2Q5WE

The x-ray crystal structure of molybdopterin synthase from staphylococcus aureus
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
137
structure length
137
Chain Sequence
b'HMKQFEIVIEPIQTEQYREFTINEYQGAVVVFTGHVREWTKGVKTEYLEYEAYIPMAEKKLAQIGDEINEKWPGTITSIVHRIGPLQISDIAVLIAVSSPHRKDAYRANEYAIERIKEIVPIWKKEIWEDGSKWQGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdopterin-converting factor subunit 2
publication title Crystal structure of a molybdopterin synthase-precursor Z complex: insight into its sulfur transfer mechanism and its role in molybdenum cofactor deficiency.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 38
structure length 137
sequence length 137
ec nomenclature ec 2.8.1.12: Molybdopterin synthase.
pdb deposition date 2007-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02391 MoaE MoaE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.40 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Molybdopterin biosynthesis MoaE subunit 2q5wE00
4AP8A 2OMDA 3BIIE 1FMAE 2Q5WE 5MPOC 1NVIE 2QIEA 1NVJA 2WP4A 1FM0E 3RPFA
chains in the Genus database with same CATH superfamily
1FFVB 1VLBA 1YTEA 3NVVC 1VQ7H 1FO4A 1QVGH 1M90J 2QA4H 3CPWH 5EP8A 1AZYA 3G6EH 3B9JC 3CCEH 1FFUB 2ZJRJ 2WK6A 2E3TA 5AYZA 4KWVA 3G71H 1VQLH 2Q5WE 3CCJH 1WKIA 1YTDA 1VQNH 1X1OA 5HUPA 3WNZA 3AM9A 3AN1A 3SR6C 3CCUH 2WK5A 1SIJA 3FC4A 1S72H 2W3SB 1JROB 2PA2A 2I1OA 3C2FA 2W55B 4WFNJ 5HULA 3C2RA 1YTKA 1QPQA 5AN9F 1N60B 3L0GA 1FMAE 5DM7J 2QIEA 2B7QA 3NVZC 3VMMA 4LHMA 4WF9J 1Q81J 3CCVH 3NS1C 5DM6J 1VQ8H 3CD6H 1NVIE 4XR5A 5JVHJ 1W2BH 5AYYA 2W3RB 4IOAJ 5GAHN 1VQ6H 2OMDA 3C2OA 3CC4H 4X46A 1QPOA 2TPTA 1KQSH 3L4PA 2QEXH 3PAJA 5JVGJ 5MLCO 2WP4A 5GADN 1K73J 1FIQC 1DGJA 1O4UA 4EAFA 2W54B 1YI2H 1Q86J 2J0FA 1KD1J 3BIIE 1RM6A 3PIPJ 4IO9J 1VQOH 4GA6A 3NVYC 4GA5A 4KWWA 4US8A 1JRPB 1YHQH 3WO0A 3NRZC 4EADA 5AYXA 3I56H 2DSJA 1ZXIB 4YYYA 1N62B 2B7PA 1VQKH 1YIJH 5EY3A 1VQ5H 4WFBJ 1YITH 1N8RJ 3CXCH 3CCRH 1YJ9H 5HUOA 1VQ9H 3ETRC 5MPOC 4YEKA 3H5QA 4US9A 4C7YA 3CMEH 4UY8M 5HL7J 4WCEJ 3CCSH 1V97A 2I14A 3WO1A 3RPFA 2ZJPJ 1FM0E 1JJ2H 3GNNA 2JBMA 5H1SO 1QPRA 1OTPA 1WYGA 5GAGN 3CMAH 3CCLH 4IOCJ 2OTLH 1Q7YJ 1YJNH 1Q82J 1NJIJ 1K8AJ 1QVFH 4I9AA 4AP8A 3J7ZM 5GAEN 3PIOJ 3I55H 1QPNA 1Y69K 4WFAJ 3NVWC 1K9MJ 4C80A 2B7NA 4USAA 4C7ZA 1SB3A 1QAPA 1M1KJ 3EUB4 1VQPH 1YJWH 3C2VA 3DLLJ 3CCQH 2ZJQJ 3OW2H 3CCMH 3FAHA 4U67J 3C2EA 1KC8J 1N5XA 3AMZA 3TQVA 3CC2H 3CC7H 1N61B 1VQMH 1N63B 4GA4A 3G4SH 1UOUA 4ZOHA 1N5WB 1NVJA 1VDVA 1VQ4H 3CF5J 2OTJH 1BRWA
chains in the Genus database with same CATH topology
4AP8A 2OMDA 3BIIE 1FMAE 2Q5WE 5MPOC 1NVIE 2QIEA 1NVJA 2WP4A 1FM0E 3RPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AP8 A;  2OMD A;  3BII E;  1FMA E;  2Q5W E;  5MPO C;  1NVI E;  2QIE A;  1NVJ A;  2WP4 A;  1FM0 E;  3RPF A; 
#chains in the Genus database with same CATH topology
 1FFV B;  1VLB A;  1YTE A;  3NVV C;  1VQ7 H;  1FO4 A;  1QVG H;  1M90 J;  2QA4 H;  3CPW H;  5EP8 A;  1AZY A;  3G6E H;  3B9J C;  3CCE H;  1FFU B;  2ZJR J;  2WK6 A;  2E3T A;  5AYZ A;  4KWV A;  3G71 H;  1VQL H;  2Q5W E;  3CCJ H;  1WKI A;  1YTD A;  1VQN H;  1X1O A;  5HUP A;  3WNZ A;  3AM9 A;  3AN1 A;  3SR6 C;  3CCU H;  2WK5 A;  1SIJ A;  3FC4 A;  1S72 H;  2W3S B;  1JRO B;  2PA2 A;  2I1O A;  3C2F A;  2W55 B;  4WFN J;  5HUL A;  3C2R A;  1YTK A;  1QPQ A;  5AN9 F;  1N60 B;  3L0G A;  1FMA E;  5DM7 J;  2QIE A;  2B7Q A;  3NVZ C;  3VMM A;  4LHM A;  4WF9 J;  1Q81 J;  3CCV H;  3NS1 C;  5DM6 J;  1VQ8 H;  3CD6 H;  1NVI E;  4XR5 A;  5JVH J;  1W2B H;  5AYY A;  2W3R B;  4IOA J;  5GAH N;  1VQ6 H;  2OMD A;  3C2O A;  3CC4 H;  4X46 A;  1QPO A;  2TPT A;  1KQS H;  3L4P A;  2QEX H;  3PAJ A;  5JVG J;  5MLC O;  2WP4 A;  5GAD N;  1K73 J;  1FIQ C;  1DGJ A;  1O4U A;  4EAF A;  2W54 B;  1YI2 H;  1Q86 J;  2J0F A;  1KD1 J;  3BII E;  1RM6 A;  3PIP J;  4IO9 J;  1VQO H;  4GA6 A;  3NVY C;  4GA5 A;  4KWW A;  4US8 A;  1JRP B;  1YHQ H;  3WO0 A;  3NRZ C;  4EAD A;  5AYX A;  3I56 H;  2DSJ A;  1ZXI B;  4YYY A;  1N62 B;  2B7P A;  1VQK H;  1YIJ H;  5EY3 A;  1VQ5 H;  4WFB J;  1YIT H;  1N8R J;  3CXC H;  3CCR H;  1YJ9 H;  5HUO A;  1VQ9 H;  3ETR C;  5MPO C;  4YEK A;  3H5Q A;  4US9 A;  4C7Y A;  3CME H;  4UY8 M;  5HL7 J;  4WCE J;  3CCS H;  1V97 A;  2I14 A;  3WO1 A;  3RPF A;  2ZJP J;  1FM0 E;  1JJ2 H;  3GNN A;  2JBM A;  5H1S O;  1QPR A;  1OTP A;  1WYG A;  5GAG N;  3CMA H;  3CCL H;  4IOC J;  2OTL H;  1Q7Y J;  1YJN H;  1Q82 J;  1NJI J;  1K8A J;  1QVF H;  4I9A A;  4AP8 A;  3J7Z M;  5GAE N;  3PIO J;  3I55 H;  1QPN A;  1Y69 K;  4WFA J;  3NVW C;  1K9M J;  4C80 A;  2B7N A;  4USA A;  4C7Z A;  1SB3 A;  1QAP A;  1M1K J;  3EUB 4;  1VQP H;  1YJW H;  3C2V A;  3DLL J;  3CCQ H;  2ZJQ J;  3OW2 H;  3CCM H;  3FAH A;  4U67 J;  3C2E A;  1KC8 J;  1N5X A;  3AMZ A;  3TQV A;  3CC2 H;  3CC7 H;  1N61 B;  1VQM H;  1N63 B;  4GA4 A;  3G4S H;  1UOU A;  4ZOH A;  1N5W B;  1NVJ A;  1VDV A;  1VQ4 H;  3CF5 J;  2OTJ H;  1BRW A; 
#chains in the Genus database with same CATH homology
 4AP8 A;  2OMD A;  3BII E;  1FMA E;  2Q5W E;  5MPO C;  1NVI E;  2QIE A;  1NVJ A;  2WP4 A;  1FM0 E;  3RPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...