5AN9F

Mechanism of eif6 release from the nascent 60s ribosomal subunit
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
217
structure length
217
Chain Sequence
MGRRPARCYRYCKNKPYIKSRYCRGVPDAKIRIFDLGRKKASTDEFPLCVHLISLEKEQLSSEAIEAGRISCNKYISKTGGKDSFHMRVRVHPWHVLRINKMLSCAGADRLQTGMRGAFGKPMGTVARVNIGQIIFSIRTRDNMLANVVEALRRSSYKFPGRQKIVVSKKWGFTAYNREAYQKLKADGRLMNDGANVKVITNHGTLAQYAKDIAAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords 60S RIBOSOMAL PROTEIN L3
publication title Mechanism of Eif6 Release from the Nascent 60S Ribosomal Subunit
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2015-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00252 Ribosomal_L16 Ribosomal protein L16p/L10e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.330 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5an9F02
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 5an9F01
1VQ5H 4WF9J 1KC8J 1YJWH 5GAHN 3I55H 3CCQH 5JVGJ 1VQLH 2ZJQJ 3PIOJ 4IOAJ 1M90J 5GADN 3CD6H 1VQKH 2QEXH 1K73J 1YJNH 1Q81J 1M1KJ 1Q82J 3CXCH 2ZJRJ 1VQ4H 1YHQH 3CCVH 3CC2H 5JVHJ 1W2BH 2PA2A 3G71H 3CCMH 1JJ2H 1VQ9H 3CMEH 3G6EH 3G4SH 3DLLJ 4WCEJ 5GAEN 5GAGN 5HL7J 4UY8M 3PIPJ 3CPWH 1VQ7H 2OTJH 3J7ZM 3CC4H 1VQOH 3CC7H 1S72H 1Y69K 1YITH 1Q7YJ 1YIJH 3CCRH 4IO9J 1N8RJ 3I56H 2QA4H 1QVGH 4U67J 3CF5J 3CCUH 5AN9F 1VQMH 3CCSH 3CCJH 1QVFH 1VQPH 5DM6J 1KD1J 1K8AJ 1K9MJ 1YJ9H 3OW2H 2OTLH 4WFNJ 1WKIA 1VQNH 1Q86J 1KQSH 1YI2H 4WFAJ 1VQ8H 3CCEH 1NJIJ 5MLCO 2ZJPJ 4IOCJ 4WFBJ 3CMAH 5DM7J 1VQ6H 3CCLH 5H1SO
chains in the Genus database with same CATH superfamily
3CCJZ 1VQ81 2M6NA 1N5XA 4WF9J 4MD8A 1VQPZ 1KC8J 3EERA 5MPOC 4DQYB 4BY1I 1VQK1 3BG0B 2PM9A 2OTLZ 5JVGJ 1PFTA 3GTGI 2GTIA 3F3FC 2JIRA 3CC4Z 3EEDA 2K3RA 3KIHA 5C4XI 1VQNZ 3S17I 1M902 4IOAJ 2LFUA 1M90J 3GCFA 1Y8CA 3CC21 2W55B 3QWUA 4GA6A 3I56Z 5AYXA 1VQKH 1NUIA 4BXXI 3I551 1JJ2Y 2KI7B 4MH4A 1Q812 1NJI1 3G711 1VQL1 1Q81J 3B9JC 1VQ6Z 4X6AI 1NVIE 2VPYA 3T4NB 3CCLZ 3K7AI 1N5WB 2E3TA 1WW9A 3CCVH 3HOXI 2JR6A 1I3QI 3CC2H 4NB9A 4NH1C 1YTDA 5JVHJ 2JA6I 1YJN1 4XR5A 3S2HI 3J81b 3G71H 4NBAA 2R7ZI 1V97A 3JAMb 3CC71 1VQ9H 2M48A 3HOWI 1DGJA 2W54B 3G6EH 1YIT1 1SIWA 3MZLB 3NFZA 5IP7I 1QVFY 1VQKZ 3VTNA 3S15I 1TWHI 2W04A 1OTPA 2HF1A 3J7ZM 4MONA 1VQOH 3CC7H 3VMIA 1K731 1YITH 4BY7I 2HU9A 4IO9J 2JA7I 4NFRA 3CC2Z 1FFVB 3NRZC 3S14I 2AYDA 1KQSY 4KWWA 5C44I 3CF5J 4C80A 5AN9F 4AYBA 2QREB 1Q7Y1 3G71Z 4E2WA 4RVHA 1S721 1VQ9Z 2R6MA 2F4MA 3G6EZ 1NVJA 3NVZC 1QAPA 1VLAA 1YJ9H 2K5RA 2LEXA 4E2XA 4E33A 4NB8A 1K8A1 1ZB8A 1K9M1 4GA4A 3CXCZ 3IFUA 1VQ51 3H5QA 3CC7Z 2V3VA 2B7QA 3CCEH 4Y52I 1NJIJ 4X46A 1YITZ 1AA6A 2ZJPJ 3BIIE 3J81f 2V8KA 2V45A 4A3II 4CL1A 2V8IA 3ESWA 5H1SO 3F3PC 1SIJA 1VQ5H 1I50I 3P5JB 3NVVC 2WAQA 1RLYA 2JMOA 2NVTI 1YUKA 2JIQA 3GTMI 5T67A 3HOYI 1YJ9Z 2RHBA 4NBCA 3GKQA 2I14A 4NOZA 5C3EI 3C2RA 3CCQH 2W3RB 2VPZA 3D2LA 1ZH1A 2VUMI 2ZJQJ 3FQMA 4E2ZA 5LL6f 3CCEZ 1Q861 5GADN 3S1MI 1VDVA 1K732 1K73J 5AYZA 3KIFA 3GTPI 4A3FI 3VMGA 1Q822 1KC82 1Q82J 1VQ5Z 4US9A 1RQFA 3MZKB 3CPWY 2IZ3A 2G2KA 5FLMI 3MONA 1M1K1 4E32A 3GTKI 1WJ2A 5D1OA 2J6AA 2KPIA 5IP9I 2OTJ1 3J80f 5IT9f 2JA5I 1JJ2H 2AKLA 3CCV1 1QPOA 3G4SH 1YIJ1 3CCR1 3DLLJ 4WCEJ 4A3GI 3S2DI 2O4HA 2VPXA 1FFUB 5HL7J 2JIPA 3CCU1 2OTJH 1VQ91 3GTJI 1TWAI 4ZOHA 3G6E1 1WZNA 4HGYA 3OW2Y 3D9XA 1YIJH 3HOZI 3CCRH 4E2YA 2VF1A 3WO1A 3GNNA 4A3CI 5HUPA 4U67J 2F4OA 1Y1VI 1N62B 3CCUH 2Q4ZA 1VQO1 1JRPB 1LQLA 1YI21 1FIQC 1QVFH 4RS4A 1N8R1 4YYYA 1JJ2Z 3C2FA 2IZ4A 3I4NI 1Z03A 1N2FA 2WK6A 4Y7NI 3RPFA 4A3KI 1QXFA 1Z01A 3CMA1 2JIMA 1WKIA 2JA8I 1N61B 1KD11 1Q862 2OTJZ 2GTHA 1Q86J 1KQSH 1YTKA 1YI2H 2QRDB 5HULA 5EP8A 2WK5A 3VMHA 2VUGA 2JBMA 3CCVZ 4NBFA 1YJ91 2RT9A 5MLCO 1YIJZ 3CCRZ 4XX2A 4A93I 4IOCJ 4E31A 1RO4A 2Q51A 3CMAH 3CCUZ 3D6WA 3AM9A 4LHMA 2Q5WE 2Y0SA 4QTUA 1QVFZ 3CCE1 1K83I 2NAPA 3NDJA 2JUBA 1WCMI 3L4PA 1FDOA 3FC4A 1YJWH 5GAHN 3NH8A 2E2HI 3NH5A 5D1PA 1VQOZ 1KQSZ 4C7YA 3J80b 1YI2Z 1NJI2 5IT9b 1VQ41 1W2BY 2W03A 1ML8A 2PK7A 4S1TA 2VPWA 4DK1A 2QEXH 3CCQ1 3GTMS 3J7A4 3CMAZ 1M901 1WYGA 3CCM1 1VQ4H 4KWVA 5T6BA 3RZOI 2V8JA 2J0FA 1Q811 1KRLA 3NH4A 1FDIA 4A3BI 1YTEA 1YJWZ 4HGZA 2W3SB 4A3LI 1N60B 3IX0A 3M3YI 3CCMH 3NS1C 1QPNA 3CMEH 1QPQA 1QVGY 2EGTA 3C2VA 2DE5A 1RO2A 3IF8A 2QEXZ 3CPWH 1Z02A 3WNZA 3HKZA 3HOVI 3VB9A 3CC4H 4MD9A 2YADA 3C2EA 1TWFI 1QYPA 3G4S1 3LUSA 1TFIA 1Q7Y2 2E2II 1Y69K 2JNYA 1VQ4Z 1Q7YJ 4BBRI 2QLVB 2QR1B 1R9TI 2IV2X 4BBSI 3I56H 2I3CA 1WIIA 1X0TA 4NBBA 3EUB4 2QA4H 3TE5B 1RO0A 3CCQZ 1VQMH 1O4UA 3FKII 5FLXf 2B63I 3CCSH 3NVWC 1TWCI 5T64A 2R92I 3FAHA 3GTOI 5DM6J 3CCMZ 1K8A2 1K9M2 2P3YA 3IR7A 1K8AJ 1K9MJ 5C4JI 3TQVA 1JROB 1AZYA 3ETRC 3OW2H 4EWCA 3GTLI 3I07A 3CPWZ 3HOUI 2NVQI 5A2Qf 1Y1VS 1YUAA 2DE6A 3GTQI 1ZXIB 4WFAJ 3FQQA 5CM2M 2QRCB 1VQ8H 1JWHC 2I1OA 4YEKA 2E2JI 2R93I 1Y1WI 4MRIA 4NBHA 3S16I 4A3JI 2QIEA 2WB1A 4WFBJ 2B7PA 2QA4Z 1QF8A 1Q16A 1S7MA 4TNUA 1VQMZ 2E7ZA 3CCSZ 2NVXI 1USPB 4RVFA 1X3ZA 3NVYC 4I9AA 1SFOI 3G4SZ 3PAJA 3VMMA 3CD61 2O53A 4MD7A 3U50C 3OW2Z 3I55H 3S1NI 3H3VJ 2DE7A 4A3MI 1I6HI 1VQLH 3M4OI 4QTTA 4A3EI 2OMDA 3PIOJ 1YHQ1 2QKDA 1RNIA 5AYYA 1VQ8Z 3PO3S 3H0GI 1X3WA 1L1OC 3CD6H 1YJW1 2LIYA 4DGLA 2JIOA 1QPRA 1TWGI 1P9NA 4US8A 4GA5A 1N63B 1YJNH 1M1K2 3PO3I 1M1KJ 3C2OA 5HUOA 4NBDA 3CXCH 2ZJRJ 1BRWA 1YHQH 2OOXB 4NBEA 2QEX1 4RV9A 1USPA 4RVDA 3CXCY 1W2BH 1KC81 1Q821 2P28A 4NBGA 1VQ71 2PA2A 3PO2I 2RIQA 3I55Z 3CQZI 5FLXb 2B7NA 2RPRA 1UOUA 3Q87A 1VQLZ 4EAFA 1FO4A 1SB3A 3TDHB 5GAEN 5GAGN 3SR6C 4UY8M 2PMZA 3CD6Z 1X1OA 3PIPJ 1VQ7H 2RBLA 1YJNZ 2NVYI 2OOYB 3CME1 3CCJ1 2JS4A 5A2Qb 1NP6A 2BJOA 4HH4A 4E30A 1VQP1 1S72H 4AP8A 4MXUA 4EADA 1YHQZ 1N8R2 3AMZA 5EY3A 1N8RJ 1FMAE 2ZAEB 1QVGH 2OTL1 1W2BZ 3S1RI 4C7ZA 1DL6A 3L0GA 1VQN1 3CC41 4A3DI 3JAMf 3CCJH 3WO0A 1VQPH 1KD12 3RZDI 1VLBA 1KD1J 3I561 2QA41 1FM0E 2E9HA 5D1OB 2WP4A 2OTLH 1VQM1 3CCS1 3I4MI 4WFNJ 2DSJA 1VQ61 1VQ7Z 1VQNH 3CCL1 3S1QI 1RM6A 4USAA 1ZB9A 1S72Z 2OZKA 3BG1B 2TPTA 4RVGA 3AN1A 1QVGZ 5DM7J 1VQ6H 2H85A 3NDIA 2GU2A 2YU9I 3CCLH 3CMEZ
chains in the Genus database with same CATH topology
3CCJZ 1VQ81 2M6NA 4WF9J 1KC8J 4MD8A 1VQPZ 3EERA 4DQYB 4BY1I 1VQK1 3BG0B 2PM9A 2OTLZ 5JVGJ 1PFTA 3GTGI 2GTIA 3F3FC 3CC4Z 1VQNZ 3EEDA 2K3RA 3KIHA 5C4XI 3S17I 1M902 4IOAJ 2LFUA 1M90J 3GCFA 3CC21 3QWUA 3I56Z 1VQKH 1NUIA 4BXXI 3I551 1JJ2Y 2KI7B 4MH4A 1Q812 1NJI1 3G711 1VQL1 1Q81J 1VQ6Z 4X6AI 3T4NB 3CCLZ 3K7AI 1WW9A 3CCVH 3HOXI 2JR6A 1I3QI 3CC2H 4NB9A 4NH1C 5JVHJ 2JA6I 1YJN1 3S2HI 3J81b 3G71H 4NBAA 2R7ZI 3JAMb 3CC71 1VQ9H 2M48A 3HOWI 3G6EH 1YIT1 3MZLB 3NFZA 5IP7I 1QVFY 1VQKZ 3VTNA 3S15I 1TWHI 2W04A 3J7ZM 2HF1A 4MONA 1VQOH 3CC7H 3VMIA 1K731 1YITH 4BY7I 2HU9A 4IO9J 2JA7I 4NFRA 3CC2Z 3S14I 1KQSY 5C44I 3CF5J 5AN9F 4AYBA 2QREB 1Q7Y1 3G71Z 4E2WA 4RVHA 1S721 1VQ9Z 2R6MA 2F4MA 3G6EZ 1VLAA 1YJ9H 2K5RA 4E2XA 4E33A 4NB8A 1K8A1 1ZB8A 1K9M1 3CXCZ 3IFUA 1VQ51 3CC7Z 3CCEH 4Y52I 1NJIJ 1YITZ 2ZJPJ 3J81f 2V8KA 4A3II 4CL1A 2V8IA 3ESWA 5H1SO 3F3PC 1VQ5H 1I50I 3P5JB 2WAQA 1RLYA 2JMOA 2NVTI 1YUKA 3GTMI 5T67A 3HOYI 1YJ9Z 2RHBA 4NBCA 3GKQA 3CCQH 4NOZA 5C3EI 1ZH1A 2VUMI 2ZJQJ 3FQMA 4E2ZA 5LL6f 3CCEZ 1Q861 5GADN 3S1MI 1K732 1K73J 3KIFA 3GTPI 4A3FI 3VMGA 1Q822 1KC82 1Q82J 1VQ5Z 1RQFA 3MZKB 3CPWY 2IZ3A 2G2KA 5FLMI 3MONA 1M1K1 4E32A 3GTKI 5D1OA 2J6AA 2KPIA 5IP9I 2OTJ1 3J80f 5IT9f 2JA5I 1JJ2H 2AKLA 3CCV1 3G4SH 1YIJ1 3CCR1 3DLLJ 4WCEJ 4A3GI 3S2DI 2O4HA 5HL7J 3CCU1 2OTJH 1VQ91 3GTJI 1TWAI 3G6E1 4HGYA 3OW2Y 3D9XA 1YIJH 3HOZI 3CCRH 4E2YA 2VF1A 4A3CI 4U67J 2F4OA 1Y1VI 3CCUH 2Q4ZA 1VQO1 1LQLA 1YI21 1QVFH 4RS4A 1N8R1 1JJ2Z 2IZ4A 3I4NI 1Z03A 1N2FA 4Y7NI 4A3KI 1Z01A 3CMA1 1WKIA 2JA8I 1KD11 1Q862 2OTJZ 2GTHA 1Q86J 1KQSH 1YI2H 2QRDB 3VMHA 2VUGA 3CCVZ 4NBFA 1YJ91 2RT9A 5MLCO 1YIJZ 3CCRZ 4XX2A 4A93I 4IOCJ 4E31A 1RO4A 2Q51A 3CMAH 3CCUZ 3D6WA 2Y0SA 4QTUA 1QVFZ 3CCE1 1K83I 3NDJA 2JUBA 1WCMI 1YJWH 5GAHN 3NH8A 2E2HI 3NH5A 5D1PA 1VQOZ 1KQSZ 3J80b 1YI2Z 1NJI2 5IT9b 1VQ41 1W2BY 2W03A 1ML8A 2PK7A 4S1TA 4DK1A 2QEXH 3CCQ1 3GTMS 3J7A4 3CMAZ 1M901 3CCM1 1VQ4H 5T6BA 3RZOI 2V8JA 1Q811 1KRLA 3NH4A 4A3BI 1YJWZ 4HGZA 4A3LI 3IX0A 3M3YI 3CCMH 3CMEH 1QVGY 2EGTA 2DE5A 1RO2A 3IF8A 2QEXZ 3CPWH 1Z02A 3HKZA 3HOVI 3VB9A 3CC4H 4MD9A 2YADA 1TWFI 1QYPA 3G4S1 3LUSA 1TFIA 1Q7Y2 2E2II 1Y69K 2JNYA 1VQ4Z 1Q7YJ 4BBRI 2QLVB 2QR1B 1R9TI 4BBSI 3I56H 2I3CA 1WIIA 1X0TA 4NBBA 2QA4H 3TE5B 1RO0A 3CCQZ 1VQMH 3CCSH 3FKII 5FLXf 2B63I 1TWCI 5T64A 2R92I 5DM6J 3GTOI 3CCMZ 1K8A2 1K9M2 2P3YA 1K8AJ 1K9MJ 5C4JI 3OW2H 4EWCA 3GTLI 3I07A 3CPWZ 3HOUI 2NVQI 5A2Qf 1Y1VS 1YUAA 2DE6A 3GTQI 4WFAJ 3FQQA 5CM2M 2QRCB 1VQ8H 1JWHC 2E2JI 2R93I 1Y1WI 4MRIA 4NBHA 3S16I 4A3JI 2WB1A 4WFBJ 2QA4Z 1QF8A 1S7MA 4TNUA 1VQMZ 3CCSZ 2NVXI 1USPB 4RVFA 1X3ZA 1SFOI 3G4SZ 3CD61 2O53A 4MD7A 3U50C 3OW2Z 3I55H 3S1NI 3H3VJ 2DE7A 4A3MI 1I6HI 1VQLH 3M4OI 4QTTA 4A3EI 3PIOJ 1YHQ1 2QKDA 1RNIA 1VQ8Z 3PO3S 3H0GI 1X3WA 1L1OC 3CD6H 1YJW1 2LIYA 4DGLA 1TWGI 1P9NA 1YJNH 1M1K2 3PO3I 1M1KJ 4NBDA 3CXCH 2ZJRJ 1YHQH 2OOXB 4NBEA 2QEX1 4RV9A 1USPA 4RVDA 3CXCY 1W2BH 1KC81 1Q821 2P28A 4NBGA 1VQ71 2PA2A 3PO2I 2RIQA 3I55Z 3CQZI 5FLXb 2RPRA 3Q87A 1VQLZ 3TDHB 5GAEN 5GAGN 4UY8M 2PMZA 3CD6Z 3PIPJ 1VQ7H 2RBLA 1YJNZ 2NVYI 2OOYB 3CME1 3CCJ1 2JS4A 5A2Qb 1NP6A 2BJOA 4HH4A 1VQP1 4E30A 1S72H 4MXUA 1YHQZ 1N8R2 1N8RJ 2ZAEB 1QVGH 2OTL1 1W2BZ 3S1RI 1DL6A 1VQN1 3CC41 4A3DI 3JAMf 3CCJH 1VQPH 1KD12 3RZDI 1KD1J 3I561 2QA41 2E9HA 5D1OB 2OTLH 1VQM1 3CCS1 3I4MI 4WFNJ 1VQ61 1VQ7Z 1VQNH 3CCL1 3S1QI 1ZB9A 1S72Z 2OZKA 3BG1B 4RVGA 1QVGZ 5DM7J 1VQ6H 2H85A 3NDIA 2GU2A 2YU9I 3CCLH 3CMEZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ5 H;  4WF9 J;  1KC8 J;  1YJW H;  5GAH N;  3I55 H;  3CCQ H;  5JVG J;  1VQL H;  2ZJQ J;  3PIO J;  4IOA J;  1M90 J;  5GAD N;  3CD6 H;  1VQK H;  2QEX H;  1K73 J;  1YJN H;  1Q81 J;  1M1K J;  1Q82 J;  3CXC H;  2ZJR J;  1VQ4 H;  1YHQ H;  3CCV H;  3CC2 H;  5JVH J;  1W2B H;  2PA2 A;  3G71 H;  3CCM H;  1JJ2 H;  1VQ9 H;  3CME H;  3G6E H;  3G4S H;  3DLL J;  4WCE J;  5GAE N;  5GAG N;  5HL7 J;  4UY8 M;  3PIP J;  3CPW H;  1VQ7 H;  2OTJ H;  3J7Z M;  3CC4 H;  1VQO H;  3CC7 H;  1S72 H;  1Y69 K;  1YIT H;  1Q7Y J;  1YIJ H;  3CCR H;  4IO9 J;  1N8R J;  3I56 H;  2QA4 H;  1QVG H;  4U67 J;  3CF5 J;  3CCU H;  5AN9 F;  1VQM H;  3CCS H;  3CCJ H;  1QVF H;  1VQP H;  5DM6 J;  1KD1 J;  1K8A J;  1K9M J;  1YJ9 H;  3OW2 H;  2OTL H;  4WFN J;  1WKI A;  1VQN H;  1Q86 J;  1KQS H;  1YI2 H;  4WFA J;  1VQ8 H;  3CCE H;  1NJI J;  5MLC O;  2ZJP J;  4IOC J;  4WFB J;  3CMA H;  5DM7 J;  1VQ6 H;  3CCL H;  5H1S O; 
#chains in the Genus database with same CATH topology
 3CCJ Z;  1VQ8 1;  2M6N A;  1N5X A;  4WF9 J;  4MD8 A;  1VQP Z;  1KC8 J;  3EER A;  5MPO C;  4DQY B;  4BY1 I;  1VQK 1;  3BG0 B;  2PM9 A;  2OTL Z;  5JVG J;  1PFT A;  3GTG I;  2GTI A;  3F3F C;  2JIR A;  3CC4 Z;  3EED A;  2K3R A;  3KIH A;  5C4X I;  1VQN Z;  3S17 I;  1M90 2;  4IOA J;  2LFU A;  1M90 J;  3GCF A;  1Y8C A;  3CC2 1;  2W55 B;  3QWU A;  4GA6 A;  3I56 Z;  5AYX A;  1VQK H;  1NUI A;  4BXX I;  3I55 1;  1JJ2 Y;  2KI7 B;  4MH4 A;  1Q81 2;  1NJI 1;  3G71 1;  1VQL 1;  1Q81 J;  3B9J C;  1VQ6 Z;  4X6A I;  1NVI E;  2VPY A;  3T4N B;  3CCL Z;  3K7A I;  1N5W B;  2E3T A;  1WW9 A;  3CCV H;  3HOX I;  2JR6 A;  1I3Q I;  3CC2 H;  4NB9 A;  4NH1 C;  1YTD A;  5JVH J;  2JA6 I;  1YJN 1;  4XR5 A;  3S2H I;  3J81 b;  3G71 H;  4NBA A;  2R7Z I;  1V97 A;  3JAM b;  3CC7 1;  1VQ9 H;  2M48 A;  3HOW I;  1DGJ A;  2W54 B;  3G6E H;  1YIT 1;  1SIW A;  3MZL B;  3NFZ A;  5IP7 I;  1QVF Y;  1VQK Z;  3VTN A;  3S15 I;  1TWH I;  2W04 A;  1OTP A;  2HF1 A;  3J7Z M;  4MON A;  1VQO H;  3CC7 H;  3VMI A;  1K73 1;  1YIT H;  4BY7 I;  2HU9 A;  4IO9 J;  2JA7 I;  4NFR A;  3CC2 Z;  1FFV B;  3NRZ C;  3S14 I;  2AYD A;  1KQS Y;  4KWW A;  5C44 I;  3CF5 J;  4C80 A;  5AN9 F;  4AYB A;  2QRE B;  1Q7Y 1;  3G71 Z;  4E2W A;  4RVH A;  1S72 1;  1VQ9 Z;  2R6M A;  2F4M A;  3G6E Z;  1NVJ A;  3NVZ C;  1QAP A;  1VLA A;  1YJ9 H;  2K5R A;  2LEX A;  4E2X A;  4E33 A;  4NB8 A;  1K8A 1;  1ZB8 A;  1K9M 1;  4GA4 A;  3CXC Z;  3IFU A;  1VQ5 1;  3H5Q A;  3CC7 Z;  2V3V A;  2B7Q A;  3CCE H;  4Y52 I;  1NJI J;  4X46 A;  1YIT Z;  1AA6 A;  2ZJP J;  3BII E;  3J81 f;  2V8K A;  2V45 A;  4A3I I;  4CL1 A;  2V8I A;  3ESW A;  5H1S O;  3F3P C;  1SIJ A;  1VQ5 H;  1I50 I;  3P5J B;  3NVV C;  2WAQ A;  1RLY A;  2JMO A;  2NVT I;  1YUK A;  2JIQ A;  3GTM I;  5T67 A;  3HOY I;  1YJ9 Z;  2RHB A;  4NBC A;  3GKQ A;  2I14 A;  4NOZ A;  5C3E I;  3C2R A;  3CCQ H;  2W3R B;  2VPZ A;  3D2L A;  1ZH1 A;  2VUM I;  2ZJQ J;  3FQM A;  4E2Z A;  5LL6 f;  3CCE Z;  1Q86 1;  5GAD N;  3S1M I;  1VDV A;  1K73 2;  1K73 J;  5AYZ A;  3KIF A;  3GTP I;  4A3F I;  3VMG A;  1Q82 2;  1KC8 2;  1Q82 J;  1VQ5 Z;  4US9 A;  1RQF A;  3MZK B;  3CPW Y;  2IZ3 A;  2G2K A;  5FLM I;  3MON A;  1M1K 1;  4E32 A;  3GTK I;  1WJ2 A;  5D1O A;  2J6A A;  2KPI A;  5IP9 I;  2OTJ 1;  3J80 f;  5IT9 f;  2JA5 I;  1JJ2 H;  2AKL A;  3CCV 1;  1QPO A;  3G4S H;  1YIJ 1;  3CCR 1;  3DLL J;  4WCE J;  4A3G I;  3S2D I;  2O4H A;  2VPX A;  1FFU B;  5HL7 J;  2JIP A;  3CCU 1;  2OTJ H;  1VQ9 1;  3GTJ I;  1TWA I;  4ZOH A;  3G6E 1;  1WZN A;  4HGY A;  3OW2 Y;  3D9X A;  1YIJ H;  3HOZ I;  3CCR H;  4E2Y A;  2VF1 A;  3WO1 A;  3GNN A;  4A3C I;  5HUP A;  4U67 J;  2F4O A;  1Y1V I;  1N62 B;  3CCU H;  2Q4Z A;  1VQO 1;  1JRP B;  1LQL A;  1YI2 1;  1FIQ C;  1QVF H;  4RS4 A;  1N8R 1;  4YYY A;  1JJ2 Z;  3C2F A;  2IZ4 A;  3I4N I;  1Z03 A;  1N2F A;  2WK6 A;  4Y7N I;  3RPF A;  4A3K I;  1QXF A;  1Z01 A;  3CMA 1;  2JIM A;  1WKI A;  2JA8 I;  1N61 B;  1KD1 1;  1Q86 2;  2OTJ Z;  2GTH A;  1Q86 J;  1KQS H;  1YTK A;  1YI2 H;  2QRD B;  5HUL A;  5EP8 A;  2WK5 A;  3VMH A;  2VUG A;  2JBM A;  3CCV Z;  4NBF A;  1YJ9 1;  2RT9 A;  5MLC O;  1YIJ Z;  3CCR Z;  4XX2 A;  4A93 I;  4IOC J;  4E31 A;  1RO4 A;  2Q51 A;  3CMA H;  3CCU Z;  3D6W A;  3AM9 A;  4LHM A;  2Q5W E;  2Y0S A;  4QTU A;  1QVF Z;  3CCE 1;  1K83 I;  2NAP A;  3NDJ A;  2JUB A;  1WCM I;  3L4P A;  1FDO A;  3FC4 A;  1YJW H;  5GAH N;  3NH8 A;  2E2H I;  3NH5 A;  5D1P A;  1VQO Z;  1KQS Z;  4C7Y A;  3J80 b;  1YI2 Z;  1NJI 2;  5IT9 b;  1VQ4 1;  1W2B Y;  2W03 A;  1ML8 A;  2PK7 A;  4S1T A;  2VPW A;  4DK1 A;  2QEX H;  3CCQ 1;  3GTM S;  3J7A 4;  3CMA Z;  1M90 1;  1WYG A;  3CCM 1;  1VQ4 H;  4KWV A;  5T6B A;  3RZO I;  2V8J A;  2J0F A;  1Q81 1;  1KRL A;  3NH4 A;  1FDI A;  4A3B I;  1YTE A;  1YJW Z;  4HGZ A;  2W3S B;  4A3L I;  1N60 B;  3IX0 A;  3M3Y I;  3CCM H;  3NS1 C;  1QPN A;  3CME H;  1QPQ A;  1QVG Y;  2EGT A;  3C2V A;  2DE5 A;  1RO2 A;  3IF8 A;  2QEX Z;  3CPW H;  1Z02 A;  3WNZ A;  3HKZ A;  3HOV I;  3VB9 A;  3CC4 H;  4MD9 A;  2YAD A;  3C2E A;  1TWF I;  1QYP A;  3G4S 1;  3LUS A;  1TFI A;  1Q7Y 2;  2E2I I;  1Y69 K;  2JNY A;  1VQ4 Z;  1Q7Y J;  4BBR I;  2QLV B;  2QR1 B;  1R9T I;  2IV2 X;  4BBS I;  3I56 H;  2I3C A;  1WII A;  1X0T A;  4NBB A;  3EUB 4;  2QA4 H;  3TE5 B;  1RO0 A;  3CCQ Z;  1VQM H;  1O4U A;  3FKI I;  5FLX f;  2B63 I;  3CCS H;  3NVW C;  1TWC I;  5T64 A;  2R92 I;  3FAH A;  3GTO I;  5DM6 J;  3CCM Z;  1K8A 2;  1K9M 2;  2P3Y A;  3IR7 A;  1K8A J;  1K9M J;  5C4J I;  3TQV A;  1JRO B;  1AZY A;  3ETR C;  3OW2 H;  4EWC A;  3GTL I;  3I07 A;  3CPW Z;  3HOU I;  2NVQ I;  5A2Q f;  1Y1V S;  1YUA A;  2DE6 A;  3GTQ I;  1ZXI B;  4WFA J;  3FQQ A;  5CM2 M;  2QRC B;  1VQ8 H;  1JWH C;  2I1O A;  4YEK A;  2E2J I;  2R93 I;  1Y1W I;  4MRI A;  4NBH A;  3S16 I;  4A3J I;  2QIE A;  2WB1 A;  4WFB J;  2B7P A;  2QA4 Z;  1QF8 A;  1Q16 A;  1S7M A;  4TNU A;  1VQM Z;  2E7Z A;  3CCS Z;  2NVX I;  1USP B;  4RVF A;  1X3Z A;  3NVY C;  4I9A A;  1SFO I;  3G4S Z;  3PAJ A;  3VMM A;  3CD6 1;  2O53 A;  4MD7 A;  3U50 C;  3OW2 Z;  3I55 H;  3S1N I;  3H3V J;  2DE7 A;  4A3M I;  1I6H I;  1VQL H;  3M4O I;  4QTT A;  4A3E I;  2OMD A;  3PIO J;  1YHQ 1;  2QKD A;  1RNI A;  5AYY A;  1VQ8 Z;  3PO3 S;  3H0G I;  1X3W A;  1L1O C;  3CD6 H;  1YJW 1;  2LIY A;  4DGL A;  2JIO A;  1QPR A;  1TWG I;  1P9N A;  4US8 A;  4GA5 A;  1N63 B;  1YJN H;  1M1K 2;  3PO3 I;  1M1K J;  3C2O A;  5HUO A;  4NBD A;  3CXC H;  2ZJR J;  1BRW A;  1YHQ H;  2OOX B;  4NBE A;  2QEX 1;  4RV9 A;  1USP A;  4RVD A;  3CXC Y;  1W2B H;  1KC8 1;  1Q82 1;  2P28 A;  4NBG A;  1VQ7 1;  2PA2 A;  3PO2 I;  2RIQ A;  3I55 Z;  3CQZ I;  5FLX b;  2B7N A;  2RPR A;  1UOU A;  3Q87 A;  1VQL Z;  4EAF A;  1FO4 A;  1SB3 A;  3TDH B;  5GAE N;  5GAG N;  3SR6 C;  4UY8 M;  2PMZ A;  3CD6 Z;  1X1O A;  3PIP J;  1VQ7 H;  2RBL A;  1YJN Z;  2NVY I;  2OOY B;  3CME 1;  3CCJ 1;  2JS4 A;  5A2Q b;  1NP6 A;  2BJO A;  4HH4 A;  4E30 A;  1VQP 1;  1S72 H;  4AP8 A;  4MXU A;  4EAD A;  1YHQ Z;  1N8R 2;  3AMZ A;  5EY3 A;  1N8R J;  1FMA E;  2ZAE B;  1QVG H;  2OTL 1;  1W2B Z;  3S1R I;  4C7Z A;  1DL6 A;  3L0G A;  1VQN 1;  3CC4 1;  4A3D I;  3JAM f;  3CCJ H;  3WO0 A;  1VQP H;  1KD1 2;  3RZD I;  1VLB A;  1KD1 J;  3I56 1;  2QA4 1;  1FM0 E;  2E9H A;  5D1O B;  2WP4 A;  2OTL H;  1VQM 1;  3CCS 1;  3I4M I;  4WFN J;  2DSJ A;  1VQ6 1;  1VQ7 Z;  1VQN H;  3CCL 1;  3S1Q I;  1RM6 A;  4USA A;  1ZB9 A;  1S72 Z;  2OZK A;  3BG1 B;  2TPT A;  4RVG A;  3AN1 A;  1QVG Z;  5DM7 J;  1VQ6 H;  2H85 A;  3NDI A;  2GU2 A;  2YU9 I;  3CCL H;  3CME Z; 
#chains in the Genus database with same CATH homology
 3CCJ Z;  1VQ8 1;  2M6N A;  4WF9 J;  1KC8 J;  4MD8 A;  1VQP Z;  3EER A;  4DQY B;  4BY1 I;  1VQK 1;  3BG0 B;  2PM9 A;  2OTL Z;  5JVG J;  1PFT A;  3GTG I;  2GTI A;  3F3F C;  3CC4 Z;  1VQN Z;  3EED A;  2K3R A;  3KIH A;  5C4X I;  3S17 I;  1M90 2;  4IOA J;  2LFU A;  1M90 J;  3GCF A;  3CC2 1;  3QWU A;  3I56 Z;  1VQK H;  1NUI A;  4BXX I;  3I55 1;  1JJ2 Y;  2KI7 B;  4MH4 A;  1Q81 2;  1NJI 1;  3G71 1;  1VQL 1;  1Q81 J;  1VQ6 Z;  4X6A I;  3T4N B;  3CCL Z;  3K7A I;  1WW9 A;  3CCV H;  3HOX I;  2JR6 A;  1I3Q I;  3CC2 H;  4NB9 A;  4NH1 C;  5JVH J;  2JA6 I;  1YJN 1;  3S2H I;  3J81 b;  3G71 H;  4NBA A;  2R7Z I;  3JAM b;  3CC7 1;  1VQ9 H;  2M48 A;  3HOW I;  3G6E H;  1YIT 1;  3MZL B;  3NFZ A;  5IP7 I;  1QVF Y;  1VQK Z;  3VTN A;  3S15 I;  1TWH I;  2W04 A;  3J7Z M;  2HF1 A;  4MON A;  1VQO H;  3CC7 H;  3VMI A;  1K73 1;  1YIT H;  4BY7 I;  2HU9 A;  4IO9 J;  2JA7 I;  4NFR A;  3CC2 Z;  3S14 I;  1KQS Y;  5C44 I;  3CF5 J;  5AN9 F;  4AYB A;  2QRE B;  1Q7Y 1;  3G71 Z;  4E2W A;  4RVH A;  1S72 1;  1VQ9 Z;  2R6M A;  2F4M A;  3G6E Z;  1VLA A;  1YJ9 H;  2K5R A;  4E2X A;  4E33 A;  4NB8 A;  1K8A 1;  1ZB8 A;  1K9M 1;  3CXC Z;  3IFU A;  1VQ5 1;  3CC7 Z;  3CCE H;  4Y52 I;  1NJI J;  1YIT Z;  2ZJP J;  3J81 f;  2V8K A;  4A3I I;  4CL1 A;  2V8I A;  3ESW A;  5H1S O;  3F3P C;  1VQ5 H;  1I50 I;  3P5J B;  2WAQ A;  1RLY A;  2JMO A;  2NVT I;  1YUK A;  3GTM I;  5T67 A;  3HOY I;  1YJ9 Z;  2RHB A;  4NBC A;  3GKQ A;  3CCQ H;  4NOZ A;  5C3E I;  1ZH1 A;  2VUM I;  2ZJQ J;  3FQM A;  4E2Z A;  5LL6 f;  3CCE Z;  1Q86 1;  5GAD N;  3S1M I;  1K73 2;  1K73 J;  3KIF A;  3GTP I;  4A3F I;  3VMG A;  1Q82 2;  1KC8 2;  1Q82 J;  1VQ5 Z;  1RQF A;  3MZK B;  3CPW Y;  2IZ3 A;  2G2K A;  5FLM I;  3MON A;  1M1K 1;  4E32 A;  3GTK I;  5D1O A;  2J6A A;  2KPI A;  5IP9 I;  2OTJ 1;  3J80 f;  5IT9 f;  2JA5 I;  1JJ2 H;  2AKL A;  3CCV 1;  3G4S H;  1YIJ 1;  3CCR 1;  3DLL J;  4WCE J;  4A3G I;  3S2D I;  2O4H A;  5HL7 J;  3CCU 1;  2OTJ H;  1VQ9 1;  3GTJ I;  1TWA I;  3G6E 1;  4HGY A;  3OW2 Y;  3D9X A;  1YIJ H;  3HOZ I;  3CCR H;  4E2Y A;  2VF1 A;  4A3C I;  4U67 J;  2F4O A;  1Y1V I;  3CCU H;  2Q4Z A;  1VQO 1;  1LQL A;  1YI2 1;  1QVF H;  4RS4 A;  1N8R 1;  1JJ2 Z;  2IZ4 A;  3I4N I;  1Z03 A;  1N2F A;  4Y7N I;  4A3K I;  1Z01 A;  3CMA 1;  1WKI A;  2JA8 I;  1KD1 1;  1Q86 2;  2OTJ Z;  2GTH A;  1Q86 J;  1KQS H;  1YI2 H;  2QRD B;  3VMH A;  2VUG A;  3CCV Z;  4NBF A;  1YJ9 1;  2RT9 A;  5MLC O;  1YIJ Z;  3CCR Z;  4XX2 A;  4A93 I;  4IOC J;  4E31 A;  1RO4 A;  2Q51 A;  3CMA H;  3CCU Z;  3D6W A;  2Y0S A;  4QTU A;  1QVF Z;  3CCE 1;  1K83 I;  3NDJ A;  2JUB A;  1WCM I;  1YJW H;  5GAH N;  3NH8 A;  2E2H I;  3NH5 A;  5D1P A;  1VQO Z;  1KQS Z;  3J80 b;  1YI2 Z;  1NJI 2;  5IT9 b;  1VQ4 1;  1W2B Y;  2W03 A;  1ML8 A;  2PK7 A;  4S1T A;  4DK1 A;  2QEX H;  3CCQ 1;  3GTM S;  3J7A 4;  3CMA Z;  1M90 1;  3CCM 1;  1VQ4 H;  5T6B A;  3RZO I;  2V8J A;  1Q81 1;  1KRL A;  3NH4 A;  4A3B I;  1YJW Z;  4HGZ A;  4A3L I;  3IX0 A;  3M3Y I;  3CCM H;  3CME H;  1QVG Y;  2EGT A;  2DE5 A;  1RO2 A;  3IF8 A;  2QEX Z;  3CPW H;  1Z02 A;  3HKZ A;  3HOV I;  3VB9 A;  3CC4 H;  4MD9 A;  2YAD A;  1TWF I;  1QYP A;  3G4S 1;  3LUS A;  1TFI A;  1Q7Y 2;  2E2I I;  1Y69 K;  2JNY A;  1VQ4 Z;  1Q7Y J;  4BBR I;  2QLV B;  2QR1 B;  1R9T I;  4BBS I;  3I56 H;  2I3C A;  1WII A;  1X0T A;  4NBB A;  2QA4 H;  3TE5 B;  1RO0 A;  3CCQ Z;  1VQM H;  3CCS H;  3FKI I;  5FLX f;  2B63 I;  1TWC I;  5T64 A;  2R92 I;  5DM6 J;  3GTO I;  3CCM Z;  1K8A 2;  1K9M 2;  2P3Y A;  1K8A J;  1K9M J;  5C4J I;  3OW2 H;  4EWC A;  3GTL I;  3I07 A;  3CPW Z;  3HOU I;  2NVQ I;  5A2Q f;  1Y1V S;  1YUA A;  2DE6 A;  3GTQ I;  4WFA J;  3FQQ A;  5CM2 M;  2QRC B;  1VQ8 H;  1JWH C;  2E2J I;  2R93 I;  1Y1W I;  4MRI A;  4NBH A;  3S16 I;  4A3J I;  2WB1 A;  4WFB J;  2QA4 Z;  1QF8 A;  1S7M A;  4TNU A;  1VQM Z;  3CCS Z;  2NVX I;  1USP B;  4RVF A;  1X3Z A;  1SFO I;  3G4S Z;  3CD6 1;  2O53 A;  4MD7 A;  3U50 C;  3OW2 Z;  3I55 H;  3S1N I;  3H3V J;  2DE7 A;  4A3M I;  1I6H I;  1VQL H;  3M4O I;  4QTT A;  4A3E I;  3PIO J;  1YHQ 1;  2QKD A;  1RNI A;  1VQ8 Z;  3PO3 S;  3H0G I;  1X3W A;  1L1O C;  3CD6 H;  1YJW 1;  2LIY A;  4DGL A;  1TWG I;  1P9N A;  1YJN H;  1M1K 2;  3PO3 I;  1M1K J;  4NBD A;  3CXC H;  2ZJR J;  1YHQ H;  2OOX B;  4NBE A;  2QEX 1;  4RV9 A;  1USP A;  4RVD A;  3CXC Y;  1W2B H;  1KC8 1;  1Q82 1;  2P28 A;  4NBG A;  1VQ7 1;  2PA2 A;  3PO2 I;  2RIQ A;  3I55 Z;  3CQZ I;  5FLX b;  2RPR A;  3Q87 A;  1VQL Z;  3TDH B;  5GAE N;  5GAG N;  4UY8 M;  2PMZ A;  3CD6 Z;  3PIP J;  1VQ7 H;  2RBL A;  1YJN Z;  2NVY I;  2OOY B;  3CME 1;  3CCJ 1;  2JS4 A;  5A2Q b;  1NP6 A;  2BJO A;  4HH4 A;  1VQP 1;  4E30 A;  1S72 H;  4MXU A;  1YHQ Z;  1N8R 2;  1N8R J;  2ZAE B;  1QVG H;  2OTL 1;  1W2B Z;  3S1R I;  1DL6 A;  1VQN 1;  3CC4 1;  4A3D I;  3JAM f;  3CCJ H;  1VQP H;  1KD1 2;  3RZD I;  1KD1 J;  3I56 1;  2QA4 1;  2E9H A;  5D1O B;  2OTL H;  1VQM 1;  3CCS 1;  3I4M I;  4WFN J;  1VQ6 1;  1VQ7 Z;  1VQN H;  3CCL 1;  3S1Q I;  1ZB9 A;  1S72 Z;  2OZK A;  3BG1 B;  4RVG A;  1QVG Z;  5DM7 J;  1VQ6 H;  2H85 A;  3NDI A;  2GU2 A;  2YU9 I;  3CCL H;  3CME Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...