5AN9F

Mechanism of eif6 release from the nascent 60s ribosomal subunit
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
217
structure length
217
Chain Sequence
MGRRPARCYRYCKNKPYIKSRYCRGVPDAKIRIFDLGRKKASTDEFPLCVHLISLEKEQLSSEAIEAGRISCNKYISKTGGKDSFHMRVRVHPWHVLRINKMLSCAGADRLQTGMRGAFGKPMGTVARVNIGQIIFSIRTRDNMLANVVEALRRSSYKFPGRQKIVVSKKWGFTAYNREAYQKLKADGRLMNDGANVKVITNHGTLAQYAKDIAAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 60S RIBOSOMAL PROTEIN L3
publication title Mechanism of Eif6 Release from the Nascent 60S Ribosomal Subunit
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
total genus 32
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2015-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00252 Ribosomal_L16 Ribosomal protein L16p/L10e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.330 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5an9F02
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 5an9F01
2QA4H 3CCEH 5JVGJ 1QVFH 5AN9F 3CPWH 1S72H 3G71H 1VQPH 3PIOJ 2ZJQJ 1VQ5H 1VQ4H 3CMEH 3CMAH 3CC2H 3J7ZM 1YJ9H 3CCVH 3CCQH 1Y69K 1K73J 1VQ8H 4IOCJ 3OW2H 4WCEJ 2OTJH 3CCJH 1VQ7H 5MLCO 4WF9J 1YI2H 1M1KJ 1WKIA 1YIJH 2PA2A 3CXCH 4WFAJ 1Q7YJ 1VQMH 4WFBJ 5GAGN 1KC8J 5DM7J 1YJWH 5H1SO 5DM6J 3CD6H 5GADN 2QEXH 1Q82J 4UY8M 1YHQH 1YJNH 1W2BH 1Q81J 3CCMH 5HL7J 3CCLH 1VQKH 1KD1J 1VQNH 3DLLJ 5JVHJ 3CC4H 4U67J 5GAEN 1N8RJ 1K9MJ 3CCRH 3CF5J 4WFNJ 1QVGH 3I56H 2OTLH 3PIPJ 3G4SH 1VQOH 1VQ6H 4IO9J 1JJ2H 1VQLH 1Q86J 1K8AJ 3G6EH 1NJIJ 5GAHN 3CC7H 1VQ9H 3CCSH 1YITH 4IOAJ 3I55H 2ZJPJ 1KQSH 2ZJRJ 3CCUH 1M90J
chains in the Genus database with same CATH superfamily
5JVGJ 1N60B 4RVGA 1N5WB 2YADA 3CXCY 4AP8A 4HH4A 4TNUA 2J6AA 2QLVB 1TWHI 2O53A 1VQLZ 3I07A 1M1K2 3CMAH 1QYPA 4MRIA 1BRWA 5C44I 3CC7Z 1Z01A 3C2OA 1VQN1 2W3RB 1Y69K 2QRCB 2WK5A 4NFRA 1RQFA 2RIQA 2NVYI 4RVDA 3CC41 1KC82 1LQLA 4WCEJ 1KQSZ 1FDOA 2B7NA 2JUBA 2E9HA 3HOVI 4A3FI 1W2BY 2QA4Z 1TWGI 2QIEA 3C2VA 1Q822 3I561 1X3WA 2PA2A 1Q7YJ 3G4S1 1NJI1 3GTQI 3FKII 1VQMZ 5T67A 1WIIA 1S72Z 4A3CI 5GAGN 2V45A 2RBLA 4X46A 3CMEZ 1VQP1 2HF1A 2LIYA 4BY7I 1I3QI 5FLMI 1ZH1A 1QVGY 3CME1 2LEXA 5EP8A 3CCVZ 4DGLA 1VQ91 5AYXA 4Y7NI 1VQ8Z 3VMIA 3EEDA 2OTJZ 1FO4A 3ESWA 3U50C 1Q81J 4MD7A 4XX2A 3CCU1 4E2YA 1W2BZ 1DL6A 3SR6C 4Y52I 3C2EA 3CCE1 1VQKH 2R6MA 4DK1A 1KD1J 1VQNH 4LHMA 1YUKA 5IP9I 3WNZA 5JVHJ 3CC4H 2K3RA 4EAFA 3VMHA 3G711 2E3TA 5GAEN 1K9MJ 4CL1A 4NB8A 2QR1B 1YTEA 3CF5J 4EWCA 1K731 1YJW1 2NVXI 3BG1B 3I56H 2QEXZ 1WW9A 1Y1VI 1YJ91 3H0GI 5FLXb 3G4SH 2Y0SA 2DE5A 2WB1A 4USAA 4IO9J 1TWFI 1VQ6Z 4US9A 1JJ2H 2I3CA 1M902 4NBAA 2JNYA 3FAHA 1Q86J 1K8AJ 3CCJ1 2B7PA 1VQ71 3CCMZ 3CCLZ 5GAHN 4BXXI 4GA4A 1YI21 3L0GA 1VQ9H 1YIJ1 5LL6f 4A3JI 4GA5A 1N63B 2H85A 2JIQA 2W04A 3I55H 2OOXB 3D9XA 3IX0A 1JROB 1V97A 3CCUH 1YUAA 3GKQA 2VPZA 3CCEH 3MZLB 2OTLZ 1NUIA 2G2KA 3T4NB 3B9JC 3CPWH 5FLXf 3G71H 2JR6A 1JRPB 1RM6A 3PIOJ 1N62B 3AMZA 3GTJI 3S2HI 3G6EZ 3NDIA 4A3MI 4YYYA 1QPNA 1Q7Y2 1YJ9H 2JA5I 4YEKA 1FM0E 1N2FA 4MONA 4E32A 3JAMb 1Y1WI 2VF1A 4IOCJ 3OW2H 4A3KI 1N8R2 3HOYI 3GNNA 3CCR1 1O4UA 3CCJH 1FFUB 1VQ7H 1N61B 2E7ZA 2NAPA 1YI2H 1WKIA 3KIHA 1YIJH 2JIRA 2RHBA 1QVFZ 1RO2A 3AN1A 4WFAJ 1SFOI 3EUB4 1TWCI 2PK7A 1Q812 2HU9A 4EADA 2JMOA 3MONA 3RZDI 1VQ5Z 1QXFA 5T64A 3J81b 1VQ4Z 5H1SO 3BG0B 1VQL1 1X0TA 2I14A 1KD12 3CC2Z 4NB9A 3GTLI 3S14I 4NBDA 3FC4A 2Q51A 3CCQZ 3CC71 5D1OB 5T6BA 3JAMf 1K9M2 4BY1I 3RZOI 3S1NI 4HGZA 2P28A 4RS4A 3I4MI 1JJ2Y 2QA41 3IFUA 2GTIA 3CXCZ 3S16I 4NBCA 1RLYA 1VQKZ 4KWVA 2NVQI 4HGYA 3TDHB 1VQM1 3C2FA 1S721 3GTMI 1N8RJ 1Q862 1K8A2 3CCRH 2GU2A 2ZAEB 3J81f 3CD6Z 3HOZI 4A3LI 2VUGA 3AM9A 1R9TI 3CCV1 5AYYA 3C2RA 3RPFA 1X3ZA 3PO3S 2KPIA 1VQ81 1M1K1 1YHQZ 1UOUA 3CPWY 1YJNZ 2OTJ1 1VQLH 3H5QA 1JJ2Z 1NJIJ 3S17I 4MH4A 3S1QI 1KC81 3CC7H 4BBRI 1FFVB 2BJOA 4IOAJ 2P3YA 3NS1C 3GCFA 3NVZC 1KQSH 2M6NA 1Q821 2JIPA 1SIJA 2ZJRJ 5HULA 1QVGZ 1USPB 3OW2Y 1VDVA 2QA4H 3HOXI 2K5RA 1I6HI 2J0FA 5MPOC 1QPOA 2QEX1 1VQOZ 2O4HA 2JA6I 3WO1A 4S1TA 1S72H 3PAJA 4E2ZA 1VQPH 2E2JI 1VQ61 3S1RI 3CMEH 3CCM1 3CCL1 2OOYB 2QRDB 3QWUA 3J7ZM 3J80b 3CCVH 1P9NA 3CCSZ 1FIQC 2B7QA 1YITZ 1K73J 1VQ8H 2IZ3A 2OTJH 2F4MA 3GTGI 2V3VA 1Z03A 4E31A 3M4OI 4KWWA 5MLCO 1Q16A 3F3PC 2W55B 5D1OA 4E2XA 1S7MA 2OTL1 3D6WA 4X6AI 3EERA 3S1MI 5IT9b 2RT9A 1OTPA 1PFTA 3TE5B 2PM9A 4ZOHA 4C80A 1ML8A 4WFBJ 5DM7J 1YJWH 3FQMA 3GTOI 1RO4A 3CMAZ 4C7YA 3G6E1 2R93I 2JA8I 1ZB9A 5GADN 1AA6A 2QEXH 3J80f 4A3BI 3VMGA 2LFUA 1M901 1TWAI 1TFIA 4US8A 2E2II 4RVFA 1YTKA 2DSJA 5HL7J 3CCLH 3CCMH 4DQYB 2V8KA 1Z02A 4BBSI 4A3DI 5A2Qb 5IT9f 3PO3I 1Y1VS 2F4OA 3CQZI 2V8JA 3BIIE 4U67J 4C7ZA 4NBFA 1NJI2 1KRLA 1VQ51 2QREB 1VQ41 3NRZC 5AYZA 1KQSY 3CC21 4NBGA 4QTTA 2OTLH 2YU9I 3CCQ1 3PIPJ 3ETRC 4QTUA 4XR5A 3MZKB 3IR7A 3GTKI 4RVHA 1USPA 3VTNA 1QPQA 2PMZA 1Q7Y1 1X1OA 2JIOA 3G6EH 2JA7I 3P5JB 2W3SB 1VQNZ 2JBMA 1N8R1 5A2Qf 1VQK1 3CC4Z 3NVYC 1WJ2A 3LUSA 1I50I 2OZKA 3CD61 1QPRA 2KI7B 3I56Z 2WAQA 2Q4ZA 2DE6A 3K7AI 1ZXIB 1QVFH 2GTHA 5C4XI 1Q811 1K732 3M3YI 4I9AA 4NBHA 5AN9F 3G4SZ 5HUPA 1VLAA 1YHQ1 1KD11 4RV9A 2RPRA 2Q5WE 3TQVA 2ZJQJ 3NVVC 1YJN1 1VQ5H 1YTDA 1VQ4H 3L4PA 1VQPZ 1K83I 4MD8A 1QAPA 3CC2H 2R92I 1WCMI 1K9M1 1VQ9Z 3CCQH 1DGJA 2IZ4A 2WP4A 1N5XA 1NP6A 2AYDA 3VMMA 3I55Z 2AKLA 2VPYA 3IF8A 1QF8A 3CCUZ 3I551 3HOUI 4WF9J 1M1KJ 3CCEZ 5IP7I 4NBBA 3CXCH 5D1PA 1ZB8A 1Q861 3CPWZ 1K8A1 4A3GI 1VQMH 3HKZA 1VQO1 5HUOA 4NH1C 3G71Z 1KC8J 1RNIA 4NBEA 5DM6J 2V8IA 4E30A 3KIFA 1YJWZ 3NH5A 1NVJA 3CD6H 3NVWC 3Q87A 4NOZA 1AZYA 3WO0A 1L1OC 1YJ9Z 1NVIE 1FMAE 3S2DI 1FDIA 4AYBA 1Q82J 4A3EI 3S15I 3CCS1 3NH4A 1JWHC 1SIWA 1YIT1 4UY8M 3NDJA 1WZNA 3GTPI 1YHQH 5EY3A 3OW2Z 1YJNH 1W2BH 2B63I 2M48A 3GTMS 3CCJZ 2I1OA 1VQ7Z 2NVTI 2W54B 1YI2Z 1VLBA 1YIJZ 1SB3A 3I4NI 3DLLJ 2VUMI 2JS4A 3VB9A 2OMDA 2TPTA 2JIMA 3PO2I 5C3EI 4GA6A 2R7ZI 4MXUA 3FQQA 4WFNJ 4E33A 1QVGH 3CMA1 4MD9A 2IV2X 3NH8A 5C4JI 1VQOH 4A93I 1QVFY 4E2WA 2W03A 1VQ6H 3H3VJ 1Y8CA 2EGTA 3D2LA 5CM2M 1WYGA 3HOWI 2VPWA 2WK6A 3CCSH 3NFZA 3F3FC 2E2HI 2QKDA 1YITH 4A3II 3J7A4 2VPXA 1RO0A 2ZJPJ 3CCRZ 2DE7A 1M90J
chains in the Genus database with same CATH topology
5JVGJ 4RVGA 2YADA 3CXCY 4HH4A 4TNUA 2J6AA 2QLVB 1TWHI 2O53A 1VQLZ 3I07A 1M1K2 3CMAH 1QYPA 4MRIA 5C44I 3CC7Z 1Z01A 1VQN1 1Y69K 2QRCB 4NFRA 1RQFA 2RIQA 2NVYI 4RVDA 3CC41 1KC82 1LQLA 4WCEJ 1KQSZ 2JUBA 2E9HA 3HOVI 4A3FI 1W2BY 2QA4Z 1TWGI 1Q822 3I561 1X3WA 2PA2A 1Q7YJ 3G4S1 1NJI1 3GTQI 3FKII 1VQMZ 5T67A 1WIIA 1S72Z 4A3CI 5GAGN 2RBLA 3CMEZ 1VQP1 2HF1A 2LIYA 4BY7I 1I3QI 5FLMI 1ZH1A 1QVGY 3CME1 3CCVZ 4DGLA 1VQ91 4Y7NI 1VQ8Z 3VMIA 3EEDA 2OTJZ 3ESWA 3U50C 1Q81J 4MD7A 4XX2A 3CCU1 4E2YA 1W2BZ 1DL6A 4Y52I 3CCE1 1VQKH 2R6MA 4DK1A 1KD1J 1VQNH 1YUKA 5IP9I 5JVHJ 3CC4H 2K3RA 3VMHA 3G711 5GAEN 1K9MJ 4CL1A 4NB8A 2QR1B 3CF5J 4EWCA 1K731 1YJW1 2NVXI 3BG1B 3I56H 2QEXZ 1WW9A 1Y1VI 1YJ91 3H0GI 5FLXb 3G4SH 2Y0SA 2DE5A 2WB1A 4IO9J 1TWFI 1VQ6Z 1JJ2H 2I3CA 1M902 4NBAA 2JNYA 1Q86J 1K8AJ 3CCJ1 1VQ71 3CCMZ 3CCLZ 5GAHN 4BXXI 1YI21 1VQ9H 1YIJ1 5LL6f 4A3JI 2H85A 2W04A 3I55H 2OOXB 3D9XA 3IX0A 3CCUH 1YUAA 3GKQA 3CCEH 3MZLB 2OTLZ 1NUIA 2G2KA 3T4NB 3CPWH 5FLXf 3G71H 2JR6A 3PIOJ 3GTJI 3S2HI 3G6EZ 3NDIA 4A3MI 1Q7Y2 1YJ9H 2JA5I 1N2FA 4MONA 4E32A 3JAMb 1Y1WI 2VF1A 4IOCJ 3OW2H 4A3KI 1N8R2 3HOYI 3CCR1 3CCJH 1VQ7H 1YI2H 1WKIA 3KIHA 1YIJH 2RHBA 1QVFZ 1RO2A 4WFAJ 1SFOI 1TWCI 2PK7A 1Q812 2HU9A 2JMOA 3MONA 3RZDI 1VQ5Z 5T64A 3J81b 1VQ4Z 5H1SO 3BG0B 1VQL1 1X0TA 1KD12 3CC2Z 4NB9A 3GTLI 3S14I 4NBDA 2Q51A 3CCQZ 3CC71 5D1OB 5T6BA 3JAMf 1K9M2 4BY1I 3RZOI 3S1NI 4HGZA 2P28A 4RS4A 3I4MI 1JJ2Y 2QA41 3IFUA 2GTIA 3CXCZ 3S16I 4NBCA 1RLYA 1VQKZ 2NVQI 4HGYA 3TDHB 1VQM1 1S721 3GTMI 1N8RJ 1Q862 1K8A2 3CCRH 2GU2A 2ZAEB 3J81f 3CD6Z 3HOZI 4A3LI 2VUGA 1R9TI 3CCV1 1X3ZA 3PO3S 2KPIA 1VQ81 1M1K1 1YHQZ 3CPWY 1YJNZ 2OTJ1 1VQLH 1JJ2Z 1NJIJ 3S17I 4MH4A 3S1QI 1KC81 3CC7H 4BBRI 2BJOA 4IOAJ 2P3YA 3GCFA 1KQSH 2M6NA 1Q821 2ZJRJ 1QVGZ 3OW2Y 1USPB 2QA4H 3HOXI 2K5RA 1I6HI 2QEX1 1VQOZ 2O4HA 2JA6I 4S1TA 1S72H 4E2ZA 1VQPH 2E2JI 1VQ61 3S1RI 3CMEH 3CCM1 3CCL1 2OOYB 2QRDB 3QWUA 3J7ZM 3J80b 3CCVH 1P9NA 3CCSZ 1YITZ 1K73J 1VQ8H 2IZ3A 2OTJH 2F4MA 3GTGI 1Z03A 4E31A 3M4OI 5MLCO 3F3PC 5D1OA 4E2XA 1S7MA 2OTL1 3D6WA 4X6AI 3EERA 3S1MI 5IT9b 2RT9A 1PFTA 3TE5B 2PM9A 1ML8A 4WFBJ 5DM7J 1YJWH 3FQMA 3GTOI 1RO4A 3CMAZ 3G6E1 2R93I 2JA8I 1ZB9A 5GADN 2QEXH 3J80f 4A3BI 3VMGA 2LFUA 1M901 1TWAI 1TFIA 2E2II 4RVFA 3CCMH 5HL7J 3CCLH 4DQYB 2V8KA 1Z02A 4BBSI 4A3DI 5A2Qb 5IT9f 3PO3I 1Y1VS 2F4OA 3CQZI 2V8JA 4U67J 4NBFA 1NJI2 1KRLA 1VQ51 2QREB 1VQ41 1KQSY 3CC21 4NBGA 4QTTA 2OTLH 2YU9I 3CCQ1 3PIPJ 4QTUA 3MZKB 3GTKI 4RVHA 1USPA 3VTNA 2PMZA 1Q7Y1 3G6EH 2JA7I 3P5JB 1VQNZ 1N8R1 5A2Qf 1VQK1 3CC4Z 3LUSA 1I50I 2OZKA 3CD61 2KI7B 3I56Z 2WAQA 2Q4ZA 2DE6A 3K7AI 1QVFH 2GTHA 5C4XI 1Q811 1K732 3M3YI 4NBHA 5AN9F 3G4SZ 1VLAA 1YHQ1 1KD11 4RV9A 2RPRA 2ZJQJ 1VQ5H 1YJN1 1VQ4H 1VQPZ 1K83I 4MD8A 3CC2H 2R92I 1WCMI 1K9M1 1VQ9Z 3CCQH 2IZ4A 1NP6A 3I55Z 2AKLA 3IF8A 1QF8A 3CCUZ 3I551 3HOUI 4WF9J 1M1KJ 3CCEZ 5IP7I 4NBBA 3CXCH 5D1PA 1ZB8A 1Q861 3CPWZ 1K8A1 4A3GI 1VQMH 3HKZA 1VQO1 4NH1C 3G71Z 1KC8J 1RNIA 4NBEA 5DM6J 2V8IA 4E30A 3KIFA 1YJWZ 3NH5A 3CD6H 3Q87A 4NOZA 1L1OC 1YJ9Z 3S2DI 4AYBA 1Q82J 4A3EI 3S15I 3CCS1 3NH4A 1JWHC 1YIT1 4UY8M 3NDJA 3GTPI 1YHQH 3OW2Z 1YJNH 1W2BH 2B63I 2M48A 3GTMS 3CCJZ 1VQ7Z 2NVTI 1YI2Z 1YIJZ 3I4NI 3DLLJ 2VUMI 2JS4A 3VB9A 3PO2I 5C3EI 2R7ZI 4MXUA 3FQQA 4WFNJ 4E33A 1QVGH 3CMA1 4MD9A 3NH8A 5C4JI 1VQOH 4A93I 1QVFY 4E2WA 2W03A 1VQ6H 3H3VJ 2EGTA 5CM2M 3HOWI 3CCSH 3NFZA 3F3FC 2E2HI 2QKDA 1YITH 4A3II 3J7A4 1RO0A 2ZJPJ 3CCRZ 2DE7A 1M90J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA4 H;  3CCE H;  5JVG J;  1QVF H;  5AN9 F;  3CPW H;  1S72 H;  3G71 H;  1VQP H;  3PIO J;  2ZJQ J;  1VQ5 H;  1VQ4 H;  3CME H;  3CMA H;  3CC2 H;  3J7Z M;  1YJ9 H;  3CCV H;  3CCQ H;  1Y69 K;  1K73 J;  1VQ8 H;  4IOC J;  3OW2 H;  4WCE J;  2OTJ H;  3CCJ H;  1VQ7 H;  5MLC O;  4WF9 J;  1YI2 H;  1M1K J;  1WKI A;  1YIJ H;  2PA2 A;  3CXC H;  4WFA J;  1Q7Y J;  1VQM H;  4WFB J;  5GAG N;  1KC8 J;  5DM7 J;  1YJW H;  5H1S O;  5DM6 J;  3CD6 H;  5GAD N;  2QEX H;  1Q82 J;  4UY8 M;  1YHQ H;  1YJN H;  1W2B H;  1Q81 J;  3CCM H;  5HL7 J;  3CCL H;  1VQK H;  1KD1 J;  1VQN H;  3DLL J;  5JVH J;  3CC4 H;  4U67 J;  5GAE N;  1N8R J;  1K9M J;  3CCR H;  3CF5 J;  4WFN J;  1QVG H;  3I56 H;  2OTL H;  3PIP J;  3G4S H;  1VQO H;  1VQ6 H;  4IO9 J;  1JJ2 H;  1VQL H;  1Q86 J;  1K8A J;  3G6E H;  1NJI J;  5GAH N;  3CC7 H;  1VQ9 H;  3CCS H;  1YIT H;  4IOA J;  3I55 H;  2ZJP J;  1KQS H;  2ZJR J;  3CCU H;  1M90 J; 
#chains in the Genus database with same CATH topology
 5JVG J;  1N60 B;  4RVG A;  1N5W B;  2YAD A;  3CXC Y;  4AP8 A;  4HH4 A;  4TNU A;  2J6A A;  2QLV B;  1TWH I;  2O53 A;  1VQL Z;  3I07 A;  1M1K 2;  3CMA H;  1QYP A;  4MRI A;  1BRW A;  5C44 I;  3CC7 Z;  1Z01 A;  3C2O A;  1VQN 1;  2W3R B;  1Y69 K;  2QRC B;  2WK5 A;  4NFR A;  1RQF A;  2RIQ A;  2NVY I;  4RVD A;  3CC4 1;  1KC8 2;  1LQL A;  4WCE J;  1KQS Z;  1FDO A;  2B7N A;  2JUB A;  2E9H A;  3HOV I;  4A3F I;  1W2B Y;  2QA4 Z;  1TWG I;  2QIE A;  3C2V A;  1Q82 2;  3I56 1;  1X3W A;  2PA2 A;  1Q7Y J;  3G4S 1;  1NJI 1;  3GTQ I;  3FKI I;  1VQM Z;  5T67 A;  1WII A;  1S72 Z;  4A3C I;  5GAG N;  2V45 A;  2RBL A;  4X46 A;  3CME Z;  1VQP 1;  2HF1 A;  2LIY A;  4BY7 I;  1I3Q I;  5FLM I;  1ZH1 A;  1QVG Y;  3CME 1;  2LEX A;  5EP8 A;  3CCV Z;  4DGL A;  1VQ9 1;  5AYX A;  4Y7N I;  1VQ8 Z;  3VMI A;  3EED A;  2OTJ Z;  1FO4 A;  3ESW A;  3U50 C;  1Q81 J;  4MD7 A;  4XX2 A;  3CCU 1;  4E2Y A;  1W2B Z;  1DL6 A;  3SR6 C;  4Y52 I;  3C2E A;  3CCE 1;  1VQK H;  2R6M A;  4DK1 A;  1KD1 J;  1VQN H;  4LHM A;  1YUK A;  5IP9 I;  3WNZ A;  5JVH J;  3CC4 H;  2K3R A;  4EAF A;  3VMH A;  3G71 1;  2E3T A;  5GAE N;  1K9M J;  4CL1 A;  4NB8 A;  2QR1 B;  1YTE A;  3CF5 J;  4EWC A;  1K73 1;  1YJW 1;  2NVX I;  3BG1 B;  3I56 H;  2QEX Z;  1WW9 A;  1Y1V I;  1YJ9 1;  3H0G I;  5FLX b;  3G4S H;  2Y0S A;  2DE5 A;  2WB1 A;  4USA A;  4IO9 J;  1TWF I;  1VQ6 Z;  4US9 A;  1JJ2 H;  2I3C A;  1M90 2;  4NBA A;  2JNY A;  3FAH A;  1Q86 J;  1K8A J;  3CCJ 1;  2B7P A;  1VQ7 1;  3CCM Z;  3CCL Z;  5GAH N;  4BXX I;  4GA4 A;  1YI2 1;  3L0G A;  1VQ9 H;  1YIJ 1;  5LL6 f;  4A3J I;  4GA5 A;  1N63 B;  2H85 A;  2JIQ A;  2W04 A;  3I55 H;  2OOX B;  3D9X A;  3IX0 A;  1JRO B;  1V97 A;  3CCU H;  1YUA A;  3GKQ A;  2VPZ A;  3CCE H;  3MZL B;  2OTL Z;  1NUI A;  2G2K A;  3T4N B;  3B9J C;  3CPW H;  5FLX f;  3G71 H;  2JR6 A;  1JRP B;  1RM6 A;  3PIO J;  1N62 B;  3AMZ A;  3GTJ I;  3S2H I;  3G6E Z;  3NDI A;  4A3M I;  4YYY A;  1QPN A;  1Q7Y 2;  1YJ9 H;  2JA5 I;  4YEK A;  1FM0 E;  1N2F A;  4MON A;  4E32 A;  3JAM b;  1Y1W I;  2VF1 A;  4IOC J;  3OW2 H;  4A3K I;  1N8R 2;  3HOY I;  3GNN A;  3CCR 1;  1O4U A;  3CCJ H;  1FFU B;  1VQ7 H;  1N61 B;  2E7Z A;  2NAP A;  1YI2 H;  1WKI A;  3KIH A;  1YIJ H;  2JIR A;  2RHB A;  1QVF Z;  1RO2 A;  3AN1 A;  4WFA J;  1SFO I;  3EUB 4;  1TWC I;  2PK7 A;  1Q81 2;  2HU9 A;  4EAD A;  2JMO A;  3MON A;  3RZD I;  1VQ5 Z;  1QXF A;  5T64 A;  3J81 b;  1VQ4 Z;  5H1S O;  3BG0 B;  1VQL 1;  1X0T A;  2I14 A;  1KD1 2;  3CC2 Z;  4NB9 A;  3GTL I;  3S14 I;  4NBD A;  3FC4 A;  2Q51 A;  3CCQ Z;  3CC7 1;  5D1O B;  5T6B A;  3JAM f;  1K9M 2;  4BY1 I;  3RZO I;  3S1N I;  4HGZ A;  2P28 A;  4RS4 A;  3I4M I;  1JJ2 Y;  2QA4 1;  3IFU A;  2GTI A;  3CXC Z;  3S16 I;  4NBC A;  1RLY A;  1VQK Z;  4KWV A;  2NVQ I;  4HGY A;  3TDH B;  1VQM 1;  3C2F A;  1S72 1;  3GTM I;  1N8R J;  1Q86 2;  1K8A 2;  3CCR H;  2GU2 A;  2ZAE B;  3J81 f;  3CD6 Z;  3HOZ I;  4A3L I;  2VUG A;  3AM9 A;  1R9T I;  3CCV 1;  5AYY A;  3C2R A;  3RPF A;  1X3Z A;  3PO3 S;  2KPI A;  1VQ8 1;  1M1K 1;  1YHQ Z;  1UOU A;  3CPW Y;  1YJN Z;  2OTJ 1;  1VQL H;  3H5Q A;  1JJ2 Z;  1NJI J;  3S17 I;  4MH4 A;  3S1Q I;  1KC8 1;  3CC7 H;  4BBR I;  1FFV B;  2BJO A;  4IOA J;  2P3Y A;  3NS1 C;  3GCF A;  3NVZ C;  1KQS H;  2M6N A;  1Q82 1;  2JIP A;  1SIJ A;  2ZJR J;  5HUL A;  1QVG Z;  1USP B;  3OW2 Y;  1VDV A;  2QA4 H;  3HOX I;  2K5R A;  1I6H I;  2J0F A;  5MPO C;  1QPO A;  2QEX 1;  1VQO Z;  2O4H A;  2JA6 I;  3WO1 A;  4S1T A;  1S72 H;  3PAJ A;  4E2Z A;  1VQP H;  2E2J I;  1VQ6 1;  3S1R I;  3CME H;  3CCM 1;  3CCL 1;  2OOY B;  2QRD B;  3QWU A;  3J7Z M;  3J80 b;  3CCV H;  1P9N A;  3CCS Z;  1FIQ C;  2B7Q A;  1YIT Z;  1K73 J;  1VQ8 H;  2IZ3 A;  2OTJ H;  2F4M A;  3GTG I;  2V3V A;  1Z03 A;  4E31 A;  3M4O I;  4KWW A;  5MLC O;  1Q16 A;  3F3P C;  2W55 B;  5D1O A;  4E2X A;  1S7M A;  2OTL 1;  3D6W A;  4X6A I;  3EER A;  3S1M I;  5IT9 b;  2RT9 A;  1OTP A;  1PFT A;  3TE5 B;  2PM9 A;  4ZOH A;  4C80 A;  1ML8 A;  4WFB J;  5DM7 J;  1YJW H;  3FQM A;  3GTO I;  1RO4 A;  3CMA Z;  4C7Y A;  3G6E 1;  2R93 I;  2JA8 I;  1ZB9 A;  5GAD N;  1AA6 A;  2QEX H;  3J80 f;  4A3B I;  3VMG A;  2LFU A;  1M90 1;  1TWA I;  1TFI A;  4US8 A;  2E2I I;  4RVF A;  1YTK A;  2DSJ A;  5HL7 J;  3CCL H;  3CCM H;  4DQY B;  2V8K A;  1Z02 A;  4BBS I;  4A3D I;  5A2Q b;  5IT9 f;  3PO3 I;  1Y1V S;  2F4O A;  3CQZ I;  2V8J A;  3BII E;  4U67 J;  4C7Z A;  4NBF A;  1NJI 2;  1KRL A;  1VQ5 1;  2QRE B;  1VQ4 1;  3NRZ C;  5AYZ A;  1KQS Y;  3CC2 1;  4NBG A;  4QTT A;  2OTL H;  2YU9 I;  3CCQ 1;  3PIP J;  3ETR C;  4QTU A;  4XR5 A;  3MZK B;  3IR7 A;  3GTK I;  4RVH A;  1USP A;  3VTN A;  1QPQ A;  2PMZ A;  1Q7Y 1;  1X1O A;  2JIO A;  3G6E H;  2JA7 I;  3P5J B;  2W3S B;  1VQN Z;  2JBM A;  1N8R 1;  5A2Q f;  1VQK 1;  3CC4 Z;  3NVY C;  1WJ2 A;  3LUS A;  1I50 I;  2OZK A;  3CD6 1;  1QPR A;  2KI7 B;  3I56 Z;  2WAQ A;  2Q4Z A;  2DE6 A;  3K7A I;  1ZXI B;  1QVF H;  2GTH A;  5C4X I;  1Q81 1;  1K73 2;  3M3Y I;  4I9A A;  4NBH A;  5AN9 F;  3G4S Z;  5HUP A;  1VLA A;  1YHQ 1;  1KD1 1;  4RV9 A;  2RPR A;  2Q5W E;  3TQV A;  2ZJQ J;  3NVV C;  1YJN 1;  1VQ5 H;  1YTD A;  1VQ4 H;  3L4P A;  1VQP Z;  1K83 I;  4MD8 A;  1QAP A;  3CC2 H;  2R92 I;  1WCM I;  1K9M 1;  1VQ9 Z;  3CCQ H;  1DGJ A;  2IZ4 A;  2WP4 A;  1N5X A;  1NP6 A;  2AYD A;  3VMM A;  3I55 Z;  2AKL A;  2VPY A;  3IF8 A;  1QF8 A;  3CCU Z;  3I55 1;  3HOU I;  4WF9 J;  1M1K J;  3CCE Z;  5IP7 I;  4NBB A;  3CXC H;  5D1P A;  1ZB8 A;  1Q86 1;  3CPW Z;  1K8A 1;  4A3G I;  1VQM H;  3HKZ A;  1VQO 1;  5HUO A;  4NH1 C;  3G71 Z;  1KC8 J;  1RNI A;  4NBE A;  5DM6 J;  2V8I A;  4E30 A;  3KIF A;  1YJW Z;  3NH5 A;  1NVJ A;  3CD6 H;  3NVW C;  3Q87 A;  4NOZ A;  1AZY A;  3WO0 A;  1L1O C;  1YJ9 Z;  1NVI E;  1FMA E;  3S2D I;  1FDI A;  4AYB A;  1Q82 J;  4A3E I;  3S15 I;  3CCS 1;  3NH4 A;  1JWH C;  1SIW A;  1YIT 1;  4UY8 M;  3NDJ A;  1WZN A;  3GTP I;  1YHQ H;  5EY3 A;  3OW2 Z;  1YJN H;  1W2B H;  2B63 I;  2M48 A;  3GTM S;  3CCJ Z;  2I1O A;  1VQ7 Z;  2NVT I;  2W54 B;  1YI2 Z;  1VLB A;  1YIJ Z;  1SB3 A;  3I4N I;  3DLL J;  2VUM I;  2JS4 A;  3VB9 A;  2OMD A;  2TPT A;  2JIM A;  3PO2 I;  5C3E I;  4GA6 A;  2R7Z I;  4MXU A;  3FQQ A;  4WFN J;  4E33 A;  1QVG H;  3CMA 1;  4MD9 A;  2IV2 X;  3NH8 A;  5C4J I;  1VQO H;  4A93 I;  1QVF Y;  4E2W A;  2W03 A;  1VQ6 H;  3H3V J;  1Y8C A;  2EGT A;  3D2L A;  5CM2 M;  1WYG A;  3HOW I;  2VPW A;  2WK6 A;  3CCS H;  3NFZ A;  3F3F C;  2E2H I;  2QKD A;  1YIT H;  4A3I I;  3J7A 4;  2VPX A;  1RO0 A;  2ZJP J;  3CCR Z;  2DE7 A;  1M90 J; 
#chains in the Genus database with same CATH homology
 5JVG J;  4RVG A;  2YAD A;  3CXC Y;  4HH4 A;  4TNU A;  2J6A A;  2QLV B;  1TWH I;  2O53 A;  1VQL Z;  3I07 A;  1M1K 2;  3CMA H;  1QYP A;  4MRI A;  5C44 I;  3CC7 Z;  1Z01 A;  1VQN 1;  1Y69 K;  2QRC B;  4NFR A;  1RQF A;  2RIQ A;  2NVY I;  4RVD A;  3CC4 1;  1KC8 2;  1LQL A;  4WCE J;  1KQS Z;  2JUB A;  2E9H A;  3HOV I;  4A3F I;  1W2B Y;  2QA4 Z;  1TWG I;  1Q82 2;  3I56 1;  1X3W A;  2PA2 A;  1Q7Y J;  3G4S 1;  1NJI 1;  3GTQ I;  3FKI I;  1VQM Z;  5T67 A;  1WII A;  1S72 Z;  4A3C I;  5GAG N;  2RBL A;  3CME Z;  1VQP 1;  2HF1 A;  2LIY A;  4BY7 I;  1I3Q I;  5FLM I;  1ZH1 A;  1QVG Y;  3CME 1;  3CCV Z;  4DGL A;  1VQ9 1;  4Y7N I;  1VQ8 Z;  3VMI A;  3EED A;  2OTJ Z;  3ESW A;  3U50 C;  1Q81 J;  4MD7 A;  4XX2 A;  3CCU 1;  4E2Y A;  1W2B Z;  1DL6 A;  4Y52 I;  3CCE 1;  1VQK H;  2R6M A;  4DK1 A;  1KD1 J;  1VQN H;  1YUK A;  5IP9 I;  5JVH J;  3CC4 H;  2K3R A;  3VMH A;  3G71 1;  5GAE N;  1K9M J;  4CL1 A;  4NB8 A;  2QR1 B;  3CF5 J;  4EWC A;  1K73 1;  1YJW 1;  2NVX I;  3BG1 B;  3I56 H;  2QEX Z;  1WW9 A;  1Y1V I;  1YJ9 1;  3H0G I;  5FLX b;  3G4S H;  2Y0S A;  2DE5 A;  2WB1 A;  4IO9 J;  1TWF I;  1VQ6 Z;  1JJ2 H;  2I3C A;  1M90 2;  4NBA A;  2JNY A;  1Q86 J;  1K8A J;  3CCJ 1;  1VQ7 1;  3CCM Z;  3CCL Z;  5GAH N;  4BXX I;  1YI2 1;  1VQ9 H;  1YIJ 1;  5LL6 f;  4A3J I;  2H85 A;  2W04 A;  3I55 H;  2OOX B;  3D9X A;  3IX0 A;  3CCU H;  1YUA A;  3GKQ A;  3CCE H;  3MZL B;  2OTL Z;  1NUI A;  2G2K A;  3T4N B;  3CPW H;  5FLX f;  3G71 H;  2JR6 A;  3PIO J;  3GTJ I;  3S2H I;  3G6E Z;  3NDI A;  4A3M I;  1Q7Y 2;  1YJ9 H;  2JA5 I;  1N2F A;  4MON A;  4E32 A;  3JAM b;  1Y1W I;  2VF1 A;  4IOC J;  3OW2 H;  4A3K I;  1N8R 2;  3HOY I;  3CCR 1;  3CCJ H;  1VQ7 H;  1YI2 H;  1WKI A;  3KIH A;  1YIJ H;  2RHB A;  1QVF Z;  1RO2 A;  4WFA J;  1SFO I;  1TWC I;  2PK7 A;  1Q81 2;  2HU9 A;  2JMO A;  3MON A;  3RZD I;  1VQ5 Z;  5T64 A;  3J81 b;  1VQ4 Z;  5H1S O;  3BG0 B;  1VQL 1;  1X0T A;  1KD1 2;  3CC2 Z;  4NB9 A;  3GTL I;  3S14 I;  4NBD A;  2Q51 A;  3CCQ Z;  3CC7 1;  5D1O B;  5T6B A;  3JAM f;  1K9M 2;  4BY1 I;  3RZO I;  3S1N I;  4HGZ A;  2P28 A;  4RS4 A;  3I4M I;  1JJ2 Y;  2QA4 1;  3IFU A;  2GTI A;  3CXC Z;  3S16 I;  4NBC A;  1RLY A;  1VQK Z;  2NVQ I;  4HGY A;  3TDH B;  1VQM 1;  1S72 1;  3GTM I;  1N8R J;  1Q86 2;  1K8A 2;  3CCR H;  2GU2 A;  2ZAE B;  3J81 f;  3CD6 Z;  3HOZ I;  4A3L I;  2VUG A;  1R9T I;  3CCV 1;  1X3Z A;  3PO3 S;  2KPI A;  1VQ8 1;  1M1K 1;  1YHQ Z;  3CPW Y;  1YJN Z;  2OTJ 1;  1VQL H;  1JJ2 Z;  1NJI J;  3S17 I;  4MH4 A;  3S1Q I;  1KC8 1;  3CC7 H;  4BBR I;  2BJO A;  4IOA J;  2P3Y A;  3GCF A;  1KQS H;  2M6N A;  1Q82 1;  2ZJR J;  1QVG Z;  3OW2 Y;  1USP B;  2QA4 H;  3HOX I;  2K5R A;  1I6H I;  2QEX 1;  1VQO Z;  2O4H A;  2JA6 I;  4S1T A;  1S72 H;  4E2Z A;  1VQP H;  2E2J I;  1VQ6 1;  3S1R I;  3CME H;  3CCM 1;  3CCL 1;  2OOY B;  2QRD B;  3QWU A;  3J7Z M;  3J80 b;  3CCV H;  1P9N A;  3CCS Z;  1YIT Z;  1K73 J;  1VQ8 H;  2IZ3 A;  2OTJ H;  2F4M A;  3GTG I;  1Z03 A;  4E31 A;  3M4O I;  5MLC O;  3F3P C;  5D1O A;  4E2X A;  1S7M A;  2OTL 1;  3D6W A;  4X6A I;  3EER A;  3S1M I;  5IT9 b;  2RT9 A;  1PFT A;  3TE5 B;  2PM9 A;  1ML8 A;  4WFB J;  5DM7 J;  1YJW H;  3FQM A;  3GTO I;  1RO4 A;  3CMA Z;  3G6E 1;  2R93 I;  2JA8 I;  1ZB9 A;  5GAD N;  2QEX H;  3J80 f;  4A3B I;  3VMG A;  2LFU A;  1M90 1;  1TWA I;  1TFI A;  2E2I I;  4RVF A;  3CCM H;  5HL7 J;  3CCL H;  4DQY B;  2V8K A;  1Z02 A;  4BBS I;  4A3D I;  5A2Q b;  5IT9 f;  3PO3 I;  1Y1V S;  2F4O A;  3CQZ I;  2V8J A;  4U67 J;  4NBF A;  1NJI 2;  1KRL A;  1VQ5 1;  2QRE B;  1VQ4 1;  1KQS Y;  3CC2 1;  4NBG A;  4QTT A;  2OTL H;  2YU9 I;  3CCQ 1;  3PIP J;  4QTU A;  3MZK B;  3GTK I;  4RVH A;  1USP A;  3VTN A;  2PMZ A;  1Q7Y 1;  3G6E H;  2JA7 I;  3P5J B;  1VQN Z;  1N8R 1;  5A2Q f;  1VQK 1;  3CC4 Z;  3LUS A;  1I50 I;  2OZK A;  3CD6 1;  2KI7 B;  3I56 Z;  2WAQ A;  2Q4Z A;  2DE6 A;  3K7A I;  1QVF H;  2GTH A;  5C4X I;  1Q81 1;  1K73 2;  3M3Y I;  4NBH A;  5AN9 F;  3G4S Z;  1VLA A;  1YHQ 1;  1KD1 1;  4RV9 A;  2RPR A;  2ZJQ J;  1VQ5 H;  1YJN 1;  1VQ4 H;  1VQP Z;  1K83 I;  4MD8 A;  3CC2 H;  2R92 I;  1WCM I;  1K9M 1;  1VQ9 Z;  3CCQ H;  2IZ4 A;  1NP6 A;  3I55 Z;  2AKL A;  3IF8 A;  1QF8 A;  3CCU Z;  3I55 1;  3HOU I;  4WF9 J;  1M1K J;  3CCE Z;  5IP7 I;  4NBB A;  3CXC H;  5D1P A;  1ZB8 A;  1Q86 1;  3CPW Z;  1K8A 1;  4A3G I;  1VQM H;  3HKZ A;  1VQO 1;  4NH1 C;  3G71 Z;  1KC8 J;  1RNI A;  4NBE A;  5DM6 J;  2V8I A;  4E30 A;  3KIF A;  1YJW Z;  3NH5 A;  3CD6 H;  3Q87 A;  4NOZ A;  1L1O C;  1YJ9 Z;  3S2D I;  4AYB A;  1Q82 J;  4A3E I;  3S15 I;  3CCS 1;  3NH4 A;  1JWH C;  1YIT 1;  4UY8 M;  3NDJ A;  3GTP I;  1YHQ H;  3OW2 Z;  1YJN H;  1W2B H;  2B63 I;  2M48 A;  3GTM S;  3CCJ Z;  1VQ7 Z;  2NVT I;  1YI2 Z;  1YIJ Z;  3I4N I;  3DLL J;  2VUM I;  2JS4 A;  3VB9 A;  3PO2 I;  5C3E I;  2R7Z I;  4MXU A;  3FQQ A;  4WFN J;  4E33 A;  1QVG H;  3CMA 1;  4MD9 A;  3NH8 A;  5C4J I;  1VQO H;  4A93 I;  1QVF Y;  4E2W A;  2W03 A;  1VQ6 H;  3H3V J;  2EGT A;  5CM2 M;  3HOW I;  3CCS H;  3NFZ A;  3F3F C;  2E2H I;  2QKD A;  1YIT H;  4A3I I;  3J7A 4;  1RO0 A;  2ZJP J;  3CCR Z;  2DE7 A;  1M90 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...