5AN9F

Mechanism of eif6 release from the nascent 60s ribosomal subunit
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
217
structure length
217
Chain Sequence
MGRRPARCYRYCKNKPYIKSRYCRGVPDAKIRIFDLGRKKASTDEFPLCVHLISLEKEQLSSEAIEAGRISCNKYISKTGGKDSFHMRVRVHPWHVLRINKMLSCAGADRLQTGMRGAFGKPMGTVARVNIGQIIFSIRTRDNMLANVVEALRRSSYKFPGRQKIVVSKKWGFTAYNREAYQKLKADGRLMNDGANVKVITNHGTLAQYAKDIAAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Eif6 Release from the Nascent 60S Ribosomal Subunit
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
molecule keywords 60S RIBOSOMAL PROTEIN L3
total genus 32
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2015-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00252 Ribosomal_L16 Ribosomal protein L16p/L10e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.330 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5an9F02
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 5an9F01
5DM7J 5DM6J 5JVHJ 3CPWH 3CC2H 5JVGJ 1VQOH 3CCJH 3G71H 3CCMH 5GAGN 1VQKH 1YJ9H 3CF5J 1S72H 3CMAH 4WF9J 3CCEH 5GAHN 3OW2H 5HL7J 1VQ9H 1VQLH 3CCUH 2QA4H 1QVFH 1Q86J 3I55H 3PIOJ 1W2BH 3CXCH 1VQ7H 1YIJH 1M90J 1VQ5H 1Y69K 1K8AJ 2ZJPJ 1K9MJ 4IOAJ 5GAEN 2QEXH 4IO9J 1YI2H 3I56H 1KQSH 3J7ZM 5GADN 1YHQH 3G6EH 1VQPH 3CMEH 2ZJQJ 4IOCJ 3CC4H 4UY8M 1VQ4H 1YJNH 3CC7H 3CCQH 4U67J 1KD1J 4WCEJ 4WFNJ 1QVGH 1KC8J 1Q82J 1VQNH 3CD6H 3CCSH 5H1SO 1WKIA 3CCRH 5AN9F 5MLCO 1Q81J 1M1KJ 3DLLJ 1VQ6H 1N8RJ 1Q7YJ 3G4SH 3CCVH 1YJWH 1YITH 2OTJH 1VQMH 3CCLH 1JJ2H 2OTLH 3PIPJ 1VQ8H 2ZJRJ 4WFAJ 4WFBJ 2PA2A 1NJIJ 1K73J
chains in the Genus database with same CATH superfamily
1ML8A 2VPWA 3NH8A 1VQ8Z 2OTLZ 3C2FA 3S15I 1VQMZ 2OTJZ 3NS1C 5JVHJ 4QTTA 3CCV1 1Q7Y2 5EP8A 3J7A4 3G71H 1NJI1 2BJOA 1QYPA 3GTOI 2O53A 3CCUZ 2NVXI 3FAHA 1VQKH 1WW9A 4EAFA 1N63B 3CCSZ 5D1OA 4E31A 3GTMS 3CCEH 4MD8A 1VQNZ 5AYXA 2J6AA 4RVHA 3OW2H 1RM6A 3KIFA 5A2Qb 3GTKI 3S1QI 1Q812 3CCUH 3KIHA 1S7MA 3FQQA 1Q86J 3GTJI 3EERA 2K5RA 1W2BH 4A3GI 5IP9I 4YYYA 5T64A 4NFRA 1QVFY 3C2OA 1VQN1 3M3YI 4CL1A 3WO0A 2VPYA 4A93I 1Y8CA 1VQ5H 3AN1A 1YHQZ 2Y0SA 5FLMI 1QF8A 1QVGY 2E3TA 3FKII 3CC4Z 1VQ81 2ZJPJ 2NVYI 2JA8I 2QRDB 2JIMA 1YI2H 3I56H 1KQSH 2LEXA 1SFOI 5GADN 3CC71 3CCVZ 3HOUI 1FIQC 2DE5A 1KRLA 2KI7B 2M6NA 2NAPA 1OTPA 3FC4A 1V97A 2QREB 2LIYA 3GTQI 3CCS1 1VQM1 1QVGZ 1FFVB 5AYZA 2E7ZA 4US8A 1W2BZ 1FO4A 2OZKA 3TE5B 4U67J 2IZ3A 1N2FA 3J80f 1QXFA 1ZH1A 1R9TI 3PO2I 1QVGH 3PO3I 1JRPB 2VPXA 1VQNH 3CCSH 1RO0A 4NH1C 3T4NB 2Q5WE 4A3KI 3F3FC 2PMZA 1Q81J 1VQP1 3CMEZ 1YI2Z 2JMOA 3GKQA 4MXUA 1YIT1 1K9M2 4KWVA 2RBLA 1YITH 2PK7A 3IF8A 3CCLH 2EGTA 5AYYA 5FLXb 1X1OA 1VQ8H 4MONA 2VPZA 2PM9A 2RT9A 1WIIA 1RLYA 1S721 4WFBJ 4EADA 4LHMA 3C2RA 1YHQ1 3CC41 1YIJ1 2ZAEB 2E2HI 4TNUA 3CCLZ 1PFTA 4X6AI 3GNNA 2DE7A 1JJ2Z 5DM7J 3CMA1 1YITZ 5DM6J 1RNIA 3HOZI 5HUPA 2F4OA 4E2WA 2RHBA 1N5XA 3J81b 1VQO1 4NB9A 5FLXf 3HOWI 5GAGN 1YJ9H 1I6HI 4HGZA 5MPOC 3CPWY 2E2JI 1N5WB 1S72H 1N62B 2VUGA 1NJI2 3HOVI 1VQKZ 2WK6A 4C80A 2JIQA 2AYDA 3I07A 1K8A2 4BY1I 1JJ2Y 1VQ9H 2J0FA 1VQLH 3GTGI 1JWHC 3S16I 3S2HI 1FM0E 1Z01A 1Y1VI 3EEDA 3CME1 1YI21 1N8R2 1WZNA 4NBBA 3CXCH 3OW2Z 5D1PA 1QPNA 4MH4A 3Q87A 3CCEZ 3TDHB 1O4UA 3G711 1WYGA 1M90J 3S1MI 1W2BY 1VQPZ 4A3CI 4Y7NI 3VTNA 2K3RA 1Q861 1K732 1K8AJ 2JA6I 3VMHA 5A2Qf 1KQSZ 4A3EI 1YTDA 2YADA 4BY7I 2Q51A 2P3YA 1YUKA 3K7AI 4RVGA 3J7ZM 4A3FI 3F3PC 4BXXI 2QRCB 2JS4A 2NVTI 3NVZC 3OW2Y 2I14A 1YHQH 2Q4ZA 4E33A 2G2KA 4DQYB 2VF1A 2QLVB 4HGYA 1YIJZ 3D2LA 4UY8M 3CCL1 1VQ4H 2JBMA 3P5JB 1Q821 1KC81 1VQK1 3CC7H 3CCQH 1SIJA 2O4HA 3CCMZ 1YTKA 5C4XI 3B9JC 4WFNJ 4WCEJ 4US9A 1FFUB 3ESWA 1UOUA 5CM2M 3CCR1 1Q862 3PO3S 1VLBA 3S2DI 4C7ZA 2GTIA 4YEKA 1NVJA 2W3SB 4C7YA 1WKIA 5MLCO 1WCMI 3G71Z 1DL6A 1RO2A 3ETRC 1VQ6H 4A3BI 3CPWZ 3BG1B 1N8RJ 4DK1A 3G4SH 1YJWH 3RZDI 4AYBA 3IX0A 2OTJH 4MD9A 1VQMH 3CCJZ 2OTLH 3H3VJ 3PIPJ 4MRIA 3HOYI 3CCE1 2W04A 1Q811 3I4MI 3CD61 2JUBA 5IP7I 2PA2A 3AM9A 1NJIJ 4E2YA 3LUSA 1QPOA 2W3RB 3IR7A 4MD7A 1VDVA 2B7NA 2OOXB 2OOYB 3JAMb 3G4S1 3J80b 3C2EA 5JVGJ 1VQOH 3CCJH 2JIRA 3SR6C 3CCMH 4S1TA 3VMIA 1I50I 3MZLB 3CCRZ 1VQLZ 1KQSY 3CF5J 3CMAH 5GAHN 3L4PA 1Z03A 3U50C 3CMAZ 3CC2Z 1QAPA 1NP6A 4NBDA 3NH4A 1M1K2 1LQLA 4NBFA 1QVFH 2QEX1 3FQMA 1Z02A 1VQOZ 1KD11 4A3LI 1I3QI 1AA6A 2WP4A 1FDOA 2F4MA 3I55H 1YJNZ 3CCQ1 1VQ7H 2B63I 5T67A 2JA7I 4ZOHA 4NBCA 3CC21 2H85A 4I9AA 1VQ71 2GTHA 5C3EI 3IFUA 2V8IA 4IOAJ 1ZXIB 2QEXH 4IO9J 2QA41 1KD12 3CCJ1 4GA5A 5EY3A 3S14I 3G4SZ 3BG0B 1Q7Y1 2QIEA 3TQVA 1M901 3G6EH 2B7QA 3MONA 2ZJQJ 3CMEH 3D6WA 4RS4A 2I3CA 1BRWA 1N61B 1VQ41 2OMDA 1K731 3VMGA 1TWFI 2E9HA 4A3MI 2QA4Z 1USPA 2R6MA 1KD1J 2HU9A 4RVDA 3CXCZ 3RPFA 2NVQI 1VQ91 1X3WA 1K83I 4GA4A 4XX2A 4E30A 5D1OB 4BBSI 2DE6A 3CCQZ 1YTEA 2RPRA 2JIOA 3C2VA 3CD6H 2RIQA 1VQ4Z 3AMZA 4HH4A 1WJ2A 3CCM1 1M1KJ 2WAQA 2QEXZ 3CXCY 1USPB 1TWCI 2JNYA 3GTLI 1Q7YJ 4Y52I 1YJN1 1Y1WI 1FDIA 1QPRA 1X3ZA 1NUIA 4BBRI 2VUMI 3CCU1 1ZB9A 3WNZA 3PAJA 1VQ7Z 3HOXI 2W03A 1VLAA 1N8R1 2DSJA 3JAMf 2R92I 2QR1B 4GA6A 4NBEA 3NRZC 4RVFA 2YU9I 5IT9f 3CPWH 3CC2H 3S1RI 1FMAE 2KPIA 2IZ4A 1VQ9Z 3S17I 3CD6Z 3VMMA 1JROB 1TFIA 1L1OC 4WF9J 5T6BA 3I551 2JR6A 4A3DI 2QKDA 4NBAA 4DGLA 2HF1A 3CQZI 3G6E1 5C44I 3I4NI 5HL7J 2R93I 4XR5A 3NDIA 2R7ZI 1YJ9Z 2LFUA 5HULA 2QA4H 4RV9A 3WO1A 3I56Z 4KWWA 2WB1A 1TWGI 3GTPI 4NBHA 1Q822 1KC82 3PIOJ 3NVYC 1VQL1 3D9XA 1RQFA 4NBGA 1P9NA 3S1NI 4NB8A 1YIJH 3G6EZ 2W55B 3NVVC 1Y69K 1VQ51 3BIIE 1ZB8A 3NH5A 2TPTA 1K9MJ 2IV2X 1NVIE 1VQ6Z 5GAEN 3I561 2WK5A 3H0GI 3HKZA 1YJW1 1AZYA 5C4JI 5IT9b 4E32A 1VQPH 1K8A1 4NOZA 1SIWA 1YUAA 3NVWC 4E2XA 2V8KA 3CC4H 4IOCJ 1M902 1VQ5Z 2JIPA 1YJNH 1DGJA 3I55Z 1N60B 1SB3A 2JA5I 1QVFZ 3GCFA 4X46A 2V3VA 3J81f 1YJWZ 3L0GA 3MZKB 3M4OI 4QTUA 3RZOI 1Q82J 1KC8J 2W54B 4AP8A 4EWCA 3GTMI 2B7PA 1TWHI 3VB9A 1S72Z 5H1SO 3CCRH 5AN9F 1Y1VS 2I1OA 1K9M1 5HUOA 1TWAI 1YJ91 1Q16A 2E2II 2AKLA 5LL6f 2OTL1 3NDJA 4USAA 2GU2A 2V8JA 3DLLJ 4A3JI 2OTJ1 3H5QA 3CCVH 4A3II 2P28A 1VQ61 3QWUA 4E2ZA 1JJ2H 2V45A 1RO4A 3CC7Z 3EUB4 2ZJRJ 2M48A 1QPQA 4WFAJ 1M1K1 1X0TA 3NFZA 1K73J
chains in the Genus database with same CATH topology
1ML8A 3NH8A 1VQ8Z 2OTLZ 3S15I 1VQMZ 2OTJZ 5JVHJ 4QTTA 3CCV1 1Q7Y2 3J7A4 3G71H 1NJI1 2BJOA 1QYPA 3GTOI 2O53A 3CCUZ 2NVXI 1VQKH 1WW9A 3CCSZ 5D1OA 4E31A 3GTMS 3CCEH 4MD8A 1VQNZ 2J6AA 4RVHA 3OW2H 3KIFA 5A2Qb 3GTKI 3S1QI 1Q812 3CCUH 3KIHA 1S7MA 3FQQA 1Q86J 3GTJI 3EERA 2K5RA 1W2BH 4A3GI 5IP9I 5T64A 4NFRA 1QVFY 1VQN1 3M3YI 4CL1A 4A93I 1VQ5H 1YHQZ 2Y0SA 5FLMI 1QF8A 1QVGY 3FKII 3CC4Z 1VQ81 2ZJPJ 2NVYI 2JA8I 2QRDB 1YI2H 3I56H 1KQSH 1SFOI 5GADN 3CC71 3CCVZ 3HOUI 2DE5A 1KRLA 2KI7B 2M6NA 2QREB 2LIYA 3GTQI 3CCS1 1VQM1 1QVGZ 1W2BZ 2OZKA 3TE5B 4U67J 2IZ3A 1N2FA 3J80f 1ZH1A 1R9TI 3PO2I 1QVGH 3PO3I 1VQNH 3CCSH 1RO0A 4NH1C 3T4NB 4A3KI 3F3FC 2PMZA 1Q81J 1VQP1 3CMEZ 1YI2Z 2JMOA 3GKQA 4MXUA 1YIT1 1K9M2 2RBLA 1YITH 2PK7A 3IF8A 3CCLH 2EGTA 5FLXb 1VQ8H 4MONA 2PM9A 2RT9A 1WIIA 1RLYA 1S721 4WFBJ 1YHQ1 3CC41 1YIJ1 2ZAEB 2E2HI 4TNUA 3CCLZ 1PFTA 4X6AI 5DM7J 2DE7A 1JJ2Z 3CMA1 1YITZ 5DM6J 1RNIA 3HOZI 2F4OA 4E2WA 2RHBA 3J81b 1VQO1 4NB9A 5FLXf 3HOWI 5GAGN 1YJ9H 1I6HI 4HGZA 3CPWY 2E2JI 1S72H 2VUGA 1NJI2 3HOVI 1VQKZ 3I07A 1K8A2 4BY1I 1JJ2Y 1VQ9H 1VQLH 3GTGI 1JWHC 3S16I 3S2HI 1Z01A 1Y1VI 3EEDA 3CME1 1YI21 1N8R2 4NBBA 3CXCH 3OW2Z 5D1PA 4MH4A 3Q87A 3CCEZ 3TDHB 3G711 1M90J 3S1MI 1W2BY 1VQPZ 4A3CI 4Y7NI 3VTNA 2K3RA 1K732 1Q861 1K8AJ 2JA6I 3VMHA 5A2Qf 1KQSZ 4A3EI 2YADA 4BY7I 2Q51A 2P3YA 1YUKA 3K7AI 4RVGA 3J7ZM 4A3FI 3F3PC 4BXXI 2QRCB 2JS4A 2NVTI 1YHQH 3OW2Y 2Q4ZA 4E33A 2G2KA 4DQYB 2VF1A 2QLVB 4HGYA 1YIJZ 4UY8M 3CCL1 1VQ4H 3P5JB 1Q821 1KC81 1VQK1 3CC7H 3CCQH 2O4HA 3CCMZ 5C4XI 4WFNJ 4WCEJ 3ESWA 5CM2M 3CCR1 1Q862 3PO3S 3S2DI 2GTIA 1WKIA 5MLCO 1WCMI 3G71Z 1DL6A 1RO2A 1VQ6H 4A3BI 3CPWZ 3BG1B 1N8RJ 4DK1A 3G4SH 1YJWH 3RZDI 4AYBA 3IX0A 2OTJH 4MD9A 1VQMH 3CCJZ 2OTLH 3H3VJ 3PIPJ 4MRIA 3HOYI 3CCE1 2W04A 1Q811 3I4MI 3CD61 2JUBA 5IP7I 2PA2A 1NJIJ 4E2YA 3LUSA 4MD7A 2OOXB 2OOYB 3JAMb 3G4S1 3J80b 5JVGJ 1VQOH 3CCJH 3CCMH 4S1TA 3VMIA 1I50I 3MZLB 3CCRZ 1VQLZ 1KQSY 3CF5J 3CMAH 5GAHN 1Z03A 3U50C 3CMAZ 3CC2Z 1NP6A 4NBDA 3NH4A 1M1K2 1LQLA 4NBFA 1QVFH 2QEX1 3FQMA 1Z02A 1VQOZ 1KD11 4A3LI 1I3QI 3I55H 2F4MA 1YJNZ 3CCQ1 1VQ7H 2B63I 5T67A 2JA7I 4NBCA 3CC21 2H85A 1VQ71 2GTHA 5C3EI 3IFUA 2V8IA 4IOAJ 2QEXH 4IO9J 2QA41 1KD12 3CCJ1 3S14I 3G4SZ 3BG0B 1Q7Y1 1M901 3G6EH 3MONA 2ZJQJ 3CMEH 3D6WA 4RS4A 2I3CA 1VQ41 1K731 3VMGA 1TWFI 2E9HA 4A3MI 2QA4Z 1USPA 2R6MA 1KD1J 2HU9A 4RVDA 3CXCZ 2NVQI 1VQ91 1X3WA 1K83I 4XX2A 4E30A 5D1OB 4BBSI 2DE6A 3CCQZ 2RPRA 3CD6H 2RIQA 1VQ4Z 4HH4A 3CCM1 1M1KJ 2WAQA 2QEXZ 3CXCY 1USPB 1TWCI 2JNYA 3GTLI 1Q7YJ 4Y52I 1Y1WI 1YJN1 1X3ZA 1NUIA 4BBRI 2VUMI 3CCU1 1ZB9A 1VQ7Z 3HOXI 2W03A 1VLAA 1N8R1 3JAMf 2R92I 2QR1B 4NBEA 4RVFA 2YU9I 5IT9f 3CPWH 3CC2H 3S1RI 2KPIA 2IZ4A 1VQ9Z 3S17I 3CD6Z 1TFIA 1L1OC 4WF9J 5T6BA 3I551 2JR6A 4A3DI 2QKDA 4NBAA 4DGLA 2HF1A 3CQZI 3G6E1 5C44I 3I4NI 5HL7J 2R93I 3NDIA 2R7ZI 1YJ9Z 2LFUA 2QA4H 4RV9A 3I56Z 2WB1A 1TWGI 3GTPI 4NBHA 1Q822 1KC82 3PIOJ 1VQL1 3D9XA 1RQFA 4NBGA 1P9NA 3S1NI 4NB8A 1YIJH 3G6EZ 1Y69K 1VQ51 1ZB8A 3NH5A 1K9MJ 1VQ6Z 5GAEN 3I561 3H0GI 3HKZA 1YJW1 5C4JI 5IT9b 4E32A 1VQPH 1K8A1 4NOZA 1YUAA 4E2XA 2V8KA 3CC4H 4IOCJ 1M902 1VQ5Z 1YJNH 3I55Z 2JA5I 1QVFZ 3GCFA 3J81f 1YJWZ 3MZKB 3M4OI 4QTUA 3RZOI 1Q82J 1KC8J 4EWCA 3GTMI 1TWHI 3VB9A 1S72Z 5H1SO 3CCRH 5AN9F 1Y1VS 1K9M1 1TWAI 1YJ91 2E2II 2AKLA 5LL6f 2OTL1 3NDJA 2GU2A 2V8JA 3DLLJ 4A3JI 2OTJ1 3CCVH 4A3II 2P28A 1VQ61 3QWUA 4E2ZA 1JJ2H 1RO4A 3CC7Z 2ZJRJ 2M48A 4WFAJ 1M1K1 1X0TA 3NFZA 1K73J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DM7 J;  5DM6 J;  5JVH J;  3CPW H;  3CC2 H;  5JVG J;  1VQO H;  3CCJ H;  3G71 H;  3CCM H;  5GAG N;  1VQK H;  1YJ9 H;  3CF5 J;  1S72 H;  3CMA H;  4WF9 J;  3CCE H;  5GAH N;  3OW2 H;  5HL7 J;  1VQ9 H;  1VQL H;  3CCU H;  2QA4 H;  1QVF H;  1Q86 J;  3I55 H;  3PIO J;  1W2B H;  3CXC H;  1VQ7 H;  1YIJ H;  1M90 J;  1VQ5 H;  1Y69 K;  1K8A J;  2ZJP J;  1K9M J;  4IOA J;  5GAE N;  2QEX H;  4IO9 J;  1YI2 H;  3I56 H;  1KQS H;  3J7Z M;  5GAD N;  1YHQ H;  3G6E H;  1VQP H;  3CME H;  2ZJQ J;  4IOC J;  3CC4 H;  4UY8 M;  1VQ4 H;  1YJN H;  3CC7 H;  3CCQ H;  4U67 J;  1KD1 J;  4WCE J;  4WFN J;  1QVG H;  1KC8 J;  1Q82 J;  1VQN H;  3CD6 H;  3CCS H;  5H1S O;  1WKI A;  3CCR H;  5AN9 F;  5MLC O;  1Q81 J;  1M1K J;  3DLL J;  1VQ6 H;  1N8R J;  1Q7Y J;  3G4S H;  3CCV H;  1YJW H;  1YIT H;  2OTJ H;  1VQM H;  3CCL H;  1JJ2 H;  2OTL H;  3PIP J;  1VQ8 H;  2ZJR J;  4WFA J;  4WFB J;  2PA2 A;  1NJI J;  1K73 J; 
#chains in the Genus database with same CATH topology
 1ML8 A;  2VPW A;  3NH8 A;  1VQ8 Z;  2OTL Z;  3C2F A;  3S15 I;  1VQM Z;  2OTJ Z;  3NS1 C;  5JVH J;  4QTT A;  3CCV 1;  1Q7Y 2;  5EP8 A;  3J7A 4;  3G71 H;  1NJI 1;  2BJO A;  1QYP A;  3GTO I;  2O53 A;  3CCU Z;  2NVX I;  3FAH A;  1VQK H;  1WW9 A;  4EAF A;  1N63 B;  3CCS Z;  5D1O A;  4E31 A;  3GTM S;  3CCE H;  4MD8 A;  1VQN Z;  5AYX A;  2J6A A;  4RVH A;  3OW2 H;  1RM6 A;  3KIF A;  5A2Q b;  3GTK I;  3S1Q I;  1Q81 2;  3CCU H;  3KIH A;  1S7M A;  3FQQ A;  1Q86 J;  3GTJ I;  3EER A;  2K5R A;  1W2B H;  4A3G I;  5IP9 I;  4YYY A;  5T64 A;  4NFR A;  1QVF Y;  3C2O A;  1VQN 1;  3M3Y I;  4CL1 A;  3WO0 A;  2VPY A;  4A93 I;  1Y8C A;  1VQ5 H;  3AN1 A;  1YHQ Z;  2Y0S A;  5FLM I;  1QF8 A;  1QVG Y;  2E3T A;  3FKI I;  3CC4 Z;  1VQ8 1;  2ZJP J;  2NVY I;  2JA8 I;  2QRD B;  2JIM A;  1YI2 H;  3I56 H;  1KQS H;  2LEX A;  1SFO I;  5GAD N;  3CC7 1;  3CCV Z;  3HOU I;  1FIQ C;  2DE5 A;  1KRL A;  2KI7 B;  2M6N A;  2NAP A;  1OTP A;  3FC4 A;  1V97 A;  2QRE B;  2LIY A;  3GTQ I;  3CCS 1;  1VQM 1;  1QVG Z;  1FFV B;  5AYZ A;  2E7Z A;  4US8 A;  1W2B Z;  1FO4 A;  2OZK A;  3TE5 B;  4U67 J;  2IZ3 A;  1N2F A;  3J80 f;  1QXF A;  1ZH1 A;  1R9T I;  3PO2 I;  1QVG H;  3PO3 I;  1JRP B;  2VPX A;  1VQN H;  3CCS H;  1RO0 A;  4NH1 C;  3T4N B;  2Q5W E;  4A3K I;  3F3F C;  2PMZ A;  1Q81 J;  1VQP 1;  3CME Z;  1YI2 Z;  2JMO A;  3GKQ A;  4MXU A;  1YIT 1;  1K9M 2;  4KWV A;  2RBL A;  1YIT H;  2PK7 A;  3IF8 A;  3CCL H;  2EGT A;  5AYY A;  5FLX b;  1X1O A;  1VQ8 H;  4MON A;  2VPZ A;  2PM9 A;  2RT9 A;  1WII A;  1RLY A;  1S72 1;  4WFB J;  4EAD A;  4LHM A;  3C2R A;  1YHQ 1;  3CC4 1;  1YIJ 1;  2ZAE B;  2E2H I;  4TNU A;  3CCL Z;  1PFT A;  4X6A I;  3GNN A;  2DE7 A;  1JJ2 Z;  5DM7 J;  3CMA 1;  1YIT Z;  5DM6 J;  1RNI A;  3HOZ I;  5HUP A;  2F4O A;  4E2W A;  2RHB A;  1N5X A;  3J81 b;  1VQO 1;  4NB9 A;  5FLX f;  3HOW I;  5GAG N;  1YJ9 H;  1I6H I;  4HGZ A;  5MPO C;  3CPW Y;  2E2J I;  1N5W B;  1S72 H;  1N62 B;  2VUG A;  1NJI 2;  3HOV I;  1VQK Z;  2WK6 A;  4C80 A;  2JIQ A;  2AYD A;  3I07 A;  1K8A 2;  4BY1 I;  1JJ2 Y;  1VQ9 H;  2J0F A;  1VQL H;  3GTG I;  1JWH C;  3S16 I;  3S2H I;  1FM0 E;  1Z01 A;  1Y1V I;  3EED A;  3CME 1;  1YI2 1;  1N8R 2;  1WZN A;  4NBB A;  3CXC H;  3OW2 Z;  5D1P A;  1QPN A;  4MH4 A;  3Q87 A;  3CCE Z;  3TDH B;  1O4U A;  3G71 1;  1WYG A;  1M90 J;  3S1M I;  1W2B Y;  1VQP Z;  4A3C I;  4Y7N I;  3VTN A;  2K3R A;  1Q86 1;  1K73 2;  1K8A J;  2JA6 I;  3VMH A;  5A2Q f;  1KQS Z;  4A3E I;  1YTD A;  2YAD A;  4BY7 I;  2Q51 A;  2P3Y A;  1YUK A;  3K7A I;  4RVG A;  3J7Z M;  4A3F I;  3F3P C;  4BXX I;  2QRC B;  2JS4 A;  2NVT I;  3NVZ C;  3OW2 Y;  2I14 A;  1YHQ H;  2Q4Z A;  4E33 A;  2G2K A;  4DQY B;  2VF1 A;  2QLV B;  4HGY A;  1YIJ Z;  3D2L A;  4UY8 M;  3CCL 1;  1VQ4 H;  2JBM A;  3P5J B;  1Q82 1;  1KC8 1;  1VQK 1;  3CC7 H;  3CCQ H;  1SIJ A;  2O4H A;  3CCM Z;  1YTK A;  5C4X I;  3B9J C;  4WFN J;  4WCE J;  4US9 A;  1FFU B;  3ESW A;  1UOU A;  5CM2 M;  3CCR 1;  1Q86 2;  3PO3 S;  1VLB A;  3S2D I;  4C7Z A;  2GTI A;  4YEK A;  1NVJ A;  2W3S B;  4C7Y A;  1WKI A;  5MLC O;  1WCM I;  3G71 Z;  1DL6 A;  1RO2 A;  3ETR C;  1VQ6 H;  4A3B I;  3CPW Z;  3BG1 B;  1N8R J;  4DK1 A;  3G4S H;  1YJW H;  3RZD I;  4AYB A;  3IX0 A;  2OTJ H;  4MD9 A;  1VQM H;  3CCJ Z;  2OTL H;  3H3V J;  3PIP J;  4MRI A;  3HOY I;  3CCE 1;  2W04 A;  1Q81 1;  3I4M I;  3CD6 1;  2JUB A;  5IP7 I;  2PA2 A;  3AM9 A;  1NJI J;  4E2Y A;  3LUS A;  1QPO A;  2W3R B;  3IR7 A;  4MD7 A;  1VDV A;  2B7N A;  2OOX B;  2OOY B;  3JAM b;  3G4S 1;  3J80 b;  3C2E A;  5JVG J;  1VQO H;  3CCJ H;  2JIR A;  3SR6 C;  3CCM H;  4S1T A;  3VMI A;  1I50 I;  3MZL B;  3CCR Z;  1VQL Z;  1KQS Y;  3CF5 J;  3CMA H;  5GAH N;  3L4P A;  1Z03 A;  3U50 C;  3CMA Z;  3CC2 Z;  1QAP A;  1NP6 A;  4NBD A;  3NH4 A;  1M1K 2;  1LQL A;  4NBF A;  1QVF H;  2QEX 1;  3FQM A;  1Z02 A;  1VQO Z;  1KD1 1;  4A3L I;  1I3Q I;  1AA6 A;  2WP4 A;  1FDO A;  2F4M A;  3I55 H;  1YJN Z;  3CCQ 1;  1VQ7 H;  2B63 I;  5T67 A;  2JA7 I;  4ZOH A;  4NBC A;  3CC2 1;  2H85 A;  4I9A A;  1VQ7 1;  2GTH A;  5C3E I;  3IFU A;  2V8I A;  4IOA J;  1ZXI B;  2QEX H;  4IO9 J;  2QA4 1;  1KD1 2;  3CCJ 1;  4GA5 A;  5EY3 A;  3S14 I;  3G4S Z;  3BG0 B;  1Q7Y 1;  2QIE A;  3TQV A;  1M90 1;  3G6E H;  2B7Q A;  3MON A;  2ZJQ J;  3CME H;  3D6W A;  4RS4 A;  2I3C A;  1BRW A;  1N61 B;  1VQ4 1;  2OMD A;  1K73 1;  3VMG A;  1TWF I;  2E9H A;  4A3M I;  2QA4 Z;  1USP A;  2R6M A;  1KD1 J;  2HU9 A;  4RVD A;  3CXC Z;  3RPF A;  2NVQ I;  1VQ9 1;  1X3W A;  1K83 I;  4GA4 A;  4XX2 A;  4E30 A;  5D1O B;  4BBS I;  2DE6 A;  3CCQ Z;  1YTE A;  2RPR A;  2JIO A;  3C2V A;  3CD6 H;  2RIQ A;  1VQ4 Z;  3AMZ A;  4HH4 A;  1WJ2 A;  3CCM 1;  1M1K J;  2WAQ A;  2QEX Z;  3CXC Y;  1USP B;  1TWC I;  2JNY A;  3GTL I;  1Q7Y J;  4Y52 I;  1YJN 1;  1Y1W I;  1FDI A;  1QPR A;  1X3Z A;  1NUI A;  4BBR I;  2VUM I;  3CCU 1;  1ZB9 A;  3WNZ A;  3PAJ A;  1VQ7 Z;  3HOX I;  2W03 A;  1VLA A;  1N8R 1;  2DSJ A;  3JAM f;  2R92 I;  2QR1 B;  4GA6 A;  4NBE A;  3NRZ C;  4RVF A;  2YU9 I;  5IT9 f;  3CPW H;  3CC2 H;  3S1R I;  1FMA E;  2KPI A;  2IZ4 A;  1VQ9 Z;  3S17 I;  3CD6 Z;  3VMM A;  1JRO B;  1TFI A;  1L1O C;  4WF9 J;  5T6B A;  3I55 1;  2JR6 A;  4A3D I;  2QKD A;  4NBA A;  4DGL A;  2HF1 A;  3CQZ I;  3G6E 1;  5C44 I;  3I4N I;  5HL7 J;  2R93 I;  4XR5 A;  3NDI A;  2R7Z I;  1YJ9 Z;  2LFU A;  5HUL A;  2QA4 H;  4RV9 A;  3WO1 A;  3I56 Z;  4KWW A;  2WB1 A;  1TWG I;  3GTP I;  4NBH A;  1Q82 2;  1KC8 2;  3PIO J;  3NVY C;  1VQL 1;  3D9X A;  1RQF A;  4NBG A;  1P9N A;  3S1N I;  4NB8 A;  1YIJ H;  3G6E Z;  2W55 B;  3NVV C;  1Y69 K;  1VQ5 1;  3BII E;  1ZB8 A;  3NH5 A;  2TPT A;  1K9M J;  2IV2 X;  1NVI E;  1VQ6 Z;  5GAE N;  3I56 1;  2WK5 A;  3H0G I;  3HKZ A;  1YJW 1;  1AZY A;  5C4J I;  5IT9 b;  4E32 A;  1VQP H;  1K8A 1;  4NOZ A;  1SIW A;  1YUA A;  3NVW C;  4E2X A;  2V8K A;  3CC4 H;  4IOC J;  1M90 2;  1VQ5 Z;  2JIP A;  1YJN H;  1DGJ A;  3I55 Z;  1N60 B;  1SB3 A;  2JA5 I;  1QVF Z;  3GCF A;  4X46 A;  2V3V A;  3J81 f;  1YJW Z;  3L0G A;  3MZK B;  3M4O I;  4QTU A;  3RZO I;  1Q82 J;  1KC8 J;  2W54 B;  4AP8 A;  4EWC A;  3GTM I;  2B7P A;  1TWH I;  3VB9 A;  1S72 Z;  5H1S O;  3CCR H;  5AN9 F;  1Y1V S;  2I1O A;  1K9M 1;  5HUO A;  1TWA I;  1YJ9 1;  1Q16 A;  2E2I I;  2AKL A;  5LL6 f;  2OTL 1;  3NDJ A;  4USA A;  2GU2 A;  2V8J A;  3DLL J;  4A3J I;  2OTJ 1;  3H5Q A;  3CCV H;  4A3I I;  2P28 A;  1VQ6 1;  3QWU A;  4E2Z A;  1JJ2 H;  2V45 A;  1RO4 A;  3CC7 Z;  3EUB 4;  2ZJR J;  2M48 A;  1QPQ A;  4WFA J;  1M1K 1;  1X0T A;  3NFZ A;  1K73 J; 
#chains in the Genus database with same CATH homology
 1ML8 A;  3NH8 A;  1VQ8 Z;  2OTL Z;  3S15 I;  1VQM Z;  2OTJ Z;  5JVH J;  4QTT A;  3CCV 1;  1Q7Y 2;  3J7A 4;  3G71 H;  1NJI 1;  2BJO A;  1QYP A;  3GTO I;  2O53 A;  3CCU Z;  2NVX I;  1VQK H;  1WW9 A;  3CCS Z;  5D1O A;  4E31 A;  3GTM S;  3CCE H;  4MD8 A;  1VQN Z;  2J6A A;  4RVH A;  3OW2 H;  3KIF A;  5A2Q b;  3GTK I;  3S1Q I;  1Q81 2;  3CCU H;  3KIH A;  1S7M A;  3FQQ A;  1Q86 J;  3GTJ I;  3EER A;  2K5R A;  1W2B H;  4A3G I;  5IP9 I;  5T64 A;  4NFR A;  1QVF Y;  1VQN 1;  3M3Y I;  4CL1 A;  4A93 I;  1VQ5 H;  1YHQ Z;  2Y0S A;  5FLM I;  1QF8 A;  1QVG Y;  3FKI I;  3CC4 Z;  1VQ8 1;  2ZJP J;  2NVY I;  2JA8 I;  2QRD B;  1YI2 H;  3I56 H;  1KQS H;  1SFO I;  5GAD N;  3CC7 1;  3CCV Z;  3HOU I;  2DE5 A;  1KRL A;  2KI7 B;  2M6N A;  2QRE B;  2LIY A;  3GTQ I;  3CCS 1;  1VQM 1;  1QVG Z;  1W2B Z;  2OZK A;  3TE5 B;  4U67 J;  2IZ3 A;  1N2F A;  3J80 f;  1ZH1 A;  1R9T I;  3PO2 I;  1QVG H;  3PO3 I;  1VQN H;  3CCS H;  1RO0 A;  4NH1 C;  3T4N B;  4A3K I;  3F3F C;  2PMZ A;  1Q81 J;  1VQP 1;  3CME Z;  1YI2 Z;  2JMO A;  3GKQ A;  4MXU A;  1YIT 1;  1K9M 2;  2RBL A;  1YIT H;  2PK7 A;  3IF8 A;  3CCL H;  2EGT A;  5FLX b;  1VQ8 H;  4MON A;  2PM9 A;  2RT9 A;  1WII A;  1RLY A;  1S72 1;  4WFB J;  1YHQ 1;  3CC4 1;  1YIJ 1;  2ZAE B;  2E2H I;  4TNU A;  3CCL Z;  1PFT A;  4X6A I;  5DM7 J;  2DE7 A;  1JJ2 Z;  3CMA 1;  1YIT Z;  5DM6 J;  1RNI A;  3HOZ I;  2F4O A;  4E2W A;  2RHB A;  3J81 b;  1VQO 1;  4NB9 A;  5FLX f;  3HOW I;  5GAG N;  1YJ9 H;  1I6H I;  4HGZ A;  3CPW Y;  2E2J I;  1S72 H;  2VUG A;  1NJI 2;  3HOV I;  1VQK Z;  3I07 A;  1K8A 2;  4BY1 I;  1JJ2 Y;  1VQ9 H;  1VQL H;  3GTG I;  1JWH C;  3S16 I;  3S2H I;  1Z01 A;  1Y1V I;  3EED A;  3CME 1;  1YI2 1;  1N8R 2;  4NBB A;  3CXC H;  3OW2 Z;  5D1P A;  4MH4 A;  3Q87 A;  3CCE Z;  3TDH B;  3G71 1;  1M90 J;  3S1M I;  1W2B Y;  1VQP Z;  4A3C I;  4Y7N I;  3VTN A;  2K3R A;  1K73 2;  1Q86 1;  1K8A J;  2JA6 I;  3VMH A;  5A2Q f;  1KQS Z;  4A3E I;  2YAD A;  4BY7 I;  2Q51 A;  2P3Y A;  1YUK A;  3K7A I;  4RVG A;  3J7Z M;  4A3F I;  3F3P C;  4BXX I;  2QRC B;  2JS4 A;  2NVT I;  1YHQ H;  3OW2 Y;  2Q4Z A;  4E33 A;  2G2K A;  4DQY B;  2VF1 A;  2QLV B;  4HGY A;  1YIJ Z;  4UY8 M;  3CCL 1;  1VQ4 H;  3P5J B;  1Q82 1;  1KC8 1;  1VQK 1;  3CC7 H;  3CCQ H;  2O4H A;  3CCM Z;  5C4X I;  4WFN J;  4WCE J;  3ESW A;  5CM2 M;  3CCR 1;  1Q86 2;  3PO3 S;  3S2D I;  2GTI A;  1WKI A;  5MLC O;  1WCM I;  3G71 Z;  1DL6 A;  1RO2 A;  1VQ6 H;  4A3B I;  3CPW Z;  3BG1 B;  1N8R J;  4DK1 A;  3G4S H;  1YJW H;  3RZD I;  4AYB A;  3IX0 A;  2OTJ H;  4MD9 A;  1VQM H;  3CCJ Z;  2OTL H;  3H3V J;  3PIP J;  4MRI A;  3HOY I;  3CCE 1;  2W04 A;  1Q81 1;  3I4M I;  3CD6 1;  2JUB A;  5IP7 I;  2PA2 A;  1NJI J;  4E2Y A;  3LUS A;  4MD7 A;  2OOX B;  2OOY B;  3JAM b;  3G4S 1;  3J80 b;  5JVG J;  1VQO H;  3CCJ H;  3CCM H;  4S1T A;  3VMI A;  1I50 I;  3MZL B;  3CCR Z;  1VQL Z;  1KQS Y;  3CF5 J;  3CMA H;  5GAH N;  1Z03 A;  3U50 C;  3CMA Z;  3CC2 Z;  1NP6 A;  4NBD A;  3NH4 A;  1M1K 2;  1LQL A;  4NBF A;  1QVF H;  2QEX 1;  3FQM A;  1Z02 A;  1VQO Z;  1KD1 1;  4A3L I;  1I3Q I;  3I55 H;  2F4M A;  1YJN Z;  3CCQ 1;  1VQ7 H;  2B63 I;  5T67 A;  2JA7 I;  4NBC A;  3CC2 1;  2H85 A;  1VQ7 1;  2GTH A;  5C3E I;  3IFU A;  2V8I A;  4IOA J;  2QEX H;  4IO9 J;  2QA4 1;  1KD1 2;  3CCJ 1;  3S14 I;  3G4S Z;  3BG0 B;  1Q7Y 1;  1M90 1;  3G6E H;  3MON A;  2ZJQ J;  3CME H;  3D6W A;  4RS4 A;  2I3C A;  1VQ4 1;  1K73 1;  3VMG A;  1TWF I;  2E9H A;  4A3M I;  2QA4 Z;  1USP A;  2R6M A;  1KD1 J;  2HU9 A;  4RVD A;  3CXC Z;  2NVQ I;  1VQ9 1;  1X3W A;  1K83 I;  4XX2 A;  4E30 A;  5D1O B;  4BBS I;  2DE6 A;  3CCQ Z;  2RPR A;  3CD6 H;  2RIQ A;  1VQ4 Z;  4HH4 A;  3CCM 1;  1M1K J;  2WAQ A;  2QEX Z;  3CXC Y;  1USP B;  1TWC I;  2JNY A;  3GTL I;  1Q7Y J;  4Y52 I;  1Y1W I;  1YJN 1;  1X3Z A;  1NUI A;  4BBR I;  2VUM I;  3CCU 1;  1ZB9 A;  1VQ7 Z;  3HOX I;  2W03 A;  1VLA A;  1N8R 1;  3JAM f;  2R92 I;  2QR1 B;  4NBE A;  4RVF A;  2YU9 I;  5IT9 f;  3CPW H;  3CC2 H;  3S1R I;  2KPI A;  2IZ4 A;  1VQ9 Z;  3S17 I;  3CD6 Z;  1TFI A;  1L1O C;  4WF9 J;  5T6B A;  3I55 1;  2JR6 A;  4A3D I;  2QKD A;  4NBA A;  4DGL A;  2HF1 A;  3CQZ I;  3G6E 1;  5C44 I;  3I4N I;  5HL7 J;  2R93 I;  3NDI A;  2R7Z I;  1YJ9 Z;  2LFU A;  2QA4 H;  4RV9 A;  3I56 Z;  2WB1 A;  1TWG I;  3GTP I;  4NBH A;  1Q82 2;  1KC8 2;  3PIO J;  1VQL 1;  3D9X A;  1RQF A;  4NBG A;  1P9N A;  3S1N I;  4NB8 A;  1YIJ H;  3G6E Z;  1Y69 K;  1VQ5 1;  1ZB8 A;  3NH5 A;  1K9M J;  1VQ6 Z;  5GAE N;  3I56 1;  3H0G I;  3HKZ A;  1YJW 1;  5C4J I;  5IT9 b;  4E32 A;  1VQP H;  1K8A 1;  4NOZ A;  1YUA A;  4E2X A;  2V8K A;  3CC4 H;  4IOC J;  1M90 2;  1VQ5 Z;  1YJN H;  3I55 Z;  2JA5 I;  1QVF Z;  3GCF A;  3J81 f;  1YJW Z;  3MZK B;  3M4O I;  4QTU A;  3RZO I;  1Q82 J;  1KC8 J;  4EWC A;  3GTM I;  1TWH I;  3VB9 A;  1S72 Z;  5H1S O;  3CCR H;  5AN9 F;  1Y1V S;  1K9M 1;  1TWA I;  1YJ9 1;  2E2I I;  2AKL A;  5LL6 f;  2OTL 1;  3NDJ A;  2GU2 A;  2V8J A;  3DLL J;  4A3J I;  2OTJ 1;  3CCV H;  4A3I I;  2P28 A;  1VQ6 1;  3QWU A;  4E2Z A;  1JJ2 H;  1RO4 A;  3CC7 Z;  2ZJR J;  2M48 A;  4WFA J;  1M1K 1;  1X0T A;  3NFZ A;  1K73 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...