5AN9F

Mechanism of eif6 release from the nascent 60s ribosomal subunit
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
217
structure length
217
Chain Sequence
MGRRPARCYRYCKNKPYIKSRYCRGVPDAKIRIFDLGRKKASTDEFPLCVHLISLEKEQLSSEAIEAGRISCNKYISKTGGKDSFHMRVRVHPWHVLRINKMLSCAGADRLQTGMRGAFGKPMGTVARVNIGQIIFSIRTRDNMLANVVEALRRSSYKFPGRQKIVVSKKWGFTAYNREAYQKLKADGRLMNDGANVKVITNHGTLAQYAKDIAAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 60S RIBOSOMAL PROTEIN L3
publication title Mechanism of Eif6 Release from the Nascent 60S Ribosomal Subunit
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
total genus 32
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2015-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00252 Ribosomal_L16 Ribosomal protein L16p/L10e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.330 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5an9F02
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 5an9F01
1K73J 3DLLJ 5GAHN 2QEXH 3I56H 1VQ5H 1Q82J 3G6EH 4WF9J 3CCSH 3G71H 1Y69K 1N8RJ 1VQ4H 3CCJH 1QVFH 1VQ7H 4WCEJ 1KQSH 3CF5J 3CPWH 1VQPH 3CCMH 3CCUH 2OTLH 3CXCH 5JVHJ 3CD6H 1VQNH 4WFAJ 1Q86J 3J7ZM 1VQ9H 2QA4H 1YI2H 1YIJH 3CCLH 2ZJQJ 1M1KJ 5MLCO 1YHQH 2OTJH 3CC2H 1K8AJ 1VQ8H 3CCQH 1JJ2H 5DM6J 3CC4H 3CMEH 1VQOH 1S72H 2ZJPJ 1YJNH 3PIOJ 3I55H 1YJWH 1K9MJ 1Q7YJ 3CCEH 1Q81J 5DM7J 1M90J 5GAEN 5GADN 3CCVH 3CCRH 5HL7J 4UY8M 1WKIA 4U67J 1QVGH 5H1SO 3G4SH 1VQMH 1W2BH 4IOAJ 5AN9F 5GAGN 1NJIJ 1KD1J 3PIPJ 5JVGJ 3CMAH 4IOCJ 1YITH 1YJ9H 2ZJRJ 3OW2H 4WFBJ 3CC7H 1VQLH 1VQ6H 4IO9J 1VQKH 2PA2A 4WFNJ 1KC8J
chains in the Genus database with same CATH superfamily
2W54B 1K73J 3DLLJ 2W04A 2VPYA 2QEXH 4US8A 2V8JA 4RVDA 2E2HI 3S1RI 4C80A 4WF9J 3CCSH 1USPB 3CMAZ 2QLVB 2GTHA 1N8R1 2QKDA 4BBRI 1O4UA 5A2Qb 3CCJ1 3VMIA 2RHBA 1YITZ 3IF8A 1PFTA 2R92I 2RIQA 3OW2Z 1KQSH 2I14A 2LEXA 1VQL1 3CF5J 3CPWH 4BY7I 3S2DI 2VPWA 3C2VA 3CCMH 1FDOA 1K9M1 1RO2A 3M3YI 1VQMZ 1ZXIB 3IFUA 1W2BZ 1ZB8A 4MRIA 1VQN1 3HOZI 1KC82 5A2Qf 1VQ5Z 2LFUA 2RT9A 2YADA 4BXXI 1RM6A 4WFAJ 5IT9b 3G71Z 1VQ9H 3MZKB 2O53A 1VQ4Z 1YI21 3PO3S 4MD7A 1M1KJ 2NVTI 2GTIA 5MLCO 1S7MA 2OTJ1 4NH1C 3CC21 3Q87A 1JJ2H 3NS1C 2J0FA 1M1K2 3S1MI 1RLYA 4NBAA 4A3LI 3CME1 2I3CA 1S721 1JWHC 3CCM1 3KIHA 3I55H 1YJW1 4E2YA 2NAPA 2OTLZ 2TPTA 4TNUA 3CCEH 4MH4A 2ZAEB 2R6MA 1Z03A 2DE5A 1YTEA 1ZB9A 1V97A 3C2EA 1YIJZ 1LQLA 4HGZA 3CCLZ 1N5XA 3FC4A 3CCVH 1QVFZ 1YHQZ 4DK1A 3CCR1 1VQ7Z 4A93I 3S17I 3C2OA 4U67J 5EY3A 2GU2A 2JA6I 3G4SH 2P28A 4RVGA 1VQMH 3GTOI 1W2BH 1WIIA 4IOAJ 3H3VJ 2BJOA 1NJIJ 2VUMI 4EADA 2B63I 5JVGJ 3FAHA 1QYPA 3CCE1 4X46A 1K9M2 3CMA1 2PM9A 4MONA 5T67A 3J81b 5CM2M 4NBHA 3EERA 2QREB 3AM9A 1YIT1 1YJ9H 4RV9A 4WFBJ 3CC7H 1FFUB 2PA2A 1FMAE 1QVGZ 1N63B 1UOUA 2NVYI 3TDHB 2JNYA 4HGYA 1WZNA 1QPNA 3CC4Z 1QPOA 3GCFA 3CQZI 2M6NA 3HOWI 3BIIE 3SR6C 1VQM1 1L1OC 4EWCA 3J81f 5IP7I 1VQ51 2O4HA 3S16I 3BG1B 5MPOC 1WW9A 2JA8I 1VQ41 1KD12 3CCJH 1QVFH 5D1PA 1M1K1 4USAA 1AA6A 2E3TA 3AMZA 1VQ7H 1YJ91 4E33A 4A3JI 5LL6f 3NVZC 4US9A 4LHMA 4QTUA 3VMMA 1FM0E 3NVYC 2H85A 1AZYA 2OOYB 1Y1WI 1K83I 2R93I 3CXCH 3HOUI 1VQNH 2VF1A 3HKZA 3I56Z 1QPRA 2QRDB 4E2ZA 3QWUA 3G6EZ 1K732 2VUGA 2IV2X 1N62B 3HOYI 1YI2H 1YIJ1 1KQSY 4HH4A 4C7ZA 5C4XI 1R9TI 3CPWY 3NVWC 5T6BA 2OTJH 3CC2H 3GTQI 1K8AJ 1N2FA 1VQ8H 1VQ71 2QRCB 4E2WA 5HUOA 5DM6J 3NRZC 1VQPZ 3CC4H 3CMEH 5FLMI 1FIQC 4KWVA 1S72H 1YJNH 1FFVB 4CL1A 3CCUZ 1YJWH 3GTLI 1X1OA 1WJ2A 1Q7YJ 3CD6Z 3GTJI 1Q81J 2W3RB 3NFZA 1TWGI 1M90J 3MZLB 2RPRA 2QA4Z 1JJ2Y 5GAEN 5GADN 2WK6A 3ETRC 1YTDA 4NFRA 3CCRH 2Q51A 2Q4ZA 3D6WA 4Y52I 5AYXA 2QIEA 1VQ81 1BRWA 3PAJA 5H1SO 2QR1B 3S15I 3CC41 1VQOZ 2JIPA 3B9JC 1YJN1 1I3QI 1Z02A 5AN9F 5IT9f 4YEKA 3KIFA 2W03A 3I4MI 1KD11 1FO4A 1X3WA 1RQFA 3NDIA 2VPXA 2JA5I 3CMAH 1JROB 1YITH 2OMDA 1N61B 1QAPA 4MD8A 3OW2H 3CCQZ 1SB3A 3VTNA 1Y1VI 4A3EI 4E31A 3FQQA 4QTTA 2YU9I 4I9AA 4EAFA 2NVXI 3PO2I 1K731 2W55B 5GAHN 3C2FA 3I561 1VQ5H 3G71H 1Y69K 1USPA 1ML8A 4NBDA 4ZOHA 1N8RJ 4A3CI 1VQ4H 4NBGA 1NJI2 4NBEA 3S2HI 1Y8CA 4A3MI 5D1OB 1K8A1 2JUBA 2E2II 2DSJA 2JIRA 1VQ6Z 3S1NI 3NH5A 3VB9A 1VQKZ 2EGTA 4E30A 4A3KI 1VQP1 1Q16A 3CCU1 2OTLH 2QEXZ 4S1TA 3CD61 5HUPA 1Q811 2WP4A 1TWAI 1Y1VS 3HOVI 1Q86J 3CCSZ 3GTMI 3IX0A 3G711 2JBMA 2QA41 4A3FI 1YIJH 3CCLH 3GTPI 1Q862 1YHQH 2WK5A 3CCQH 1KQSZ 3CPWZ 3CXCY 1FDIA 2V3VA 1TWFI 2JR6A 1VQO1 3PIOJ 2JMOA 3I07A 2DE7A 3T4NB 2OTL1 1TWCI 2F4OA 3LUSA 2JIMA 3P5JB 4NBCA 2OZKA 4MXUA 2P3YA 1VQ9Z 3H5QA 1N5WB 3EUB4 3CCL1 1YHQ1 4NOZA 5C3EI 2B7QA 1JJ2Z 1NP6A 3HOXI 4A3II 5C44I 3CCQ1 3GTGI 1DGJA 1WKIA 2PMZA 3F3PC 1QVGH 4A3GI 5C4JI 2IZ3A 4DGLA 1K8A2 1SIJA 3WO1A 3I55Z 1QXFA 2OOXB 5GAGN 3FQMA 3TQVA 3RZOI 1ZH1A 2V45A 2K5RA 3CCEZ 1NJI1 5AYYA 2E9HA 3PIPJ 4X6AI 4Y7NI 2Q5WE 4NBBA 3D9XA 4IOCJ 1Q7Y2 4AYBA 1YUAA 1Q812 5D1OA 2ZJRJ 3CCVZ 1M902 2B7NA 1RO0A 1VQ61 4IO9J 1VLBA 2NVQI 2HF1A 4DQYB 1VQK1 2VPZA 3VMGA 4WFNJ 3F3FC 1KC8J 3G4SZ 5IP9I 3MONA 2E7ZA 1SIWA 4A3DI 2HU9A 2QEX1 4GA4A 3I56H 4NBFA 1NVIE 5EP8A 1Q82J 3G6EH 1Q861 3CCS1 1I50I 3BG0B 3NH8A 4AP8A 1QF8A 1TWHI 3OW2Y 1Q822 3NH4A 3GKQA 3AN1A 1YJ9Z 4NB8A 2IZ4A 3J7A4 4WCEJ 3CC7Z 3VMHA 4KWWA 1VQPH 1W2BY 3D2LA 2V8KA 3FKII 2B7PA 4MD9A 1YTKA 3CCUH 5FLXb 2JS4A 4XR5A 3GTKI 5JVHJ 3CD6H 1I6HI 3RZDI 3J80b 3J7ZM 3G6E1 1VQ91 2QA4H 2JA7I 2WAQA 3S1QI 3EEDA 3CCJZ 2ZJQJ 4YYYA 2AKLA 2KI7B 1WYGA 3H0GI 2F4MA 3ESWA 2R7ZI 1N8R2 1NVJA 3NVVC 1TFIA 3IR7A 4RS4A 1VQLZ 5FLXf 2I1OA 4RVHA 1X3ZA 1VQOH 2ZJPJ 3TE5B 2JIOA 2V8IA 3J80f 3I551 1K9MJ 2G2KA 3CXCZ 5AYZA 1Q7Y1 4BY1I 1VQNZ 2JIQA 4NB9A 1VDVA 5DM7J 2RBLA 1Z01A 1QVFY 4GA6A 2KPIA 1M901 3WNZA 2DE6A 4GA5A 1YI2Z 4XX2A 3CCV1 2E2JI 4RVFA 2OTJZ 4BBSI 3JAMb 5HL7J 3CC2Z 3L4PA 1VQ8Z 4UY8M 3WO0A 3U50C 1N60B 1OTPA 3GNNA 3I4NI 1VLAA 2W3SB 5T64A 3CMEZ 2WB1A 1KC81 3NDJA 3G4S1 1S72Z 1RNIA 3M4OI 1KRLA 1X0TA 3CCMZ 1YJNZ 1JRPB 1YJWZ 1QPQA 3L0GA 1YUKA 4A3BI 3S14I 2AYDA 1KD1J 3K7AI 4E32A 1Q821 2PK7A 1SFOI 1WCMI 1NUIA 4E2XA 3JAMf 2K3RA 1P9NA 3CCRZ 2Y0SA 1QVGY 3RPFA 1VQLH 3CC71 4C7YA 3C2RA 1VQ6H 2LIYA 2J6AA 1DL6A 2M48A 1VQKH 5HULA 3GTMS 1RO4A 3PO3I
chains in the Genus database with same CATH topology
1K73J 3DLLJ 2W04A 2QEXH 2V8JA 4RVDA 2E2HI 3S1RI 4WF9J 3CCSH 1USPB 3CMAZ 2QLVB 2GTHA 1N8R1 2QKDA 4BBRI 5A2Qb 3CCJ1 3VMIA 2RHBA 1YITZ 3IF8A 1PFTA 2R92I 2RIQA 3OW2Z 1KQSH 1VQL1 3CF5J 3CPWH 4BY7I 3S2DI 3CCMH 1K9M1 1RO2A 3M3YI 1VQMZ 3IFUA 1W2BZ 1ZB8A 4MRIA 1VQN1 3HOZI 1KC82 5A2Qf 1VQ5Z 2LFUA 2RT9A 2YADA 4BXXI 4WFAJ 5IT9b 3G71Z 1VQ9H 3MZKB 2O53A 1VQ4Z 1YI21 3PO3S 4MD7A 1M1KJ 2NVTI 2GTIA 5MLCO 1S7MA 2OTJ1 4NH1C 3CC21 3Q87A 1JJ2H 1M1K2 3S1MI 1RLYA 4NBAA 4A3LI 3CME1 2I3CA 1S721 1JWHC 3CCM1 3KIHA 3I55H 1YJW1 4E2YA 2OTLZ 4TNUA 3CCEH 4MH4A 2ZAEB 2R6MA 1Z03A 2DE5A 1ZB9A 1YIJZ 1LQLA 4HGZA 3CCLZ 3CCVH 1QVFZ 1YHQZ 4DK1A 3CCR1 1VQ7Z 4A93I 3S17I 4U67J 2GU2A 2JA6I 3G4SH 2P28A 4RVGA 1VQMH 3GTOI 1W2BH 1WIIA 4IOAJ 3H3VJ 2BJOA 1NJIJ 2VUMI 2B63I 5JVGJ 1QYPA 3CCE1 1K9M2 3CMA1 2PM9A 4MONA 5T67A 3J81b 5CM2M 4NBHA 3EERA 2QREB 1YIT1 1YJ9H 4RV9A 4WFBJ 3CC7H 2PA2A 1QVGZ 2NVYI 3TDHB 2JNYA 4HGYA 3CC4Z 3GCFA 3CQZI 2M6NA 3HOWI 1VQM1 1L1OC 4EWCA 3J81f 5IP7I 1VQ51 2O4HA 3S16I 3BG1B 1WW9A 2JA8I 1VQ41 1KD12 3CCJH 1QVFH 5D1PA 1M1K1 1VQ7H 1YJ91 4E33A 4A3JI 5LL6f 4QTUA 2H85A 2OOYB 1Y1WI 1K83I 2R93I 3CXCH 3HOUI 1VQNH 2VF1A 3HKZA 3I56Z 2QRDB 4E2ZA 3QWUA 3G6EZ 1K732 2VUGA 3HOYI 1YI2H 1YIJ1 1KQSY 4HH4A 5C4XI 1R9TI 3CPWY 2OTJH 5T6BA 3CC2H 3GTQI 1K8AJ 1N2FA 1VQ8H 1VQ71 2QRCB 4E2WA 5DM6J 1VQPZ 3CC4H 3CMEH 5FLMI 1S72H 1YJNH 4CL1A 3CCUZ 1YJWH 3GTLI 1Q7YJ 3CD6Z 3GTJI 1Q81J 3NFZA 1TWGI 1M90J 3MZLB 2RPRA 2QA4Z 1JJ2Y 5GAEN 5GADN 4NFRA 3CCRH 2Q51A 2Q4ZA 3D6WA 4Y52I 1VQ81 5H1SO 2QR1B 3S15I 3CC41 1VQOZ 1YJN1 1I3QI 1Z02A 5AN9F 5IT9f 3KIFA 2W03A 3I4MI 1KD11 1X3WA 1RQFA 3NDIA 2JA5I 3CMAH 1YITH 3OW2H 4MD8A 3CCQZ 3VTNA 1Y1VI 4A3EI 4E31A 3FQQA 4QTTA 2YU9I 2NVXI 3PO2I 1K731 5GAHN 3I561 1VQ5H 3G71H 1Y69K 1USPA 1ML8A 4NBDA 1N8RJ 4A3CI 1VQ4H 4NBGA 1NJI2 4NBEA 3S2HI 4A3MI 5D1OB 1K8A1 2JUBA 2E2II 1VQ6Z 3S1NI 3NH5A 3VB9A 1VQKZ 2EGTA 4E30A 4A3KI 1VQP1 3CCU1 2OTLH 2QEXZ 4S1TA 3CD61 1Q811 1TWAI 1Y1VS 3HOVI 1Q86J 3CCSZ 3GTMI 3IX0A 3G711 2QA41 4A3FI 1YIJH 3CCLH 3GTPI 1Q862 1YHQH 3CCQH 1KQSZ 3CPWZ 3CXCY 2JR6A 1TWFI 1VQO1 3PIOJ 2JMOA 3I07A 2DE7A 3T4NB 2OTL1 1TWCI 2F4OA 3LUSA 3P5JB 2OZKA 4NBCA 4MXUA 2P3YA 1VQ9Z 3CCL1 1YHQ1 4NOZA 5C3EI 1JJ2Z 1NP6A 3HOXI 4A3II 5C44I 3CCQ1 3GTGI 1WKIA 2PMZA 3F3PC 1QVGH 4A3GI 5C4JI 2IZ3A 4DGLA 1K8A2 3I55Z 2OOXB 5GAGN 3FQMA 3RZOI 1ZH1A 2K5RA 3CCEZ 1NJI1 3PIPJ 2E9HA 4X6AI 4Y7NI 4NBBA 3D9XA 4IOCJ 1Q7Y2 4AYBA 1YUAA 1Q812 5D1OA 2ZJRJ 3CCVZ 1M902 1RO0A 1VQ61 4IO9J 2NVQI 2HF1A 4DQYB 1VQK1 3VMGA 4WFNJ 3F3FC 1KC8J 3G4SZ 5IP9I 3MONA 4A3DI 2HU9A 2QEX1 3I56H 4NBFA 1Q82J 3G6EH 1Q861 3CCS1 1I50I 3BG0B 3NH8A 1QF8A 1TWHI 3OW2Y 1Q822 3NH4A 3GKQA 1YJ9Z 4NB8A 2IZ4A 3J7A4 4WCEJ 3CC7Z 3VMHA 1VQPH 1W2BY 2V8KA 3FKII 4MD9A 3CCUH 5FLXb 2JS4A 3GTKI 5JVHJ 3CD6H 1I6HI 3RZDI 3J80b 3J7ZM 3G6E1 1VQ91 2QA4H 2JA7I 2WAQA 3S1QI 3EEDA 3CCJZ 2ZJQJ 2AKLA 2KI7B 3H0GI 2F4MA 3ESWA 2R7ZI 1N8R2 1TFIA 4RS4A 1VQLZ 5FLXf 4RVHA 1X3ZA 1VQOH 2ZJPJ 3TE5B 2V8IA 3J80f 3I551 1K9MJ 2G2KA 3CXCZ 1Q7Y1 4BY1I 1VQNZ 4NB9A 5DM7J 2RBLA 1Z01A 1QVFY 2KPIA 1M901 2DE6A 1YI2Z 4XX2A 3CCV1 2E2JI 4RVFA 2OTJZ 4BBSI 3JAMb 5HL7J 3CC2Z 1VQ8Z 4UY8M 3U50C 3I4NI 1VLAA 5T64A 3CMEZ 2WB1A 1KC81 3NDJA 3G4S1 1S72Z 1RNIA 3M4OI 1KRLA 1X0TA 3CCMZ 1YJNZ 1YJWZ 1YUKA 4A3BI 3S14I 1KD1J 3K7AI 4E32A 1Q821 2PK7A 1SFOI 1WCMI 1NUIA 4E2XA 3JAMf 2K3RA 1P9NA 3CCRZ 2Y0SA 1QVGY 1VQLH 3CC71 1VQ6H 2LIYA 2J6AA 1DL6A 2M48A 1VQKH 3GTMS 1RO4A 3PO3I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K73 J;  3DLL J;  5GAH N;  2QEX H;  3I56 H;  1VQ5 H;  1Q82 J;  3G6E H;  4WF9 J;  3CCS H;  3G71 H;  1Y69 K;  1N8R J;  1VQ4 H;  3CCJ H;  1QVF H;  1VQ7 H;  4WCE J;  1KQS H;  3CF5 J;  3CPW H;  1VQP H;  3CCM H;  3CCU H;  2OTL H;  3CXC H;  5JVH J;  3CD6 H;  1VQN H;  4WFA J;  1Q86 J;  3J7Z M;  1VQ9 H;  2QA4 H;  1YI2 H;  1YIJ H;  3CCL H;  2ZJQ J;  1M1K J;  5MLC O;  1YHQ H;  2OTJ H;  3CC2 H;  1K8A J;  1VQ8 H;  3CCQ H;  1JJ2 H;  5DM6 J;  3CC4 H;  3CME H;  1VQO H;  1S72 H;  2ZJP J;  1YJN H;  3PIO J;  3I55 H;  1YJW H;  1K9M J;  1Q7Y J;  3CCE H;  1Q81 J;  5DM7 J;  1M90 J;  5GAE N;  5GAD N;  3CCV H;  3CCR H;  5HL7 J;  4UY8 M;  1WKI A;  4U67 J;  1QVG H;  5H1S O;  3G4S H;  1VQM H;  1W2B H;  4IOA J;  5AN9 F;  5GAG N;  1NJI J;  1KD1 J;  3PIP J;  5JVG J;  3CMA H;  4IOC J;  1YIT H;  1YJ9 H;  2ZJR J;  3OW2 H;  4WFB J;  3CC7 H;  1VQL H;  1VQ6 H;  4IO9 J;  1VQK H;  2PA2 A;  4WFN J;  1KC8 J; 
#chains in the Genus database with same CATH topology
 2W54 B;  1K73 J;  3DLL J;  2W04 A;  2VPY A;  2QEX H;  4US8 A;  2V8J A;  4RVD A;  2E2H I;  3S1R I;  4C80 A;  4WF9 J;  3CCS H;  1USP B;  3CMA Z;  2QLV B;  2GTH A;  1N8R 1;  2QKD A;  4BBR I;  1O4U A;  5A2Q b;  3CCJ 1;  3VMI A;  2RHB A;  1YIT Z;  3IF8 A;  1PFT A;  2R92 I;  2RIQ A;  3OW2 Z;  1KQS H;  2I14 A;  2LEX A;  1VQL 1;  3CF5 J;  3CPW H;  4BY7 I;  3S2D I;  2VPW A;  3C2V A;  3CCM H;  1FDO A;  1K9M 1;  1RO2 A;  3M3Y I;  1VQM Z;  1ZXI B;  3IFU A;  1W2B Z;  1ZB8 A;  4MRI A;  1VQN 1;  3HOZ I;  1KC8 2;  5A2Q f;  1VQ5 Z;  2LFU A;  2RT9 A;  2YAD A;  4BXX I;  1RM6 A;  4WFA J;  5IT9 b;  3G71 Z;  1VQ9 H;  3MZK B;  2O53 A;  1VQ4 Z;  1YI2 1;  3PO3 S;  4MD7 A;  1M1K J;  2NVT I;  2GTI A;  5MLC O;  1S7M A;  2OTJ 1;  4NH1 C;  3CC2 1;  3Q87 A;  1JJ2 H;  3NS1 C;  2J0F A;  1M1K 2;  3S1M I;  1RLY A;  4NBA A;  4A3L I;  3CME 1;  2I3C A;  1S72 1;  1JWH C;  3CCM 1;  3KIH A;  3I55 H;  1YJW 1;  4E2Y A;  2NAP A;  2OTL Z;  2TPT A;  4TNU A;  3CCE H;  4MH4 A;  2ZAE B;  2R6M A;  1Z03 A;  2DE5 A;  1YTE A;  1ZB9 A;  1V97 A;  3C2E A;  1YIJ Z;  1LQL A;  4HGZ A;  3CCL Z;  1N5X A;  3FC4 A;  3CCV H;  1QVF Z;  1YHQ Z;  4DK1 A;  3CCR 1;  1VQ7 Z;  4A93 I;  3S17 I;  3C2O A;  4U67 J;  5EY3 A;  2GU2 A;  2JA6 I;  3G4S H;  2P28 A;  4RVG A;  1VQM H;  3GTO I;  1W2B H;  1WII A;  4IOA J;  3H3V J;  2BJO A;  1NJI J;  2VUM I;  4EAD A;  2B63 I;  5JVG J;  3FAH A;  1QYP A;  3CCE 1;  4X46 A;  1K9M 2;  3CMA 1;  2PM9 A;  4MON A;  5T67 A;  3J81 b;  5CM2 M;  4NBH A;  3EER A;  2QRE B;  3AM9 A;  1YIT 1;  1YJ9 H;  4RV9 A;  4WFB J;  3CC7 H;  1FFU B;  2PA2 A;  1FMA E;  1QVG Z;  1N63 B;  1UOU A;  2NVY I;  3TDH B;  2JNY A;  4HGY A;  1WZN A;  1QPN A;  3CC4 Z;  1QPO A;  3GCF A;  3CQZ I;  2M6N A;  3HOW I;  3BII E;  3SR6 C;  1VQM 1;  1L1O C;  4EWC A;  3J81 f;  5IP7 I;  1VQ5 1;  2O4H A;  3S16 I;  3BG1 B;  5MPO C;  1WW9 A;  2JA8 I;  1VQ4 1;  1KD1 2;  3CCJ H;  1QVF H;  5D1P A;  1M1K 1;  4USA A;  1AA6 A;  2E3T A;  3AMZ A;  1VQ7 H;  1YJ9 1;  4E33 A;  4A3J I;  5LL6 f;  3NVZ C;  4US9 A;  4LHM A;  4QTU A;  3VMM A;  1FM0 E;  3NVY C;  2H85 A;  1AZY A;  2OOY B;  1Y1W I;  1K83 I;  2R93 I;  3CXC H;  3HOU I;  1VQN H;  2VF1 A;  3HKZ A;  3I56 Z;  1QPR A;  2QRD B;  4E2Z A;  3QWU A;  3G6E Z;  1K73 2;  2VUG A;  2IV2 X;  1N62 B;  3HOY I;  1YI2 H;  1YIJ 1;  1KQS Y;  4HH4 A;  4C7Z A;  5C4X I;  1R9T I;  3CPW Y;  3NVW C;  5T6B A;  2OTJ H;  3CC2 H;  3GTQ I;  1K8A J;  1N2F A;  1VQ8 H;  1VQ7 1;  2QRC B;  4E2W A;  5HUO A;  5DM6 J;  3NRZ C;  1VQP Z;  3CC4 H;  3CME H;  5FLM I;  1FIQ C;  4KWV A;  1S72 H;  1YJN H;  1FFV B;  4CL1 A;  3CCU Z;  1YJW H;  3GTL I;  1X1O A;  1WJ2 A;  1Q7Y J;  3CD6 Z;  3GTJ I;  1Q81 J;  2W3R B;  3NFZ A;  1TWG I;  1M90 J;  3MZL B;  2RPR A;  2QA4 Z;  1JJ2 Y;  5GAE N;  5GAD N;  2WK6 A;  3ETR C;  1YTD A;  4NFR A;  3CCR H;  2Q51 A;  2Q4Z A;  3D6W A;  4Y52 I;  5AYX A;  2QIE A;  1VQ8 1;  1BRW A;  3PAJ A;  5H1S O;  2QR1 B;  3S15 I;  3CC4 1;  1VQO Z;  2JIP A;  3B9J C;  1YJN 1;  1I3Q I;  1Z02 A;  5AN9 F;  5IT9 f;  4YEK A;  3KIF A;  2W03 A;  3I4M I;  1KD1 1;  1FO4 A;  1X3W A;  1RQF A;  3NDI A;  2VPX A;  2JA5 I;  3CMA H;  1JRO B;  1YIT H;  2OMD A;  1N61 B;  1QAP A;  4MD8 A;  3OW2 H;  3CCQ Z;  1SB3 A;  3VTN A;  1Y1V I;  4A3E I;  4E31 A;  3FQQ A;  4QTT A;  2YU9 I;  4I9A A;  4EAF A;  2NVX I;  3PO2 I;  1K73 1;  2W55 B;  5GAH N;  3C2F A;  3I56 1;  1VQ5 H;  3G71 H;  1Y69 K;  1USP A;  1ML8 A;  4NBD A;  4ZOH A;  1N8R J;  4A3C I;  1VQ4 H;  4NBG A;  1NJI 2;  4NBE A;  3S2H I;  1Y8C A;  4A3M I;  5D1O B;  1K8A 1;  2JUB A;  2E2I I;  2DSJ A;  2JIR A;  1VQ6 Z;  3S1N I;  3NH5 A;  3VB9 A;  1VQK Z;  2EGT A;  4E30 A;  4A3K I;  1VQP 1;  1Q16 A;  3CCU 1;  2OTL H;  2QEX Z;  4S1T A;  3CD6 1;  5HUP A;  1Q81 1;  2WP4 A;  1TWA I;  1Y1V S;  3HOV I;  1Q86 J;  3CCS Z;  3GTM I;  3IX0 A;  3G71 1;  2JBM A;  2QA4 1;  4A3F I;  1YIJ H;  3CCL H;  3GTP I;  1Q86 2;  1YHQ H;  2WK5 A;  3CCQ H;  1KQS Z;  3CPW Z;  3CXC Y;  1FDI A;  2V3V A;  1TWF I;  2JR6 A;  1VQO 1;  3PIO J;  2JMO A;  3I07 A;  2DE7 A;  3T4N B;  2OTL 1;  1TWC I;  2F4O A;  3LUS A;  2JIM A;  3P5J B;  4NBC A;  2OZK A;  4MXU A;  2P3Y A;  1VQ9 Z;  3H5Q A;  1N5W B;  3EUB 4;  3CCL 1;  1YHQ 1;  4NOZ A;  5C3E I;  2B7Q A;  1JJ2 Z;  1NP6 A;  3HOX I;  4A3I I;  5C44 I;  3CCQ 1;  3GTG I;  1DGJ A;  1WKI A;  2PMZ A;  3F3P C;  1QVG H;  4A3G I;  5C4J I;  2IZ3 A;  4DGL A;  1K8A 2;  1SIJ A;  3WO1 A;  3I55 Z;  1QXF A;  2OOX B;  5GAG N;  3FQM A;  3TQV A;  3RZO I;  1ZH1 A;  2V45 A;  2K5R A;  3CCE Z;  1NJI 1;  5AYY A;  2E9H A;  3PIP J;  4X6A I;  4Y7N I;  2Q5W E;  4NBB A;  3D9X A;  4IOC J;  1Q7Y 2;  4AYB A;  1YUA A;  1Q81 2;  5D1O A;  2ZJR J;  3CCV Z;  1M90 2;  2B7N A;  1RO0 A;  1VQ6 1;  4IO9 J;  1VLB A;  2NVQ I;  2HF1 A;  4DQY B;  1VQK 1;  2VPZ A;  3VMG A;  4WFN J;  3F3F C;  1KC8 J;  3G4S Z;  5IP9 I;  3MON A;  2E7Z A;  1SIW A;  4A3D I;  2HU9 A;  2QEX 1;  4GA4 A;  3I56 H;  4NBF A;  1NVI E;  5EP8 A;  1Q82 J;  3G6E H;  1Q86 1;  3CCS 1;  1I50 I;  3BG0 B;  3NH8 A;  4AP8 A;  1QF8 A;  1TWH I;  3OW2 Y;  1Q82 2;  3NH4 A;  3GKQ A;  3AN1 A;  1YJ9 Z;  4NB8 A;  2IZ4 A;  3J7A 4;  4WCE J;  3CC7 Z;  3VMH A;  4KWW A;  1VQP H;  1W2B Y;  3D2L A;  2V8K A;  3FKI I;  2B7P A;  4MD9 A;  1YTK A;  3CCU H;  5FLX b;  2JS4 A;  4XR5 A;  3GTK I;  5JVH J;  3CD6 H;  1I6H I;  3RZD I;  3J80 b;  3J7Z M;  3G6E 1;  1VQ9 1;  2QA4 H;  2JA7 I;  2WAQ A;  3S1Q I;  3EED A;  3CCJ Z;  2ZJQ J;  4YYY A;  2AKL A;  2KI7 B;  1WYG A;  3H0G I;  2F4M A;  3ESW A;  2R7Z I;  1N8R 2;  1NVJ A;  3NVV C;  1TFI A;  3IR7 A;  4RS4 A;  1VQL Z;  5FLX f;  2I1O A;  4RVH A;  1X3Z A;  1VQO H;  2ZJP J;  3TE5 B;  2JIO A;  2V8I A;  3J80 f;  3I55 1;  1K9M J;  2G2K A;  3CXC Z;  5AYZ A;  1Q7Y 1;  4BY1 I;  1VQN Z;  2JIQ A;  4NB9 A;  1VDV A;  5DM7 J;  2RBL A;  1Z01 A;  1QVF Y;  4GA6 A;  2KPI A;  1M90 1;  3WNZ A;  2DE6 A;  4GA5 A;  1YI2 Z;  4XX2 A;  3CCV 1;  2E2J I;  4RVF A;  2OTJ Z;  4BBS I;  3JAM b;  5HL7 J;  3CC2 Z;  3L4P A;  1VQ8 Z;  4UY8 M;  3WO0 A;  3U50 C;  1N60 B;  1OTP A;  3GNN A;  3I4N I;  1VLA A;  2W3S B;  5T64 A;  3CME Z;  2WB1 A;  1KC8 1;  3NDJ A;  3G4S 1;  1S72 Z;  1RNI A;  3M4O I;  1KRL A;  1X0T A;  3CCM Z;  1YJN Z;  1JRP B;  1YJW Z;  1QPQ A;  3L0G A;  1YUK A;  4A3B I;  3S14 I;  2AYD A;  1KD1 J;  3K7A I;  4E32 A;  1Q82 1;  2PK7 A;  1SFO I;  1WCM I;  1NUI A;  4E2X A;  3JAM f;  2K3R A;  1P9N A;  3CCR Z;  2Y0S A;  1QVG Y;  3RPF A;  1VQL H;  3CC7 1;  4C7Y A;  3C2R A;  1VQ6 H;  2LIY A;  2J6A A;  1DL6 A;  2M48 A;  1VQK H;  5HUL A;  3GTM S;  1RO4 A;  3PO3 I; 
#chains in the Genus database with same CATH homology
 1K73 J;  3DLL J;  2W04 A;  2QEX H;  2V8J A;  4RVD A;  2E2H I;  3S1R I;  4WF9 J;  3CCS H;  1USP B;  3CMA Z;  2QLV B;  2GTH A;  1N8R 1;  2QKD A;  4BBR I;  5A2Q b;  3CCJ 1;  3VMI A;  2RHB A;  1YIT Z;  3IF8 A;  1PFT A;  2R92 I;  2RIQ A;  3OW2 Z;  1KQS H;  1VQL 1;  3CF5 J;  3CPW H;  4BY7 I;  3S2D I;  3CCM H;  1K9M 1;  1RO2 A;  3M3Y I;  1VQM Z;  3IFU A;  1W2B Z;  1ZB8 A;  4MRI A;  1VQN 1;  3HOZ I;  1KC8 2;  5A2Q f;  1VQ5 Z;  2LFU A;  2RT9 A;  2YAD A;  4BXX I;  4WFA J;  5IT9 b;  3G71 Z;  1VQ9 H;  3MZK B;  2O53 A;  1VQ4 Z;  1YI2 1;  3PO3 S;  4MD7 A;  1M1K J;  2NVT I;  2GTI A;  5MLC O;  1S7M A;  2OTJ 1;  4NH1 C;  3CC2 1;  3Q87 A;  1JJ2 H;  1M1K 2;  3S1M I;  1RLY A;  4NBA A;  4A3L I;  3CME 1;  2I3C A;  1S72 1;  1JWH C;  3CCM 1;  3KIH A;  3I55 H;  1YJW 1;  4E2Y A;  2OTL Z;  4TNU A;  3CCE H;  4MH4 A;  2ZAE B;  2R6M A;  1Z03 A;  2DE5 A;  1ZB9 A;  1YIJ Z;  1LQL A;  4HGZ A;  3CCL Z;  3CCV H;  1QVF Z;  1YHQ Z;  4DK1 A;  3CCR 1;  1VQ7 Z;  4A93 I;  3S17 I;  4U67 J;  2GU2 A;  2JA6 I;  3G4S H;  2P28 A;  4RVG A;  1VQM H;  3GTO I;  1W2B H;  1WII A;  4IOA J;  3H3V J;  2BJO A;  1NJI J;  2VUM I;  2B63 I;  5JVG J;  1QYP A;  3CCE 1;  1K9M 2;  3CMA 1;  2PM9 A;  4MON A;  5T67 A;  3J81 b;  5CM2 M;  4NBH A;  3EER A;  2QRE B;  1YIT 1;  1YJ9 H;  4RV9 A;  4WFB J;  3CC7 H;  2PA2 A;  1QVG Z;  2NVY I;  3TDH B;  2JNY A;  4HGY A;  3CC4 Z;  3GCF A;  3CQZ I;  2M6N A;  3HOW I;  1VQM 1;  1L1O C;  4EWC A;  3J81 f;  5IP7 I;  1VQ5 1;  2O4H A;  3S16 I;  3BG1 B;  1WW9 A;  2JA8 I;  1VQ4 1;  1KD1 2;  3CCJ H;  1QVF H;  5D1P A;  1M1K 1;  1VQ7 H;  1YJ9 1;  4E33 A;  4A3J I;  5LL6 f;  4QTU A;  2H85 A;  2OOY B;  1Y1W I;  1K83 I;  2R93 I;  3CXC H;  3HOU I;  1VQN H;  2VF1 A;  3HKZ A;  3I56 Z;  2QRD B;  4E2Z A;  3QWU A;  3G6E Z;  1K73 2;  2VUG A;  3HOY I;  1YI2 H;  1YIJ 1;  1KQS Y;  4HH4 A;  5C4X I;  1R9T I;  3CPW Y;  2OTJ H;  5T6B A;  3CC2 H;  3GTQ I;  1K8A J;  1N2F A;  1VQ8 H;  1VQ7 1;  2QRC B;  4E2W A;  5DM6 J;  1VQP Z;  3CC4 H;  3CME H;  5FLM I;  1S72 H;  1YJN H;  4CL1 A;  3CCU Z;  1YJW H;  3GTL I;  1Q7Y J;  3CD6 Z;  3GTJ I;  1Q81 J;  3NFZ A;  1TWG I;  1M90 J;  3MZL B;  2RPR A;  2QA4 Z;  1JJ2 Y;  5GAE N;  5GAD N;  4NFR A;  3CCR H;  2Q51 A;  2Q4Z A;  3D6W A;  4Y52 I;  1VQ8 1;  5H1S O;  2QR1 B;  3S15 I;  3CC4 1;  1VQO Z;  1YJN 1;  1I3Q I;  1Z02 A;  5AN9 F;  5IT9 f;  3KIF A;  2W03 A;  3I4M I;  1KD1 1;  1X3W A;  1RQF A;  3NDI A;  2JA5 I;  3CMA H;  1YIT H;  3OW2 H;  4MD8 A;  3CCQ Z;  3VTN A;  1Y1V I;  4A3E I;  4E31 A;  3FQQ A;  4QTT A;  2YU9 I;  2NVX I;  3PO2 I;  1K73 1;  5GAH N;  3I56 1;  1VQ5 H;  3G71 H;  1Y69 K;  1USP A;  1ML8 A;  4NBD A;  1N8R J;  4A3C I;  1VQ4 H;  4NBG A;  1NJI 2;  4NBE A;  3S2H I;  4A3M I;  5D1O B;  1K8A 1;  2JUB A;  2E2I I;  1VQ6 Z;  3S1N I;  3NH5 A;  3VB9 A;  1VQK Z;  2EGT A;  4E30 A;  4A3K I;  1VQP 1;  3CCU 1;  2OTL H;  2QEX Z;  4S1T A;  3CD6 1;  1Q81 1;  1TWA I;  1Y1V S;  3HOV I;  1Q86 J;  3CCS Z;  3GTM I;  3IX0 A;  3G71 1;  2QA4 1;  4A3F I;  1YIJ H;  3CCL H;  3GTP I;  1Q86 2;  1YHQ H;  3CCQ H;  1KQS Z;  3CPW Z;  3CXC Y;  2JR6 A;  1TWF I;  1VQO 1;  3PIO J;  2JMO A;  3I07 A;  2DE7 A;  3T4N B;  2OTL 1;  1TWC I;  2F4O A;  3LUS A;  3P5J B;  2OZK A;  4NBC A;  4MXU A;  2P3Y A;  1VQ9 Z;  3CCL 1;  1YHQ 1;  4NOZ A;  5C3E I;  1JJ2 Z;  1NP6 A;  3HOX I;  4A3I I;  5C44 I;  3CCQ 1;  3GTG I;  1WKI A;  2PMZ A;  3F3P C;  1QVG H;  4A3G I;  5C4J I;  2IZ3 A;  4DGL A;  1K8A 2;  3I55 Z;  2OOX B;  5GAG N;  3FQM A;  3RZO I;  1ZH1 A;  2K5R A;  3CCE Z;  1NJI 1;  3PIP J;  2E9H A;  4X6A I;  4Y7N I;  4NBB A;  3D9X A;  4IOC J;  1Q7Y 2;  4AYB A;  1YUA A;  1Q81 2;  5D1O A;  2ZJR J;  3CCV Z;  1M90 2;  1RO0 A;  1VQ6 1;  4IO9 J;  2NVQ I;  2HF1 A;  4DQY B;  1VQK 1;  3VMG A;  4WFN J;  3F3F C;  1KC8 J;  3G4S Z;  5IP9 I;  3MON A;  4A3D I;  2HU9 A;  2QEX 1;  3I56 H;  4NBF A;  1Q82 J;  3G6E H;  1Q86 1;  3CCS 1;  1I50 I;  3BG0 B;  3NH8 A;  1QF8 A;  1TWH I;  3OW2 Y;  1Q82 2;  3NH4 A;  3GKQ A;  1YJ9 Z;  4NB8 A;  2IZ4 A;  3J7A 4;  4WCE J;  3CC7 Z;  3VMH A;  1VQP H;  1W2B Y;  2V8K A;  3FKI I;  4MD9 A;  3CCU H;  5FLX b;  2JS4 A;  3GTK I;  5JVH J;  3CD6 H;  1I6H I;  3RZD I;  3J80 b;  3J7Z M;  3G6E 1;  1VQ9 1;  2QA4 H;  2JA7 I;  2WAQ A;  3S1Q I;  3EED A;  3CCJ Z;  2ZJQ J;  2AKL A;  2KI7 B;  3H0G I;  2F4M A;  3ESW A;  2R7Z I;  1N8R 2;  1TFI A;  4RS4 A;  1VQL Z;  5FLX f;  4RVH A;  1X3Z A;  1VQO H;  2ZJP J;  3TE5 B;  2V8I A;  3J80 f;  3I55 1;  1K9M J;  2G2K A;  3CXC Z;  1Q7Y 1;  4BY1 I;  1VQN Z;  4NB9 A;  5DM7 J;  2RBL A;  1Z01 A;  1QVF Y;  2KPI A;  1M90 1;  2DE6 A;  1YI2 Z;  4XX2 A;  3CCV 1;  2E2J I;  4RVF A;  2OTJ Z;  4BBS I;  3JAM b;  5HL7 J;  3CC2 Z;  1VQ8 Z;  4UY8 M;  3U50 C;  3I4N I;  1VLA A;  5T64 A;  3CME Z;  2WB1 A;  1KC8 1;  3NDJ A;  3G4S 1;  1S72 Z;  1RNI A;  3M4O I;  1KRL A;  1X0T A;  3CCM Z;  1YJN Z;  1YJW Z;  1YUK A;  4A3B I;  3S14 I;  1KD1 J;  3K7A I;  4E32 A;  1Q82 1;  2PK7 A;  1SFO I;  1WCM I;  1NUI A;  4E2X A;  3JAM f;  2K3R A;  1P9N A;  3CCR Z;  2Y0S A;  1QVG Y;  1VQL H;  3CC7 1;  1VQ6 H;  2LIY A;  2J6A A;  1DL6 A;  2M48 A;  1VQK H;  3GTM S;  1RO4 A;  3PO3 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...