J;  3FC4 A;  1KQS H;  2E3T A;  3CCR H;  2ZJR J;  3H5Q A;  2ZJQ J;  1YIJ H;  1SB3 A;  3B9J C;  3NVV C;  3PAJ A;  1SIJ A;  1FFU B;  1V97 A;  1Q7Y J;  1VQ6 H;  2I1O A;  4YYY A;  1WYG A;  4C7Y A;  4YEK A;  4LHM A;  1VQ5 H;  4I9A A;  5HL7 J;  1VQ8 H;  2I14 A;  1VDV A;  1AZY A;  4EAF A;  3G71 H;  3CCQ H;  2J0F A;  4USA A;  2OTL H;  5HUO A;  2PA2 A;  2W55 B;  1QPQ A;  4XR5 A;  3CCS H;  2QA4 H;  3C2F A;  3VMM A;  1YI2 H;  1YJW H;  4IOA J;  5HUL A;  3CD6 H;  1QPO A;  5GAD N;  1VLB A;  3NRZ C;  1KD1 J;  1FFV B;  2B7Q A;  1W2B H;  2WK6 A;  1VQL H;  1JJ2 H;  1VQ9 H;  3NS1 C;  1FMA E;  3GNN A;  1ZXI B;  3CCL H;  1Q82 J;  4IOC J;  1N62 B;  1Q81 J;  3AM9 A;  2B7N A;  5MLC O;  4KWW A;  5MPO C;  3NVW C;  1QPN A;  1K8A J;  1NVJ A;  3CPW H;  3L0G A;  3TQV A;  3I56 H;  1K9M J;  1RM6 A;  5GAG N;  3CME H;  5AN9 F;  2DSJ A;  3SR6 C;  5HUP A;  4AP8 A;  4GA4 A;  1WKI A;  3OW2 H;  2WP4 A;  1VQO H;  3AN1 A;  3C2E A;  4C80 A;  4WCE J;  3CMA H;  3CCV H;  1YJN H;  1QVF H;  5GAE N;  5DM6 J;  3CCJ H;  4GA6 A;  4IO9 J;  1VQN H;  1JRO B;  1BRW A;  3CC7 H;  2QEX H;  1KC8 J;  2OMD A;  1QPR A;  3BII E;  2TPT A;  3WO1 A;  1VQK H;  1VQ4 H;  2QIE A;  1OTP A;  1N8R J;  1O4U A;  1N61 B;  4GA5 A;  4ZOH A;  3G6E H;  1YIT H;  1N5W B;  1YTK A;  4EAD A;  3C2R A;  1VQ7 H;  3FAH A;  1YHQ H;  3C2O A;  2Q5W E;  5AYX A;  3CC2 H;  3DLL J;  1N63 B;  4WFN J;  1YTD A;  1QAP A;  2WK5 A;  3WO0 A;  1QVG H;  1FIQ C;  3CCE H;  5EY3 A;  2W3R B;  3RPF A;  1YJ9 H;  3EUB 4;  1FO4 A;  1VQM H;  5EP8 A;  4WFA J;  3NVZ C;  3NVY C; 
#chains in the Genus database with same CATH homology
 5GAH N;  4WF9 J;  3CF5 J;  5JVG J;  1NJI J;  1S72 H;  4UY8 M;  4U67 J;  1M1K J;  3G4S H;  5JVH J;  3PIP J;  3CC4 H;  1Q86 J;  2OTJ H;  4WFB J;  3J7Z M;  5H1S O;  3I55 H;  3PIO J;  1M90 J;  3CXC H;  3CCU H;  3CCM H;  4WFA J;  1K73 J;  1Y69 K;  1VQP H;  5DM7 J;  1KQS H;  3CCR H;  2ZJR J;  2ZJQ J;  1YIJ H;  1Q7Y J;  1VQ6 H;  1VQ5 H;  5HL7 J;  1VQ8 H;  3G71 H;  3CCQ H;  2OTL H;  2PA2 A;  3CCS H;  1YI2 H;  2QA4 H;  4IOA J;  1YJW H;  3CD6 H;  5GAD N;  1KD1 J;  1W2B H;  1VQL H;  1JJ2 H;  1VQ9 H;  3CCL H;  1Q82 J;  4IOC J;  1Q81 J;  5MLC O;  1K8A J;  3CPW H;  1K9M J;  3I56 H;  5GAG N;  3CME H;  5AN9 F;  1VQO H;  3OW2 H;  1WKI A;  4WCE J;  3CMA H;  3CCV H;  1YJN H;  1QVF H;  5GAE N;  5DM6 J;  3CCJ H;  4IO9 J;  1VQN H;  3CC7 H;  2QEX H;  1KC8 J;  1VQK H;  1VQ4 H;  1N8R J;  1YIT H;  3G6E H;  1VQ7 H;  1YHQ H;  3CC2 H;  3DLL J;  4WFN J;  1QVG H;  3CCE H;  1YJ9 H;  1VQM H;  2ZJP J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...