5AN9F

Mechanism of eif6 release from the nascent 60s ribosomal subunit
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
217
structure length
217
Chain Sequence
b'MGRRPARCYRYCKNKPYIKSRYCRGVPDAKIRIFDLGRKKASTDEFPLCVHLISLEKEQLSSEAIEAGRISCNKYISKTGGKDSFHMRVRVHPWHVLRINKMLSCAGADRLQTGMRGAFGKPMGTVARVNIGQIIFSIRTRDNMLANVVEALRRSSYKFPGRQKIVVSKKWGFTAYNREAYQKLKADGRLMNDGANVKVITNHGTLAQYAKDIAAAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 60S RIBOSOMAL PROTEIN L3
publication title Mechanism of Eif6 Release from the Nascent 60S Ribosomal Subunit
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
total genus 32
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2015-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00252 Ribosomal_L16 Ribosomal protein L16p/L10e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.330 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5an9F02
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 5an9F01
2OTJH 1M1KJ 1YIJH 3CC2H 3CCVH 1QVFH 5GAHN 2ZJPJ 4WCEJ 1VQMH 3PIOJ 3CPWH 4IO9J 3I56H 1VQKH 1YI2H 5HL7J 1VQPH 1VQ7H 3CMAH 3PIPJ 3OW2H 5GAGN 5JVHJ 1YHQH 1KD1J 1VQLH 5DM7J 3CD6H 3CCLH 1Q81J 3CC4H 5JVGJ 1Q7YJ 1QVGH 1S72H 1JJ2H 2QEXH 1Q82J 4IOCJ 1K73J 2OTLH 1VQ4H 1YJWH 4WFAJ 1VQ9H 3CXCH 1VQ5H 3CCRH 2QA4H 3CCJH 4WFNJ 4WFBJ 1VQOH 1VQNH 3CCUH 2ZJQJ 1KQSH 1K9MJ 3CMEH 1NJIJ 3CCSH 3G6EH 3CF5J 4UY8M 1KC8J 1N8RJ 1K8AJ 1YJNH 3G71H 1YJ9H 2ZJRJ 4U67J 4WF9J 3CCEH 1Y69K 3J7ZM 5GAEN 1M90J 1VQ8H 5AN9F 1VQ6H 1YITH 5GADN 3DLLJ 5H1SO 5DM6J 3CCMH 1WKIA 1W2BH 4IOAJ 3I55H 2PA2A 5MLCO 3CCQH 3G4SH 1Q86J 3CC7H
chains in the Genus database with same CATH superfamily
1WIIA 3CCLZ 1I50I 3JAMb 2JIRA 3NDIA 3S2DI 1Q812 5FLXf 2O53A 2NAPA 3HOVI 4C7ZA 3I4MI 3S2HI 4YEKA 3I551 3CCVH 3S14I 3G6EZ 3VMGA 2B7QA 2JIPA 4XX2A 4WCEJ 1VQMH 3CPWY 4RV9A 3NH5A 4E2ZA 2JNYA 4NBBA 2JIQA 4IO9J 1YIJ1 2QR1B 1FDOA 2K3RA 3CC21 3I56H 4RVHA 1VQ5Z 4MXUA 3CCRZ 5LL6f 3T4NB 3S17I 4C7YA 1L1OC 3NFZA 2B63I 3NDJA 1NUIA 1AA6A 4ZOHA 3TQVA 1VQOZ 2J6AA 1UOUA 2W54B 1N2FA 4RVDA 5D1PA 2W3RB 1VQK1 2LEXA 2QIEA 1YI21 3WO1A 1VQP1 2E7ZA 3PO3S 1Q81J 3AM9A 3MZKB 5JVGJ 1Q7YJ 5A2Qb 3QWUA 4NBDA 3S1NI 1YJNZ 4MD8A 3F3PC 5C3EI 1QVGH 1VQL1 5C4XI 2VUMI 2QEXH 4IOCJ 1VQ4H 1Y1VS 3B9JC 4WFAJ 3CCL1 4BY1I 1DL6A 2DE6A 2E9HA 3WO0A 3CCJH 3J81f 2RT9A 1YITZ 4WFNJ 5C4JI 2JS4A 1S721 4WFBJ 3JAMf 4Y52I 2TPTA 1FFUB 2WK6A 1SIWA 3CCUH 4RS4A 3MONA 1KQSH 3Q87A 3GTPI 4A3MI 1VQ51 3CCR1 2W3SB 3VMIA 3CMAZ 2P28A 4EWCA 3CCQZ 2IZ3A 1VQO1 3G4SZ 3S15I 1QPRA 3CCSH 3CC7Z 4UY8M 3D2LA 4NBAA 4TNUA 1YHQZ 2B7PA 3GTQI 1QPQA 1O4UA 2JBMA 2JR6A 2VUGA 3GNNA 1N60B 2R93I 2JUBA 2V8IA 4A93I 4A3DI 2WP4A 2QLVB 3VTNA 5FLXb 2I1OA 5MPOC 1VQ8H 3D9XA 3IFUA 1YJN1 3H5QA 4E2XA 4A3EI 3AMZA 1Y1WI 5GADN 2HF1A 3DLLJ 5H1SO 1WYGA 4HGZA 5DM6J 1VQ9Z 5A2Qf 1KD11 2OOYB 3IF8A 3HOXI 1W2BH 2VF1A 4NB8A 5HUOA 3I55H 1YIT1 2JA6I 2OMDA 2PM9A 1KD12 2QRCB 2VPYA 2DE5A 3GTGI 2E2HI 1N62B 1YIJH 1X3ZA 2JA5I 3CC2H 1RQFA 3FQMA 1AZYA 4XR5A 4GA5A 1QVFH 2YADA 2VPZA 3CCQ1 2BJOA 2ZJPJ 2OTLZ 3CC71 2RPRA 3IX0A 2Q4ZA 3PIOJ 2OTJ1 1USPB 4NBHA 1VQKH 1YI2H 1I6HI 1VDVA 5HL7J 2ZAEB 1VQPH 3L0GA 3LUSA 4A3BI 5T6BA 3H0GI 3PIPJ 1VQ6Z 1Q7Y1 4HH4A 1VQNZ 2DE7A 1JWHC 3GTKI 2JA8I 1KD1J 4Y7NI 1KC81 1VQLH 1K8A1 4GA6A 4CL1A 1YTDA 1Q7Y2 3CCLH 5FLMI 4RVFA 2QKDA 3PO3I 1KC82 3S1QI 5T64A 1QVGY 2P3YA 1K8A2 1NP6A 1YJ9Z 1RM6A 2EGTA 1S72H 2YU9I 2V3VA 1ML8A 1SB3A 3IR7A 3CCEZ 3CQZI 4A3II 1Y1VI 3CCVZ 1FFVB 1VQ5H 3RZDI 3CCRH 4NH1C 4E30A 1VQMZ 2OTL1 1VQOH 3VB9A 1YUKA 1KQSY 4HGYA 3MZLB 2B7NA 4E33A 2V8KA 1QPNA 3FC4A 2Y0SA 1OTPA 4DQYB 4BXXI 1M1K1 4US8A 3KIFA 3GTOI 1TWFI 4DK1A 1I3QI 1FIQC 3CF5J 3M3YI 1WJ2A 5D1OB 1VQN1 3C2FA 1KC8J 1Q16A 2K5RA 4S1TA 1K8AJ 1YJNH 2GTIA 1M1K2 2KPIA 2E3TA 2JIMA 2IZ4A 2R92I 3G6E1 3J7ZM 2W04A 3CPWZ 1QVGZ 2WK5A 1YJ91 1YITH 4DGLA 1TFIA 1N63B 1VQ4Z 4A3KI 3C2RA 3CCE1 1WZNA 1ZH1A 3BG1B 3ESWA 3P5JB 1VQ7Z 1VLBA 2KI7B 3CCJZ 4NFRA 2IV2X 2W55B 3CCQH 3G4SH 1KRLA 3CC7H 3U50C 1KQSZ 3CD6Z 2V8JA 2OTJH 1Q821 5HULA 4EAFA 1M1KJ 1Z01A 2M6NA 3CC4Z 4USAA 1QVFY 1N5XA 2RHBA 1QXFA 4BBRI 4E32A 3ETRC 5GAHN 1YTEA 3NRZC 3RPFA 3HKZA 1Q822 1YJWZ 1RO2A 2JIOA 2OZKA 4NB9A 1N5WB 3TE5B 1Z03A 4QTUA 4A3FI 2QA4Z 1RNIA 1JRPB 1Y8CA 1VQ8Z 2J0FA 1QAPA 1QPOA 3OW2H 5GAGN 2I14A 3K7AI 3GTMI 3NH4A 3NH8A 5DM7J 4MD9A 3CMEZ 1ZB8A 1VQ71 3I4NI 3CMA1 1TWCI 1LQLA 3GTJI 5IT9b 1X3WA 3G4S1 3NS1C 3D6WA 3I55Z 2V45A 3F3FC 4E31A 1YHQ1 3G71Z 4NBEA 1JJ2H 1Q82J 1TWAI 4A3GI 5AYXA 2OTLH 3M4OI 2HU9A 4A3LI 3CD61 4NBCA 3CC2Z 4NOZA 3NVWC 2JMOA 3GCFA 4MRIA 3CXCH 2NVQI 2G2KA 3S16I 2WAQA 3C2VA 3C2OA 2DSJA 3PO2I 3BG0B 3H3VJ 1YJW1 1VQNH 3WNZA 3CCMZ 2WB1A 4QTTA 1VQ91 2ZJQJ 4X46A 2RBLA 1YI2Z 3HOZI 2QA41 2QRDB 1TWHI 2LFUA 1NJIJ 4GA4A 2GU2A 2RIQA 3HOUI 2E2JI 3G6EH 2NVYI 1FO4A 1FDIA 4E2WA 3J80b 1SFOI 2JA7I 1VQLZ 1YJ9H 2E2II 1K83I 3CME1 4U67J 3CCEH 1Y69K 3VMMA 3NVZC 4I9AA 2AYDA 3KIHA 2PMZA 1WW9A 1S72Z 3G711 3I56Z 5IT9f 1Z02A 1VLAA 5C44I 1RO0A 4C80A 1USPA 2Q51A 1VQ61 3SR6C 4IOAJ 3NVYC 2Q5WE 5MLCO 4MD7A 5AYYA 4NBFA 1Q86J 4YYYA 2QREB 1TWGI 3CCM1 2GTHA 1QYPA 1K731 1WCMI 3BIIE 3HOWI 4EADA 3C2EA 2QEXZ 1RO4A 1S7MA 4NBGA 1K732 3CPWH 3NVVC 1W2BY 2O4HA 1FMAE 4E2YA 3FKII 3CCV1 4A3JI 2LIYA 3OW2Y 1VQ7H 3J80f 3CMAH 1VQM1 2AKLA 1K9M1 5JVHJ 4LHMA 3CCUZ 5AYZA 4AYBA 1YHQH 3EERA 3I561 3S1MI 1N8R1 4BBSI 3EUB4 4MH4A 1K9M2 2F4OA 3VMHA 3CD6H 1NVJA 3CCSZ 3HOYI 3CC4H 5HUPA 2M48A 1N8R2 1JJ2Y 1X1OA 1M901 2NVTI 1K73J 5D1OA 2NVXI 1P9NA 5EP8A 1YJWH 2OTJZ 2PK7A 5EY3A 3CXCY 1VQ9H 2H85A 4BY7I 3L4PA 1M902 2QA4H 3RZOI 1NJI1 2VPWA 2QEX1 3TDHB 4US9A 3EEDA 1VQ41 3FQQA 2R6MA 1W2BZ 1NJI2 4MONA 2F4MA 3CCJ1 1K9MJ 3CMEH 2I3CA 3GKQA 2VPXA 5IP7I 3OW2Z 1ZB9A 5CM2M 1N8RJ 3CCU1 4X6AI 5IP9I 1FM0E 1YUAA 1YIJZ 3G71H 3S1RI 2R7ZI 3CC41 2ZJRJ 1QVFZ 4WF9J 4KWWA 3CCS1 1DGJA 5GAEN 1M90J 1NVIE 3J7A4 5AN9F 1V97A 1VQ6H 1JJ2Z 1X0TA 1VQKZ 1SIJA 1Q861 4A3CI 2OOXB 1YTKA 1PFTA 1VQPZ 3CCMH 5T67A 4RVGA 1WKIA 3CXCZ 1ZXIB 1R9TI 1VQ81 2W03A 3I07A 4KWVA 1RLYA 3FAHA 3GTLI 1Q811 1Q862 1BRWA 1JROB 2PA2A 3AN1A 1N61B 1QF8A 3GTMS 4AP8A 3PAJA 3J81b
chains in the Genus database with same CATH topology
1WIIA 3CCLZ 1I50I 3JAMb 3NDIA 3S2DI 1Q812 5FLXf 2O53A 3HOVI 3I4MI 3S2HI 3I551 3CCVH 3S14I 3G6EZ 3VMGA 4XX2A 4WCEJ 1VQMH 3CPWY 4RV9A 3NH5A 4E2ZA 2JNYA 4NBBA 4IO9J 1YIJ1 2QR1B 3CC21 2K3RA 3I56H 4RVHA 1VQ5Z 4MXUA 3CCRZ 5LL6f 3T4NB 3S17I 1L1OC 3NFZA 2B63I 3NDJA 1NUIA 1VQOZ 2J6AA 1N2FA 4RVDA 5D1PA 1VQK1 1YI21 1VQP1 3PO3S 1Q81J 3MZKB 5JVGJ 1Q7YJ 5A2Qb 3QWUA 4NBDA 3S1NI 1YJNZ 4MD8A 3F3PC 5C3EI 1QVGH 1VQL1 5C4XI 2VUMI 2QEXH 4IOCJ 1VQ4H 1Y1VS 4WFAJ 3CCL1 4BY1I 1DL6A 2DE6A 2E9HA 3CCJH 3J81f 2RT9A 1YITZ 4WFNJ 5C4JI 2JS4A 1S721 4WFBJ 3JAMf 4Y52I 3CCUH 4RS4A 3MONA 1KQSH 3Q87A 3GTPI 4A3MI 1VQ51 3CCR1 3VMIA 3CMAZ 2P28A 4EWCA 3CCQZ 2IZ3A 1VQO1 3G4SZ 3S15I 3CCSH 3CC7Z 4UY8M 4NBAA 1YHQZ 4TNUA 3GTQI 2JR6A 2VUGA 2R93I 2JUBA 2V8IA 4A93I 4A3DI 2QLVB 3VTNA 5FLXb 1VQ8H 3D9XA 3IFUA 1YJN1 4E2XA 4A3EI 1Y1WI 5GADN 2HF1A 3DLLJ 5H1SO 5DM6J 4HGZA 1VQ9Z 5A2Qf 1KD11 2OOYB 3IF8A 3HOXI 1W2BH 2VF1A 4NB8A 3I55H 1YIT1 2JA6I 2PM9A 1KD12 2QRCB 2DE5A 3GTGI 2E2HI 1YIJH 1X3ZA 2JA5I 3CC2H 1RQFA 3FQMA 1QVFH 2YADA 3CCQ1 2BJOA 2ZJPJ 2OTLZ 3CC71 2RPRA 3IX0A 2Q4ZA 3PIOJ 2OTJ1 1USPB 4NBHA 1VQKH 1YI2H 1I6HI 5HL7J 2ZAEB 1VQPH 3LUSA 4A3BI 5T6BA 3H0GI 3PIPJ 1VQ6Z 1Q7Y1 4HH4A 1VQNZ 2DE7A 1JWHC 3GTKI 2JA8I 1KD1J 4Y7NI 1KC81 1VQLH 1K8A1 4CL1A 1Q7Y2 3CCLH 5FLMI 4RVFA 2QKDA 3PO3I 1KC82 3S1QI 5T64A 1QVGY 2P3YA 1K8A2 1NP6A 1YJ9Z 2EGTA 1S72H 2YU9I 1ML8A 3CCEZ 3CQZI 4A3II 1Y1VI 3CCVZ 1VQ5H 3RZDI 3CCRH 4NH1C 4E30A 1VQMZ 2OTL1 1VQOH 3VB9A 1YUKA 1KQSY 4HGYA 3MZLB 4E33A 2V8KA 2Y0SA 4DQYB 4BXXI 1M1K1 3KIFA 3GTOI 1TWFI 4DK1A 1I3QI 3CF5J 3M3YI 5D1OB 1VQN1 1KC8J 2K5RA 4S1TA 1K8AJ 1YJNH 2GTIA 1M1K2 2KPIA 2IZ4A 2R92I 3G6E1 3J7ZM 2W04A 3CPWZ 1QVGZ 1YJ91 1YITH 4DGLA 1TFIA 1VQ4Z 4A3KI 3CCE1 3BG1B 1ZH1A 3ESWA 3P5JB 1VQ7Z 2KI7B 3CCJZ 4NFRA 3CCQH 3G4SH 1KRLA 3CC7H 3U50C 1KQSZ 3CD6Z 2V8JA 2OTJH 1Q821 1M1KJ 1Z01A 2M6NA 3CC4Z 1QVFY 2RHBA 4E32A 4BBRI 5GAHN 3HKZA 1Q822 1YJWZ 1RO2A 2OZKA 4NB9A 3TE5B 1Z03A 4QTUA 4A3FI 2QA4Z 1RNIA 1VQ8Z 3OW2H 5GAGN 3K7AI 3GTMI 3NH4A 3NH8A 5DM7J 4MD9A 3CMEZ 1ZB8A 1VQ71 3I4NI 3CMA1 1TWCI 1LQLA 3GTJI 5IT9b 1X3WA 3G4S1 3D6WA 3I55Z 3F3FC 4E31A 1YHQ1 3G71Z 4NBEA 1JJ2H 1Q82J 1TWAI 4A3GI 2OTLH 3M4OI 2HU9A 4A3LI 3CD61 4NBCA 3CC2Z 4NOZA 2JMOA 3GCFA 4MRIA 3CXCH 2NVQI 2G2KA 3S16I 2WAQA 3PO2I 3BG0B 3H3VJ 1YJW1 1VQNH 3CCMZ 2WB1A 4QTTA 1VQ91 2ZJQJ 2RBLA 1YI2Z 3HOZI 2QA41 2QRDB 1TWHI 2LFUA 1NJIJ 2GU2A 2RIQA 3HOUI 2E2JI 3G6EH 2NVYI 4E2WA 3J80b 1SFOI 2JA7I 1VQLZ 1YJ9H 2E2II 1K83I 3CME1 4U67J 3CCEH 1Y69K 3KIHA 2PMZA 1WW9A 1S72Z 3G711 3I56Z 5IT9f 1Z02A 1VLAA 5C44I 1RO0A 1USPA 2Q51A 1VQ61 4IOAJ 5MLCO 4MD7A 4NBFA 1Q86J 2QREB 1TWGI 3CCM1 2GTHA 1QYPA 1K731 1WCMI 3HOWI 2QEXZ 1RO4A 1S7MA 4NBGA 1K732 3CPWH 1W2BY 2O4HA 4E2YA 3FKII 3CCV1 4A3JI 2LIYA 3OW2Y 1VQ7H 3J80f 3CMAH 1VQM1 2AKLA 1K9M1 5JVHJ 3CCUZ 4AYBA 1YHQH 3EERA 3I561 3S1MI 1N8R1 4BBSI 4MH4A 1K9M2 2F4OA 3VMHA 3CD6H 3CCSZ 3HOYI 3CC4H 2M48A 1N8R2 1JJ2Y 1M901 2NVTI 1K73J 5D1OA 2NVXI 1P9NA 1YJWH 2OTJZ 2PK7A 3CXCY 1VQ9H 2H85A 4BY7I 1M902 2QA4H 3RZOI 1NJI1 2QEX1 3TDHB 3EEDA 1VQ41 3FQQA 2R6MA 1W2BZ 1NJI2 4MONA 2F4MA 3CCJ1 1K9MJ 3CMEH 2I3CA 3GKQA 5IP7I 3OW2Z 1ZB9A 5CM2M 1N8RJ 3CCU1 4X6AI 5IP9I 3G71H 1YUAA 1YIJZ 3S1RI 2R7ZI 3CC41 2ZJRJ 1QVFZ 4WF9J 3CCS1 5GAEN 1M90J 3J7A4 5AN9F 1VQ6H 1JJ2Z 1X0TA 1VQKZ 1Q861 4A3CI 2OOXB 1PFTA 1VQPZ 3CCMH 5T67A 4RVGA 1WKIA 3CXCZ 1R9TI 1VQ81 2W03A 3I07A 1RLYA 3GTLI 1Q811 1Q862 2PA2A 1QF8A 3GTMS 3J81b
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTJ H;  1M1K J;  1YIJ H;  3CC2 H;  3CCV H;  1QVF H;  5GAH N;  2ZJP J;  4WCE J;  1VQM H;  3PIO J;  3CPW H;  4IO9 J;  3I56 H;  1VQK H;  1YI2 H;  5HL7 J;  1VQP H;  1VQ7 H;  3CMA H;  3PIP J;  3OW2 H;  5GAG N;  5JVH J;  1YHQ H;  1KD1 J;  1VQL H;  5DM7 J;  3CD6 H;  3CCL H;  1Q81 J;  3CC4 H;  5JVG J;  1Q7Y J;  1QVG H;  1S72 H;  1JJ2 H;  2QEX H;  1Q82 J;  4IOC J;  1K73 J;  2OTL H;  1VQ4 H;  1YJW H;  4WFA J;  1VQ9 H;  3CXC H;  1VQ5 H;  3CCR H;  2QA4 H;  3CCJ H;  4WFN J;  4WFB J;  1VQO H;  1VQN H;  3CCU H;  2ZJQ J;  1KQS H;  1K9M J;  3CME H;  1NJI J;  3CCS H;  3G6E H;  3CF5 J;  4UY8 M;  1KC8 J;  1N8R J;  1K8A J;  1YJN H;  3G71 H;  1YJ9 H;  2ZJR J;  4U67 J;  4WF9 J;  3CCE H;  1Y69 K;  3J7Z M;  5GAE N;  1M90 J;  1VQ8 H;  5AN9 F;  1VQ6 H;  1YIT H;  5GAD N;  3DLL J;  5H1S O;  5DM6 J;  3CCM H;  1WKI A;  1W2B H;  4IOA J;  3I55 H;  2PA2 A;  5MLC O;  3CCQ H;  3G4S H;  1Q86 J;  3CC7 H; 
#chains in the Genus database with same CATH topology
 1WII A;  3CCL Z;  1I50 I;  3JAM b;  2JIR A;  3NDI A;  3S2D I;  1Q81 2;  5FLX f;  2O53 A;  2NAP A;  3HOV I;  4C7Z A;  3I4M I;  3S2H I;  4YEK A;  3I55 1;  3CCV H;  3S14 I;  3G6E Z;  3VMG A;  2B7Q A;  2JIP A;  4XX2 A;  4WCE J;  1VQM H;  3CPW Y;  4RV9 A;  3NH5 A;  4E2Z A;  2JNY A;  4NBB A;  2JIQ A;  4IO9 J;  1YIJ 1;  2QR1 B;  1FDO A;  2K3R A;  3CC2 1;  3I56 H;  4RVH A;  1VQ5 Z;  4MXU A;  3CCR Z;  5LL6 f;  3T4N B;  3S17 I;  4C7Y A;  1L1O C;  3NFZ A;  2B63 I;  3NDJ A;  1NUI A;  1AA6 A;  4ZOH A;  3TQV A;  1VQO Z;  2J6A A;  1UOU A;  2W54 B;  1N2F A;  4RVD A;  5D1P A;  2W3R B;  1VQK 1;  2LEX A;  2QIE A;  1YI2 1;  3WO1 A;  1VQP 1;  2E7Z A;  3PO3 S;  1Q81 J;  3AM9 A;  3MZK B;  5JVG J;  1Q7Y J;  5A2Q b;  3QWU A;  4NBD A;  3S1N I;  1YJN Z;  4MD8 A;  3F3P C;  5C3E I;  1QVG H;  1VQL 1;  5C4X I;  2VUM I;  2QEX H;  4IOC J;  1VQ4 H;  1Y1V S;  3B9J C;  4WFA J;  3CCL 1;  4BY1 I;  1DL6 A;  2DE6 A;  2E9H A;  3WO0 A;  3CCJ H;  3J81 f;  2RT9 A;  1YIT Z;  4WFN J;  5C4J I;  2JS4 A;  1S72 1;  4WFB J;  3JAM f;  4Y52 I;  2TPT A;  1FFU B;  2WK6 A;  1SIW A;  3CCU H;  4RS4 A;  3MON A;  1KQS H;  3Q87 A;  3GTP I;  4A3M I;  1VQ5 1;  3CCR 1;  2W3S B;  3VMI A;  3CMA Z;  2P28 A;  4EWC A;  3CCQ Z;  2IZ3 A;  1VQO 1;  3G4S Z;  3S15 I;  1QPR A;  3CCS H;  3CC7 Z;  4UY8 M;  3D2L A;  4NBA A;  4TNU A;  1YHQ Z;  2B7P A;  3GTQ I;  1QPQ A;  1O4U A;  2JBM A;  2JR6 A;  2VUG A;  3GNN A;  1N60 B;  2R93 I;  2JUB A;  2V8I A;  4A93 I;  4A3D I;  2WP4 A;  2QLV B;  3VTN A;  5FLX b;  2I1O A;  5MPO C;  1VQ8 H;  3D9X A;  3IFU A;  1YJN 1;  3H5Q A;  4E2X A;  4A3E I;  3AMZ A;  1Y1W I;  5GAD N;  2HF1 A;  3DLL J;  5H1S O;  1WYG A;  4HGZ A;  5DM6 J;  1VQ9 Z;  5A2Q f;  1KD1 1;  2OOY B;  3IF8 A;  3HOX I;  1W2B H;  2VF1 A;  4NB8 A;  5HUO A;  3I55 H;  1YIT 1;  2JA6 I;  2OMD A;  2PM9 A;  1KD1 2;  2QRC B;  2VPY A;  2DE5 A;  3GTG I;  2E2H I;  1N62 B;  1YIJ H;  1X3Z A;  2JA5 I;  3CC2 H;  1RQF A;  3FQM A;  1AZY A;  4XR5 A;  4GA5 A;  1QVF H;  2YAD A;  2VPZ A;  3CCQ 1;  2BJO A;  2ZJP J;  2OTL Z;  3CC7 1;  2RPR A;  3IX0 A;  2Q4Z A;  3PIO J;  2OTJ 1;  1USP B;  4NBH A;  1VQK H;  1YI2 H;  1I6H I;  1VDV A;  5HL7 J;  2ZAE B;  1VQP H;  3L0G A;  3LUS A;  4A3B I;  5T6B A;  3H0G I;  3PIP J;  1VQ6 Z;  1Q7Y 1;  4HH4 A;  1VQN Z;  2DE7 A;  1JWH C;  3GTK I;  2JA8 I;  1KD1 J;  4Y7N I;  1KC8 1;  1VQL H;  1K8A 1;  4GA6 A;  4CL1 A;  1YTD A;  1Q7Y 2;  3CCL H;  5FLM I;  4RVF A;  2QKD A;  3PO3 I;  1KC8 2;  3S1Q I;  5T64 A;  1QVG Y;  2P3Y A;  1K8A 2;  1NP6 A;  1YJ9 Z;  1RM6 A;  2EGT A;  1S72 H;  2YU9 I;  2V3V A;  1ML8 A;  1SB3 A;  3IR7 A;  3CCE Z;  3CQZ I;  4A3I I;  1Y1V I;  3CCV Z;  1FFV B;  1VQ5 H;  3RZD I;  3CCR H;  4NH1 C;  4E30 A;  1VQM Z;  2OTL 1;  1VQO H;  3VB9 A;  1YUK A;  1KQS Y;  4HGY A;  3MZL B;  2B7N A;  4E33 A;  2V8K A;  1QPN A;  3FC4 A;  2Y0S A;  1OTP A;  4DQY B;  4BXX I;  1M1K 1;  4US8 A;  3KIF A;  3GTO I;  1TWF I;  4DK1 A;  1I3Q I;  1FIQ C;  3CF5 J;  3M3Y I;  1WJ2 A;  5D1O B;  1VQN 1;  3C2F A;  1KC8 J;  1Q16 A;  2K5R A;  4S1T A;  1K8A J;  1YJN H;  2GTI A;  1M1K 2;  2KPI A;  2E3T A;  2JIM A;  2IZ4 A;  2R92 I;  3G6E 1;  3J7Z M;  2W04 A;  3CPW Z;  1QVG Z;  2WK5 A;  1YJ9 1;  1YIT H;  4DGL A;  1TFI A;  1N63 B;  1VQ4 Z;  4A3K I;  3C2R A;  3CCE 1;  1WZN A;  1ZH1 A;  3BG1 B;  3ESW A;  3P5J B;  1VQ7 Z;  1VLB A;  2KI7 B;  3CCJ Z;  4NFR A;  2IV2 X;  2W55 B;  3CCQ H;  3G4S H;  1KRL A;  3CC7 H;  3U50 C;  1KQS Z;  3CD6 Z;  2V8J A;  2OTJ H;  1Q82 1;  5HUL A;  4EAF A;  1M1K J;  1Z01 A;  2M6N A;  3CC4 Z;  4USA A;  1QVF Y;  1N5X A;  2RHB A;  1QXF A;  4BBR I;  4E32 A;  3ETR C;  5GAH N;  1YTE A;  3NRZ C;  3RPF A;  3HKZ A;  1Q82 2;  1YJW Z;  1RO2 A;  2JIO A;  2OZK A;  4NB9 A;  1N5W B;  3TE5 B;  1Z03 A;  4QTU A;  4A3F I;  2QA4 Z;  1RNI A;  1JRP B;  1Y8C A;  1VQ8 Z;  2J0F A;  1QAP A;  1QPO A;  3OW2 H;  5GAG N;  2I14 A;  3K7A I;  3GTM I;  3NH4 A;  3NH8 A;  5DM7 J;  4MD9 A;  3CME Z;  1ZB8 A;  1VQ7 1;  3I4N I;  3CMA 1;  1TWC I;  1LQL A;  3GTJ I;  5IT9 b;  1X3W A;  3G4S 1;  3NS1 C;  3D6W A;  3I55 Z;  2V45 A;  3F3F C;  4E31 A;  1YHQ 1;  3G71 Z;  4NBE A;  1JJ2 H;  1Q82 J;  1TWA I;  4A3G I;  5AYX A;  2OTL H;  3M4O I;  2HU9 A;  4A3L I;  3CD6 1;  4NBC A;  3CC2 Z;  4NOZ A;  3NVW C;  2JMO A;  3GCF A;  4MRI A;  3CXC H;  2NVQ I;  2G2K A;  3S16 I;  2WAQ A;  3C2V A;  3C2O A;  2DSJ A;  3PO2 I;  3BG0 B;  3H3V J;  1YJW 1;  1VQN H;  3WNZ A;  3CCM Z;  2WB1 A;  4QTT A;  1VQ9 1;  2ZJQ J;  4X46 A;  2RBL A;  1YI2 Z;  3HOZ I;  2QA4 1;  2QRD B;  1TWH I;  2LFU A;  1NJI J;  4GA4 A;  2GU2 A;  2RIQ A;  3HOU I;  2E2J I;  3G6E H;  2NVY I;  1FO4 A;  1FDI A;  4E2W A;  3J80 b;  1SFO I;  2JA7 I;  1VQL Z;  1YJ9 H;  2E2I I;  1K83 I;  3CME 1;  4U67 J;  3CCE H;  1Y69 K;  3VMM A;  3NVZ C;  4I9A A;  2AYD A;  3KIH A;  2PMZ A;  1WW9 A;  1S72 Z;  3G71 1;  3I56 Z;  5IT9 f;  1Z02 A;  1VLA A;  5C44 I;  1RO0 A;  4C80 A;  1USP A;  2Q51 A;  1VQ6 1;  3SR6 C;  4IOA J;  3NVY C;  2Q5W E;  5MLC O;  4MD7 A;  5AYY A;  4NBF A;  1Q86 J;  4YYY A;  2QRE B;  1TWG I;  3CCM 1;  2GTH A;  1QYP A;  1K73 1;  1WCM I;  3BII E;  3HOW I;  4EAD A;  3C2E A;  2QEX Z;  1RO4 A;  1S7M A;  4NBG A;  1K73 2;  3CPW H;  3NVV C;  1W2B Y;  2O4H A;  1FMA E;  4E2Y A;  3FKI I;  3CCV 1;  4A3J I;  2LIY A;  3OW2 Y;  1VQ7 H;  3J80 f;  3CMA H;  1VQM 1;  2AKL A;  1K9M 1;  5JVH J;  4LHM A;  3CCU Z;  5AYZ A;  4AYB A;  1YHQ H;  3EER A;  3I56 1;  3S1M I;  1N8R 1;  4BBS I;  3EUB 4;  4MH4 A;  1K9M 2;  2F4O A;  3VMH A;  3CD6 H;  1NVJ A;  3CCS Z;  3HOY I;  3CC4 H;  5HUP A;  2M48 A;  1N8R 2;  1JJ2 Y;  1X1O A;  1M90 1;  2NVT I;  1K73 J;  5D1O A;  2NVX I;  1P9N A;  5EP8 A;  1YJW H;  2OTJ Z;  2PK7 A;  5EY3 A;  3CXC Y;  1VQ9 H;  2H85 A;  4BY7 I;  3L4P A;  1M90 2;  2QA4 H;  3RZO I;  1NJI 1;  2VPW A;  2QEX 1;  3TDH B;  4US9 A;  3EED A;  1VQ4 1;  3FQQ A;  2R6M A;  1W2B Z;  1NJI 2;  4MON A;  2F4M A;  3CCJ 1;  1K9M J;  3CME H;  2I3C A;  3GKQ A;  2VPX A;  5IP7 I;  3OW2 Z;  1ZB9 A;  5CM2 M;  1N8R J;  3CCU 1;  4X6A I;  5IP9 I;  1FM0 E;  1YUA A;  1YIJ Z;  3G71 H;  3S1R I;  2R7Z I;  3CC4 1;  2ZJR J;  1QVF Z;  4WF9 J;  4KWW A;  3CCS 1;  1DGJ A;  5GAE N;  1M90 J;  1NVI E;  3J7A 4;  5AN9 F;  1V97 A;  1VQ6 H;  1JJ2 Z;  1X0T A;  1VQK Z;  1SIJ A;  1Q86 1;  4A3C I;  2OOX B;  1YTK A;  1PFT A;  1VQP Z;  3CCM H;  5T67 A;  4RVG A;  1WKI A;  3CXC Z;  1ZXI B;  1R9T I;  1VQ8 1;  2W03 A;  3I07 A;  4KWV A;  1RLY A;  3FAH A;  3GTL I;  1Q81 1;  1Q86 2;  1BRW A;  1JRO B;  2PA2 A;  3AN1 A;  1N61 B;  1QF8 A;  3GTM S;  4AP8 A;  3PAJ A;  3J81 b; 
#chains in the Genus database with same CATH homology
 1WII A;  3CCL Z;  1I50 I;  3JAM b;  3NDI A;  3S2D I;  1Q81 2;  5FLX f;  2O53 A;  3HOV I;  3I4M I;  3S2H I;  3I55 1;  3CCV H;  3S14 I;  3G6E Z;  3VMG A;  4XX2 A;  4WCE J;  1VQM H;  3CPW Y;  4RV9 A;  3NH5 A;  4E2Z A;  2JNY A;  4NBB A;  4IO9 J;  1YIJ 1;  2QR1 B;  3CC2 1;  2K3R A;  3I56 H;  4RVH A;  1VQ5 Z;  4MXU A;  3CCR Z;  5LL6 f;  3T4N B;  3S17 I;  1L1O C;  3NFZ A;  2B63 I;  3NDJ A;  1NUI A;  1VQO Z;  2J6A A;  1N2F A;  4RVD A;  5D1P A;  1VQK 1;  1YI2 1;  1VQP 1;  3PO3 S;  1Q81 J;  3MZK B;  5JVG J;  1Q7Y J;  5A2Q b;  3QWU A;  4NBD A;  3S1N I;  1YJN Z;  4MD8 A;  3F3P C;  5C3E I;  1QVG H;  1VQL 1;  5C4X I;  2VUM I;  2QEX H;  4IOC J;  1VQ4 H;  1Y1V S;  4WFA J;  3CCL 1;  4BY1 I;  1DL6 A;  2DE6 A;  2E9H A;  3CCJ H;  3J81 f;  2RT9 A;  1YIT Z;  4WFN J;  5C4J I;  2JS4 A;  1S72 1;  4WFB J;  3JAM f;  4Y52 I;  3CCU H;  4RS4 A;  3MON A;  1KQS H;  3Q87 A;  3GTP I;  4A3M I;  1VQ5 1;  3CCR 1;  3VMI A;  3CMA Z;  2P28 A;  4EWC A;  3CCQ Z;  2IZ3 A;  1VQO 1;  3G4S Z;  3S15 I;  3CCS H;  3CC7 Z;  4UY8 M;  4NBA A;  1YHQ Z;  4TNU A;  3GTQ I;  2JR6 A;  2VUG A;  2R93 I;  2JUB A;  2V8I A;  4A93 I;  4A3D I;  2QLV B;  3VTN A;  5FLX b;  1VQ8 H;  3D9X A;  3IFU A;  1YJN 1;  4E2X A;  4A3E I;  1Y1W I;  5GAD N;  2HF1 A;  3DLL J;  5H1S O;  5DM6 J;  4HGZ A;  1VQ9 Z;  5A2Q f;  1KD1 1;  2OOY B;  3IF8 A;  3HOX I;  1W2B H;  2VF1 A;  4NB8 A;  3I55 H;  1YIT 1;  2JA6 I;  2PM9 A;  1KD1 2;  2QRC B;  2DE5 A;  3GTG I;  2E2H I;  1YIJ H;  1X3Z A;  2JA5 I;  3CC2 H;  1RQF A;  3FQM A;  1QVF H;  2YAD A;  3CCQ 1;  2BJO A;  2ZJP J;  2OTL Z;  3CC7 1;  2RPR A;  3IX0 A;  2Q4Z A;  3PIO J;  2OTJ 1;  1USP B;  4NBH A;  1VQK H;  1YI2 H;  1I6H I;  5HL7 J;  2ZAE B;  1VQP H;  3LUS A;  4A3B I;  5T6B A;  3H0G I;  3PIP J;  1VQ6 Z;  1Q7Y 1;  4HH4 A;  1VQN Z;  2DE7 A;  1JWH C;  3GTK I;  2JA8 I;  1KD1 J;  4Y7N I;  1KC8 1;  1VQL H;  1K8A 1;  4CL1 A;  1Q7Y 2;  3CCL H;  5FLM I;  4RVF A;  2QKD A;  3PO3 I;  1KC8 2;  3S1Q I;  5T64 A;  1QVG Y;  2P3Y A;  1K8A 2;  1NP6 A;  1YJ9 Z;  2EGT A;  1S72 H;  2YU9 I;  1ML8 A;  3CCE Z;  3CQZ I;  4A3I I;  1Y1V I;  3CCV Z;  1VQ5 H;  3RZD I;  3CCR H;  4NH1 C;  4E30 A;  1VQM Z;  2OTL 1;  1VQO H;  3VB9 A;  1YUK A;  1KQS Y;  4HGY A;  3MZL B;  4E33 A;  2V8K A;  2Y0S A;  4DQY B;  4BXX I;  1M1K 1;  3KIF A;  3GTO I;  1TWF I;  4DK1 A;  1I3Q I;  3CF5 J;  3M3Y I;  5D1O B;  1VQN 1;  1KC8 J;  2K5R A;  4S1T A;  1K8A J;  1YJN H;  2GTI A;  1M1K 2;  2KPI A;  2IZ4 A;  2R92 I;  3G6E 1;  3J7Z M;  2W04 A;  3CPW Z;  1QVG Z;  1YJ9 1;  1YIT H;  4DGL A;  1TFI A;  1VQ4 Z;  4A3K I;  3CCE 1;  3BG1 B;  1ZH1 A;  3ESW A;  3P5J B;  1VQ7 Z;  2KI7 B;  3CCJ Z;  4NFR A;  3CCQ H;  3G4S H;  1KRL A;  3CC7 H;  3U50 C;  1KQS Z;  3CD6 Z;  2V8J A;  2OTJ H;  1Q82 1;  1M1K J;  1Z01 A;  2M6N A;  3CC4 Z;  1QVF Y;  2RHB A;  4E32 A;  4BBR I;  5GAH N;  3HKZ A;  1Q82 2;  1YJW Z;  1RO2 A;  2OZK A;  4NB9 A;  3TE5 B;  1Z03 A;  4QTU A;  4A3F I;  2QA4 Z;  1RNI A;  1VQ8 Z;  3OW2 H;  5GAG N;  3K7A I;  3GTM I;  3NH4 A;  3NH8 A;  5DM7 J;  4MD9 A;  3CME Z;  1ZB8 A;  1VQ7 1;  3I4N I;  3CMA 1;  1TWC I;  1LQL A;  3GTJ I;  5IT9 b;  1X3W A;  3G4S 1;  3D6W A;  3I55 Z;  3F3F C;  4E31 A;  1YHQ 1;  3G71 Z;  4NBE A;  1JJ2 H;  1Q82 J;  1TWA I;  4A3G I;  2OTL H;  3M4O I;  2HU9 A;  4A3L I;  3CD6 1;  4NBC A;  3CC2 Z;  4NOZ A;  2JMO A;  3GCF A;  4MRI A;  3CXC H;  2NVQ I;  2G2K A;  3S16 I;  2WAQ A;  3PO2 I;  3BG0 B;  3H3V J;  1YJW 1;  1VQN H;  3CCM Z;  2WB1 A;  4QTT A;  1VQ9 1;  2ZJQ J;  2RBL A;  1YI2 Z;  3HOZ I;  2QA4 1;  2QRD B;  1TWH I;  2LFU A;  1NJI J;  2GU2 A;  2RIQ A;  3HOU I;  2E2J I;  3G6E H;  2NVY I;  4E2W A;  3J80 b;  1SFO I;  2JA7 I;  1VQL Z;  1YJ9 H;  2E2I I;  1K83 I;  3CME 1;  4U67 J;  3CCE H;  1Y69 K;  3KIH A;  2PMZ A;  1WW9 A;  1S72 Z;  3G71 1;  3I56 Z;  5IT9 f;  1Z02 A;  1VLA A;  5C44 I;  1RO0 A;  1USP A;  2Q51 A;  1VQ6 1;  4IOA J;  5MLC O;  4MD7 A;  4NBF A;  1Q86 J;  2QRE B;  1TWG I;  3CCM 1;  2GTH A;  1QYP A;  1K73 1;  1WCM I;  3HOW I;  2QEX Z;  1RO4 A;  1S7M A;  4NBG A;  1K73 2;  3CPW H;  1W2B Y;  2O4H A;  4E2Y A;  3FKI I;  3CCV 1;  4A3J I;  2LIY A;  3OW2 Y;  1VQ7 H;  3J80 f;  3CMA H;  1VQM 1;  2AKL A;  1K9M 1;  5JVH J;  3CCU Z;  4AYB A;  1YHQ H;  3EER A;  3I56 1;  3S1M I;  1N8R 1;  4BBS I;  4MH4 A;  1K9M 2;  2F4O A;  3VMH A;  3CD6 H;  3CCS Z;  3HOY I;  3CC4 H;  2M48 A;  1N8R 2;  1JJ2 Y;  1M90 1;  2NVT I;  1K73 J;  5D1O A;  2NVX I;  1P9N A;  1YJW H;  2OTJ Z;  2PK7 A;  3CXC Y;  1VQ9 H;  2H85 A;  4BY7 I;  1M90 2;  2QA4 H;  3RZO I;  1NJI 1;  2QEX 1;  3TDH B;  3EED A;  1VQ4 1;  3FQQ A;  2R6M A;  1W2B Z;  1NJI 2;  4MON A;  2F4M A;  3CCJ 1;  1K9M J;  3CME H;  2I3C A;  3GKQ A;  5IP7 I;  3OW2 Z;  1ZB9 A;  5CM2 M;  1N8R J;  3CCU 1;  4X6A I;  5IP9 I;  3G71 H;  1YUA A;  1YIJ Z;  3S1R I;  2R7Z I;  3CC4 1;  2ZJR J;  1QVF Z;  4WF9 J;  3CCS 1;  5GAE N;  1M90 J;  3J7A 4;  5AN9 F;  1VQ6 H;  1JJ2 Z;  1X0T A;  1VQK Z;  1Q86 1;  4A3C I;  2OOX B;  1PFT A;  1VQP Z;  3CCM H;  5T67 A;  4RVG A;  1WKI A;  3CXC Z;  1R9T I;  1VQ8 1;  2W03 A;  3I07 A;  1RLY A;  3GTL I;  1Q81 1;  1Q86 2;  2PA2 A;  1QF8 A;  3GTM S;  3J81 b; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...