3VMMA

Crystal structure of bacd, an l-amino acid dipeptide ligase from bacillus subtilis
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
471
structure length
471
Chain Sequence
ERKTVLVIADLGGCPPHMFYKSAAEKYNLVSFIPRPFAITASHAALIEKYSVAVIKDKDYFKSLADFEHPDSIYWAHEDHNKPEEEVVEQIVKVAEMFGADAITTNNELFIAPMAKACERLGLRGAGVQAAENARDKNKMRDAFNKAGVKSIKNKRVTTLEDFRAALEEIGTPLILKPTYLASSIGVTLITDTETAEDEFNRVNDYLKSINVPKAVTFEAPFIAEEFLQGEYGDWYQTEGYSDYISIEGIMADGEYFPIAIHDKTPQIGFTETSHITPSILDEEAKKKIVEAAKKANEGLGLQNCATHTEIKLMKNREPGLIESAARFAGWNMIPNIKKVFGLDMAQLLLDVLCFGKDADLPDGLLDQEPYYVADCHLYPQHFKQNGQIPETAEDLVIEAIDIPDGLLKGDTEIVSFSAAAPGTSVDLTLFEAFNSIAAFELKGSNSQDVAESIRQIQQHAKLTAKYVLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and enzymatic characterization of BacD, an l-amino acid dipeptide ligase from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Ligase
molecule keywords Alanine-anticapsin ligase BacD
total genus 140
structure length 471
sequence length 471
ec nomenclature ec 6.3.2.49: L-alanine--L-anticapsin ligase.
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13535 ATP-grasp_4 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3vmmA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3vmmA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3vmmA01
3.90.1170.60 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Aldehyde Oxidoreductase; domain 3 3vmmA04
3RFCA 2P0AA 4DLKA 4FGRA 1A9XA 1CQJB 1EUCB 1Z2OX 5CB4F 4XZ3B 2W6QA 4I4TF 4O4JF 3G8CA 5JQWA 4FE2A 1DV1A 5JVDF 1GSAA 4ZOLF 4M9UA 3ORRA 2YRWA 2YS7A 1KJJA 1DIKA 3DF7A 4O82A 4YJ3F 4FU0A 4IHJF 1Z2PX 3K3PA 4C5BA 3OUZA 1AUVA 3KAKA 3VPDA 2IP4A 5HBRB 4ME6A 1GSOA 4WBNF 3LWBA 4IWYA 5FNVF 1I7NA 3E5NA 1CQIB 3K5IA 4TV9F 4I55F 2XCLA 4FFOA 5LXTF 2HGSA 5C1OA 4O7YA 2VQDA 1KJQA 4ZI7F 4O84A 4XX0B 2R7NA 2W70A 2GLTA 2YZGA 1A48A 3BSYA 4MA0A 3HB9A 5BPHA 1GGOA 5LOVF 4O4HF 4M99A 4TV8F 2ZDQA 2CNUA 4FFMA 2X0SA 4MV3A 2W6OA 2DWCA 2VHEA 2I80A 3BG5A 3N6RA 2R85A 3U54A 4FFRA 5LP6F 1KEEA 2GPWA 1WR2A 1EYZA 1M6VA 4HQ6A 3KALA 4ZQIA 3V4ZA 2J9GA 1JDBB 2YYAA 2W6MA 4ZHQF 3Q1KA 4MV6A 5D8DA 1KBLA 3BSWA 2YWVA 4O7TA 1EUDB 2WYOA 5DMXA 2W6NA 4I50F 3Q2OA 4O7NA 4IZOA 3QFFA 3SE7A 3R9RA 2HJWA 5J2UF 4O7LA 3U9SA 4O2BF 4O7SA 4YB8B 4HNUA 4MAMA 2GQRA 3G8DA 3AW8A 3ETJA 2NU8B 1KJ9A 3I12A 3JRXA 3R5HA 4EAAA 1T36A 2NU9B 1GSHA 2C00A 4EGJA 3TQTA 2R84A 1KUTA 4MV1A 2CNVA 3LP8A 3MJFA 2YZNA 1VBGA 1PX2A 4M9CA 2CNQA 3V4SA 2PVPA 1OBGA 3NUAA 2W71A 5GONF 2NU7B 3R23A 1W96A 4L1KA 1M0TA 5JVLA 2SCUB 2V59A 2FPIB 2V5AA 5JH7F 1CE8A 1B6SA 5EZYF 4XYLB 4YAJB 1AUXA 2PN1A 4FFNA 1KJIA 4MV7A 5BPFA 2DIKA 2ZDHA 3TW6A 4WD3A 4YBZB 2QK4A 3R5FA 3BFPA 4HNVA 5BMVF 2I8CA 1M0WA 3VPCA 4Y8VB 1OBDA 1KJ8A 4MA5A 4NYEA 1JDEA 3KREA 2FP4B 3RV3A 1I7LA 4YAKB 1Z2NX 2I87A 1UC9A 3JZFA 4IWXA 2R82A 3HBLA 1E4EB 1EHIA 1DV2A 1SCUB 1BNCA 5KKNB 4RZQA 2GPSA 4TUYF 3GIDA 3WNZA 3OUUA 1C3OA 2R7MA 3BSSA 3VMMA 1C30A 4O4LF 4C5AA 4EGQA 3WO1A 3KAJA 2ZDGA 4EA8A 4MV4A 4HR7A 5CAEB 3AX6A 4EA9A 3N8DA 5J2TF 5HV6A 3MWDA 2NU6B 2YZMA 3K5HA 3JZIA 2QF7A 3R5XA 4FFPA 2YZLA 1BXRA 4M98A 2R6FA 4XYMB 3VPBA 3ETHA 3HO8A 3RV4A 5LA6F 2NUAB 4O4IF 1CS0A 3RUPA 2W6PA 3MWEA 5C1PA 4HNTA 1KC7A 4C5CA 3VOTA 4QSHA 5LYJF 2PBZA 4DIMA 4E4TA 4O7VA 1VKZA 2FPPB 4MV9A 3U9TA 5CA0F 2CQYA 2VR1A 4EABA 5IYZF 2YS6A 1ULZA 2GQSA 2CZGA 4GGMX 4O83A 2YW2A 3UFXB 2OLSA 2DLNA 2VPQA 2YL2A 1JKJB 2R86A 4O7RA 1JLLB 2Z04A 2YRXA 1VBHA 1GLVA 2DZDA 5CA1F 2R7LA 2FB9A 2XD4A 2R7KA 2Z02A 5H80A 4IIJF 4O2AF 1W93A 4EG0A 1IOVA 5I47A 4EA7A 3GLKA 3JRWA 4FFLA 2W6ZA 3TIIA 4O7ZA 3WO0A 5C8YF 2NPOA 1E4EA 2V58A 2R87A 1UC8A 1EZ1A 4O86A 5K2MA 4O81A 5JQGF 1B6RA 3U55A 2FPGB 1IOWA 3ORQA 5KX5F 4MV8A 3VA7A 4J6EA 3TIGA 4O7WA 3TINA 4YJ2F 1PK8A
chains in the Genus database with same CATH superfamily
3JALA 3PR5B 1UBCA 4LGCA 5REQA 3K3VA 1JG6A 4ABYA 621PA 5CNKA 5AM3A 2JLWA 5A03A 4XD2A 2OHXA 1G7RA 1R0XA 2JEJA 4Q3EA 2RK6A 5G0WA 4CQLB 4DT1B 1MX5A 4IRMA 5EFOA 5IMSA 1ZXBA 2F3PA 4ZRNA 2EIXA 3OH8A 1Q1QA 4MW2A 3W2HA 4LG1A 1VL5A 3GCWA 4R16A 3G2PA 2VN8A 5K3FA 1GNLA 4YEDA 2J30A 1ECJA 4M37A 4I4TF 2XUQA 3C3WA 3EFOA 3DH0A 5IYBG 1MC5A 2UVDA 1O94A 2IYPA 2ZJBA 2JD0A 3K1AA 4NZ9A 1I4DD 1ISFA 4C0JA 1XCPA 2BJVA 2BR0A 4U5QA 4E1BA 1KYWA 2BJWA 2IJGX 3RRFA 1XJ0A 3S1SA 2ZTLA 1DLIA 1ISHA 1VPDA 4JL6A 3SXUB 4E15A 2PJRA 1EA7A 2KMLA 3K9HA 5K3OA 5KWEA 4YHHH 4KNYA 4E5UA 1KJJA 5JYDA 3OKFA 3NJ4A 4MV0A 3EW7A 3LLUA 1S2NA 1W2WB 4WSOA 4YJHB 1DAFA 2XUGA 1ISGA 2W3SB 4B46A 5FOVA 2SCUA 5KG5A 4X24A 1BMFD 3PX3A 4PPYA 4RZUA 4Y18A 1CB0A 5IWAH 1A4RA 2YC2C 1T3GA 5ILOA 3PQ2A 3QK7A 2QPLA 1BE6A 4TTPA 4KBYA 4J9MA 2IY8A 3IEUA 1W46A 3QPBA 1OTXA 1MNAA 1VB3A 3VR6D 1Q16A 3W34A 1N2GA 3WBBA 1F20A 1WUYA 4BCBA 2XQJA 2FQQA 3LXUX 3O4VA 2X8JB 5DBEX 4CM3A 5IT9A 4WBNF 4ZD6A 3FCXA 3KYIB 3N2ZB 4ZEWA 3BZWA 4IX9A 1DDIA 3OWHA 3QW4B 3O8OA 4CDNA 5CLIA 2R1TA 3A4IA 1GR1A 1WF3A 2IX9A 2XBLA 1A5BB 4ZAVA 5KFNA 4CV0A 1EZZA 4JYMA 4KIGA 3DTFA 4IIEA 4NU5A 1DAMA 1KQ3A 2RGVA 1IUOA 1OYOA 2CNLA 1C0KA 1W0CA 2GJ9A 3NHZA 4MQEB 3WBKA 4FFOA 5EIFA 1S72H 1MT0A 1FVXA 3DT9A 5BR7A 4ASUD 4H18A 1O6GA 4R69A 2IW3A 1HE1C 3FPFA 4HPXB 4ENRA 1Q3HA 2FWRA 3P97A 5EQFA 3V1UA 1RD4A 2F4VB 1Q12A 1Z25A 1OWTA 4XDYA 4B2YA 4ZCMA 2O5RA 4YLYA 1HQYE 3T99A 3BSYA 3D4PA 2GKSA 2AEFA 1XNGA 1Q3TA 4JLDA 2C28A 4F1JA 4CE5A 4ICIA 4QUBA 2FR8A 1KU0A 2W90A 3EIXA 5TF0A 3PENA 2VQ3A 4XWWA 5B36A 3SGIA 1SPXA 2Q0SA 3S3TA 3R41A 3BB1A 3UVEA 4IRUB 1CDEA 2FWJA 4QULA 1PZEA 4ZYLA 2J6HA 3B36A 3JQGB 3U4CA 5BWCA 1CUJA 3UYLA 3E7WA 3DP9A 1YBAA 3AB7A 3H0CA 2AD5A 2G25A 4LOAA 3TLJA 3W78A 2LNDA 4FNMA 2IZ0A 3HUTA 4FCWA 1E7SA 5JRZA 1SJ9A 3T3GA 2W6OA 1J4AA 3EGDA 1RMYA 2JA6A 5DBGA 4LOLA 2C2KA 3KSBC 3PKJA 1TWGA 3S2EA 1IXYA 2X6RA 4TWJA 2I80A 3CEBA 1XKXA 2VTEA 3N6RA 4WKGA 5DP2A 4II2A 2ZZMA 4Q4AA 1Z0FA 4WHXA 2C84A 3OCCA 3DDOA 3PPXA 3VNNA 1RZRD 3ZWNA 3QGMA 2IV2X 3RABA 3PR1A 3HZHA 2BEJA 3DE0X 1PTJA 3DDUA 5KPDA 1OAAA 1SC1A 1Z3IX 3DCJA 5T5QA 3T4UA 1PDWA 5D00A 3KLOA 4R7GA 4LJ5A 4EVRA 7ADHA 2VBCA 4IZHA 3VAAA 1ZJWA 2QGFA 4IIJA 2RHWA 3ZJUA 4DA8A 1L8XA 5JCJD 3CA8A 2JIPA 2QG4A 4JFRA 4LXHA 4TVKA 5FQNA 5K5EA 1UOUA 5CFLA 1XT6A 2XXAB 1QPBA 1SUSA 2FMIA 2IUTA 2PRSA 1DAKA 3B6MA 1TJYA 1CKMA 3KKLA 3MJ4A 4Q4HB 5EKSA 4F4CA 1JEEA 1E5XA 3FYHA 3LUDA 5L3SB 1V7ZA 1RPAA 1COWD 4KACA 2OO3A 3I55H 1DIAA 2QRNA 4PO1A 1SFRA 4EDHA 4KSYA 5AUNB 3DLIA 2ODBA 1FJGB 4KHPH 1LDMA 3CZ4A 5CR9A 4EG4A 2WD8A 3MFQA 3NM6B 5KVVA 3BRSA 3PJEA 1IHXA 1QK5A 2A7XA 2CZCA 3DAPA 2HUPA 1N6KA 4FFBA 4RQAA 5DSTA 1P7WA 5IF3A 5EOYA 3A28A 4UHDA 1MDBA 1O6CA 4KIJA 4XR4A 4E2ZA 2WYOA 1PJRA 2H7XA 4NAUA 5KIAA 2ZUFA 4CDGA 5ADUS 3A9VA 5FV4A 4DHEA 3AWDA 3H75A 1HTTA 1C1XB 1G8AA 1U1IA 1XEFA 2ZUVA 3EIFA 3N2YA 4N7RA 4XGIA 3WQQA 4DIUA 4NXMB 4O7NA 1R6VA 4QT0A 1XTBA 4IEIA 3AGPA 3HLKA 4JMLA 4BCDA 2M6SA 5K1ZA 1BDJA 2AFIE 4R2IA 4LVOA 1TYCA 1YSCA 1Z83A 2JLAA 3X44A 1MC8A 1PYOA 4G1FA 3QPDA 3ICQB 3ESXA 2IOQA 4OLBA 3QLUA 3VI3B 3VTKA 1YQXA 2AGPA 3QBVA 2DFKB 4DDVA 1G5TA 3ZE0B 4H4CA 2P9FA 1DO0A 3UAZA 3KWFA 4R1LA 2NXJA 4RTKA 4MTDA 1ZNYA 2SKDA 4HRVA 1M9NA 1WB5A 2LDXA 2AN5A 3AF2A 2R5NA 1BS2A 4FDMA 4HH0A 3HVUA 3JR3A 3LDFA 2OBMA 4EUSA 4FC6A 1E32A 1E4GT 4IO0A 2OBBA 2QW8A 3P27A 2NV2B 2QX6A 4G5XA 4KQ6A 3GAAA 2EFDB 2FLWA 3DLAA 3GJ5A 4HNUA 3Q8WA 4H6XA 4HLNA 2GZAA 1I3CA 4N5IX 2VDOB 2JAWA 3WS7A 2X0RA 3ET4A 2REBA 2X23A 4LTMA 6REQA 5KVSA 1KI4A 4PPFA 1WKIA 1CY1A 5CVDA 2ZRHA 1SQ5A 2FSPA 1E18A 1XK6A 5HKOA 1X7YA 2I03A 3N2IA 1DTSA 3PO3G 4P31A 5LSAA 1RLJA 4LMYA 2FN7A 1NM5A 3SSAA 1UBKS 5ITSA 1Y1KE 2DYKA 1S01A 3MJFA 3FXAA 4XB6B 3E9CA 4ZT6A 3CXUA 1GZDA 4FBGA 4MUNA 4X3OA 5E0OA 3UT5B 4D6XA 1JW9B 2IHNA 2O8EA 2CNQA 4A3BG 2VTDA 3IBCA 1LJUA 1N5DA 4NS4A 1NMEA 3TX2A 2P65A 4CL0A 4CN8A 4EJSC 2DPLA 2Z2JA 1WCMG 3PVZA 4G56A 2BGTA 1FDOA 3R74A 3VAYA 1JVSA 2JZCA 2XDWA 3DZJA 5AM1A 3ZGVA 3I0NA 2B94A 3RAPR 4F12A 1Y6FA 4G09A 2NNLD 5IJAA 3OM9A 3VR0A 4FYMA 5EJGA 2R97A 4FW9A 2EZ9A 3FGNA 3Q7EA 4GZLA 4H9GA 3RU2A 3FMAA 2AT1A 1EKPA 4IY1A 5FPKA 2DR0A 5EEHA 1TC1A 3VR4D 2FUG6 1CS4C 2PVSA 3CX3A 1X7XA 1YVUA 5F98A 5MPOC 2P1DA 3WWYA 2G9ZA 2ZBGA 4HLDA 2Q7OE 5FORA 3MQ2A 2GZDA 2GNAA 4YWJA 1ORHA 2B2CA 1MV5A 5CG1A 1DRWA 1QAOA 1GGHA 3EZFA 3EHEA 4PGHA 5DBHX 4B3DA 2OGSA 5KMGA 1IC6A 2VUIB 2AHOA 3KPUA 2WE8A 1CZUA 4RD0A 3PUIA 4OQXA 1AIPA 3LRXA 4QARA 2DIKA 5BSFA 2X1LA 4I9AA 3R3WA 4PZ0A 2PXXA 3M1YA 1A72A 3GIIA 1PZFA 5DTMA 3ZXSA 3LGAA 3T4EA 2XTNA 3W2GA 4MARA 4TGLA 4W9NA 2AFHB 2ZSBA 3A0RB 3NWBA 3PC6A 3T52A 2ZCUA 1HZZC 1U4NA 3TXAA 1BCSB 1JLLA 4F2GA 3P5BA 2R4QA 5G0SA 4KGXA 2XUAA 4UTRA 4P0PB 1JPVA 4XIFA 3LUHA 1LQUA 1DOAA 1QLHA 2GX6A 2VH2A 3G0IA 2FZKA 3OIWA 4GYKA 1PVDA 4P86A 5GADl 1FUUA 3OSZA 5JLAA 4CMFA 1FUYB 1SY7A 2YXPX 5BWRA 4PVDA 4RGYA 5A0VA 4KNWA 1Z34A 2AFHE 2GB4A 1EPUA 1F6BA 2R6R1 4FHGA 1GZ7A 1T4DA 3WIOA 4JXZA 3A3KA 5LZ9A 1JDEA 2G9UA 2K7ZA 4RKYA 3UV6A 2RONA 3ZJVA 5IBCA 4LISA 4U6NA 1FNNA 1A9SA 2Q50A 1NL3A 3NS7A 4Y1GA 4YFYA 1E1YA 2QUKA 2MHCA 3I9NA 3SQXA 4LWPA 4ZOQI 3THXA 3OU2A 4RAYA 4EFMA 1E7WA 2WWYA 2FX2A 4G0UA 3C2OA 4EJSA 4ND6A 3KUDA 3RG8A 3JQAD 1I80A 1NOJA 4S1WA 3T1HH 1XHFA 2RCNA 1V4BA 5KKNB 1N8NA 1TX4B 5HRUA 3IBYA 5TQ2A 3WNDA 1O4VA 3SMVA 1IY9A 4C30A 5EWMA 1S0OA 3OAAA 4U7CA 2X0KA 1I2MA 3U13A 1E3LA 3O1JC 1WEHA 4LHWA 3GEMA 4C4SA 4G23A 2ZLBA 2JKVA 3S2YA 2X0EA 2YOGA 2H3EA 2B8WA 2HK7A 3MB8A 3Q0TA 5TPWA 1USUA 4LV8B 3CUYA 3GFPA 3ZUGA 5JJCA 3C6QA 1HDRA 4LYAA 5KWJA 3WHLA 2EQBA 4H60A 2D8AA 2OHGA 4NYIR 4PHFA 4CMBA 3WLMA 2QL9A 4ZJUA 4LF8H 4K40A 1XN1A 2QRMA 3KOWA 5AP9A 2WYIA 4KQCA 2JIDA 5DDIP 3PWZA 2ICAA 1O2DA 2IXFA 1UAAA 1QYDA 2B21A 5LA6B 2Q1YA 5HV6A 1GWNA 3MWDA 3SKVA 2J5KA 3WLHA 4HCJA 4OYYA 2C4MA 5CIYA 2AXNA 1L4UA 3COSA 3OD5A 3LLMA 1THMA 2B36A 1ZXXA 4K0KH 2C2XA 4P35A 4WUVA 4MR8A 4YP7A 3SN6A 3P71T 3CX7A 4IDFA 4YCBA 1NSYA 4QOHA 3PE4A 4HXGA 2DRIA 4MV5A 4KTVE 4LY0A 4XYMB 4OXRA 5H68A 2H2DA 2YFHA 2NO6A 1N4DA 2DTEA 3NOXA 4KXQA 1YJCA 5IMBA 5TC4A 3WLOA 1WVMA 4AG3A 2YN0A 1GRVA 5ALOA 5I9NA 3PV0A 2WKWA 2GEKA 5KFHA 3ROTA 4M0KA 4NZOA 1A71A 4ZXPA 4BNDA 2AF4C 2QAGC 3ZKWB 4LVCA 3GTQA 4YX9A 3UJNA 2Q4RA 3C0FB 3TBHA 1VM6A 2C78A 3G82C 1R1DA 2W2MA 4S1NA 5FTJA 5JD4A 1V1MA 4MGHA 3L79A 3QVTA 4KDFA 3ROXA 1H9AA 2WFMA 3CF0A 1ZN7A 1KDRA 2UU9H 1ZPDA 4QIHA 4O3QA 4I3HA 3X2SA 1Q86J 2XODA 5GONB 1XKQA 1A95A 5IBPA 3PL5A 1H94A 4L8GA 3EPIA 1WLYA 1Y33E 1HEUA 1ZNXA 2CVPA 2VA9A 3QWAA 1SVSA 3B78A 3F49S 3K8OE 2IZOA 1ZRHA 4FMPA 4TN1A 4EMTA 2VDMB 4ZI3A 2NAFA 4GEKA 2E3TA 3DVAB 1U7OA 3OKCA 3GUUA 4R51A 3U3KA 1H1DA 1GDHA 1UXGA 2DQZA 2J09A 2FSSA 4E31A 1KDOA 1YVEI 4K9OA 3MPOA 5IKPA 4AUNA 1PZNA 1J9GA 2PMFA 2B98A 2UXBB 1YXMA 4D3YA 3GRKA 2VPSA 3ZTYA 4J9OA 1EE1A 1P18A 1YA4A 4RVGA 2YX1A 2XZPA 4KPGA 3KSUA 3T7DA 2YS6A 3A31A 1I13A 4OSOA 1A7JA 2W8BA 2GQSA 3L5OA 3KWJA 3LCRA 3EA0A 4TN5A 2PUEA 1ZC4A 3KU4A 5ALLA 2ZM6B 3KEFA 3L0ZA 5JEEA 1H2EA 1OZAA 2E82A 2AZMA 5B3JC 3SU8A 5BNTA 2OP1A 1BVRA 1WDTA 3VOSA 5KFMA 1QVAA 1ZGGA 2HRZA 2R66A 3HKCA 5LQRA 2PX6A 2PL5A 2DZDA 2PJDA 3DOIA 2O8DA 4MNTA 4LFCH 1HQDA 1LRKA 1WBDA 3AUUA 4CQMA 1U0NA 3H84A 1OR8A 3HYRA 5KQSA 4QJFA 2XCRB 3M81A 4M86A 4ZVSA 4A73A 2W9BA 4Q0YA 4EFKA 5LQKA 1YB1A 2FK3A 4C08A 3OJEA 1P2UA 2AC7A 1UIRA 4FGJA 3ZH9B 2L69A 1KFCB 1K27A 2ZAYA 2FE1A 1S1CA 3B3AA 2YIJA 4HDAA 3FHTA 3QF4B 4UVGA 1XK7A 3THWA 4C2MA 1XDZA 4Y3UA 2JJ2D 3EEYA 4M89A 1Y63A 2WV9A 4XR9A 1YS1X 1KSGA 3GDOA 3EDQA 2XGQA 1Z4IA 3OLVA 5DXAA 1LS6A 5IWAB 3HFRA 3RRMA 4E14A 4U00A 1QDEA 2BMDA 3DDHA 1AKUA 2V74B 3JAKA 1JFVA 3TRIA 3N3BC 1R88A 2GLUA 1XTSA 2CCGA 2IPNA 5K3DA 2PGAA 2HG8A 3LSTA 4LE2A 1G21B 4RMNA 4E21A 3I37X 4IVRA 1R8JA 2ODWA 4FZVA 5ICFA 1KNQA 7REQB 3ZV5A 1MJGA 1JQDA 2V6GA 4P38A 5JARA 1U0SY 3F2VA 2FH5B 1JJ7A 2CMKA 4QQFA 3OE7D 2JHPA 5TMBA 4EG6A 3OP4A 1JIUA 2WKPA 3CX4A 4LJ9A 4AKSA 2QAGB 5PGMA 1TWHA 1Y5NA 3HKDA 3L0SA 2VDLB 3L9WA 1CFZA 2JFYA 2ZSJA 4PN7A 5IUNC 1JA1A 2OPBA 3JQ7A 1RM0A 4YFVA 5KNBH 1CUYA 2IV7A 2QTVA 3OZGA 3IMFA 1RAHA 2J0UA 2Y1GA 1GQSA 3DXFA 2V96A 4U9IS 4CQMD 3OLYA 4BWSC 3CVUA 1RWWA 3B9BA 1ZWKA 2M6KA 1JSXA 3LMKA 4KXLA 1G8SA 3F6SA 5FI3A 5WRFA 4I7EA 1GUBA 1UJMA 4K3UA 2D3WA 5BRNA 4ZYTA 2V3CC 4B2LA 2CDNA 3CR8A 1RRPA 4JU8A 2VHYA 4W9RA 5IJXA 1G63A 1ESNA 1MQ9A 5IFLA 3KT3A 3LUFA 4JASB 5KQLA 4FS2A 2PSFA 3NUGA 5AICA 1X1TA 1YB6A 1E1RA 1YZ3A 2L17A 3QLEA 4LTDA 2K2WA 3TKYA 2C5EA 3GFSA 4G9BA 4QXPA 4ZK6A 1K0FA 4ANFA 3BCUA 4BMVA 3LNCA 4PGMA 5E6SA 4EG7A 5C18A 2ACEA 1ZJJA 3KJXA 1NVIE 2JVKA 3G8CA 2O1EA 4FE2A 2XBUA 3QHAA 4NJMA 3RAGA 1DV1A 4P4LA 3MTJA 1GSAA 1TKRA 4DQNA 1D5WA 5AXCA 2P1ZA 2RHJA 2ZRBA 3L02A 3LCUA 2ZQ5A 4HB0A 2B8JA 3JQBA 4H08A 3K8ZA 1KA9H 1TNDA 2HRCA 1N6NA 3ML1A 5CCXA 4JJ7A 4ALLA 4F7DA 4GKJH 1JB1A 1MVOA 4GICA 3V1MA 3PLAE 4P54A 3RC2A 3ZNQA 3GJ0A 4BQEA 1GPUA 1TYEB 2Z83A 2JCGA 4FU0A 5CM2Z 1CY6A 4Z0PA 4U7PB 5EPUA 1OW3B 3ZUPA 1TZBA 5KJ1A 3MGGA 1JN0A 3RVPA 3Q3VA 2EFJA 2ZKLA 3A27A 1VLHA 3C6XA 3L7JA 4MTCA 3RGXA 3BREA 4AJLA 4CF3A 4ECQA 1F6DA 4W5JA 1FBNA 4BP8A 4A3SA 4LQ4A 4DSTA 1JI3A 4MPDA 2YWFA 5JAMA 5J47A 2RDMA 1PGOA 3VYRB 3GVIA 1DPGA 3QF4A 2OOKA 4DUZH 3M9MB 5TARA 1DARA 3FR8A 4E46A 1UC5B 3VNSA 3U80A 1TA4A 4GS5A 4JLBA 4M7OA 1F4VA 3QVKA 4N3NA 1I7NA 4DMGA 2RGWA 3GIPA 1FZTA 4ZDIA 4RK7A 3E5NA 4NNOA 1G55A 2J3HA 1Y3AA 3GLQA 1H9BA 2OYRA 4HYYA 3DZFA 3ID6C 3VISA 3W6PA 4X62B 5ILGA 2NU7A 3ACBA 2VOEA 3N0RA 3NBMA 4Y7CA 1KRHA 2XY4A 3EZ6A 1Z63A 3OBBA 4XWYA 5FD8A 3JY6A 3L04A 5DG8A 3W1EA 3WB2A 4B4UA 1WXHA 1GJRA 1YQDA 2PU7A 4YXFA 3FROA 5J59A 4GPIB 4LJSA 4CCAA 2FQWA 3TYXA 4FNOA 1KIFA 4YAUA 5L4LA 1VQMH 2ATXA 4J9RA 2YZGA 5L3QB 2UVWA 1R0SA 5F2NA 1C1DB 4XVHA 1WCMA 1U04A 2PS3A 4RJ2A 4BX2A 1E9SA 1JLHA 1DP4A 1OXVA 4RGBA 2PZKA 2ZULA 4ZRDA 2WP0A 3N53A 3CZRA 3CW2A 1DCFA 4YMSA 3WSTA 4TV8F 3MOSA 5EWJA 5FT9A 2DHRA 1XZJA 2EKPA 3WNVA 1Z12A 3NWOA 1E1QA 2ZREA 5K8TA 3HXPA 3OQIB 4O3PA 1EG7A 3BGOS 4LQDA 3J81k 3MMSA 4MV3A 5FADA 1RKQA 3JAKB 1V8PA 2B7NA 4HQOA 1K7EB 2WG1A 4MITA 1FVHA 3RUAA 3ZVRA 1SC4A 1GU0A 4QFDA 1QZZA 4YNBA 5IT5A 2QAJA 1LK7A 4M36A 1RCUA 1YE8A 1TUBA 2W00A 1QZ3A 3IP9A 4OL9A 1T5TA 1FVIA 1HOTA 4UU7A 4LF9B 1WR2A 2OM2A 1NDQA 5L9AA 1M8KA 1UKEA 4NHEA 3T5MA 3VX4A 4DEVA 2Y76A 3NANA 1OVMA 5M2QA 3QPUA 2ZS8A 4MULA 2TS1A 4XD7A 3NEPX 5DNWA 4ZQIA 2GZSA 3W2EA 2HLHA 4E11A 1I3NA 2DBQA 3PJGA 3RM3A 4ZZ1A 1RWNA 4F11A 5A9SB 3SBXA 3UJ9A 4X20A 4H59A 5JISA 1JR3D 2I6GA 2IEIA 4ZHQF 4F4WA 4OI4A 1MQ8B 1U3TA 3DDZX 2OYCA 1MXHA 2O2HA 4RD3A 3C6MA 4MI1A 5D01A 3K6SB 4UHCA 1C4XA 2BHLA 2O14A 4GKVA 4LC1A 4RE6A 3T95A 4CMEC 2HMWA 3IV9A 1K75A 3ASYA 3IUEA 4ALKA 3IKMB 3HBFA 3S1AA 3H5TA 4E6EA 3K72B 3SGLA 2YJ6A 4RA6B 2FYTA 3SC2A 1AKMA 2JLRA 3ICWA 3ADBA 1CERA 3WL6A 3B13B 3WYCA 1NTOA 1ZD1A 2EYUA 4D3ZA 5DNUA 3ND6A 1E9DA 4U2CA 4HX9A 2J9FB 3UMCA 1O4UA 3HGMA 4MO9A 5J4LA 1LNZA 3WGTA 2UXBH 4JEIA 3PC2A 4PLYA 3E05A 1E79D 4QSMA 5ECDA 2PBRA 1QOPB 2DKNA 4FSHA 4O4HA 3BCSA 2XUPA 3GV8B 1OY1A 3FDFA 4OY3A 4P3YA 1Y42X 3V4OA 2O0LA 1YDWA 1ZUHA 2PVCA 5G41A 3I39X 1O08A 1ZNZA 1TLFA 1MJFA 1RPTA 4ZVQA 2OMDA 1PHRA 2BMAA 2POQX 2FJZA 5K0NA 1QVFH 4MMZB 5D3MB 5EZSA 3IEMA 2PRKA 3ABRB 1U6IA 3KJFA 3A6GA 1RJRA 3QUSA 4Y6OA 3B1KA 4R2WA 2I2CA 4ALIA 1H3FA 1I1KA 5EYPB 4WN9A 1VXOA 2IHYA 5HYVA 2VHJA 4JJ6A 1N60B 2JEGA 1P61B 1XLUA 4GI3A 4ERNA 1ECBA 3A25A 3SYMA 2P2YA 2D1TA 1M73E 4NRDA 5AXBA 4FB5A 1ENOA 1Q0LA 4JI4H 2BTQB 3I8OA 5JDCC 5AK0A 4BXOA 3I12A 5BW8A 5LBIA 3HNRA 1TUEA 3PEVA 2W8ZA 1MU0A 3JYNA 2GHQA 3EZ7A 2D4HA 4RUKA 1RLOA 3MCZA 3O4FA 3SYKA 5LZ5A 1JWLA 1R0WA 4RO0A 4OVKA 4CMHA 2XQVA 4HHEA 1M1KJ 1QIDA 4HAUA 3S44A 4LWQA 1IJBA 1DWOA 1I24A 1TCCA 2BTQA 1KMCA 2G5TA 4I0WB 3UHOA 3JAMW 2J07A 2OORC 1GITA 4XSHA 5J4YA 4DV2H 4JI6H 3U5TA 4RGVA 3DHNA 4EKNB 1RYSA 3LL4A 1YULA 1S4QA 1H0SA 3DMNA 4B40A 1QHFA 4K26A 2XNCA 4JVLA 3U7RA 2I2XB 1KZ6A 2WVAA 3OFJA 4NMLA 3U7QA 4NYMQ 4XDGA 4AYWA 2PZFA 1Z6PA 3AFGA 1EVIA 2PMZE 5HCIA 2FRXA 1N5KA 3VDNB 2VZLA 3AUFA 5HJ2A 3D4IA 2V5AA 3R3XA 3PNYA 1NA5A 3EK2A 1TKBA 1YQWA 2NWQA 3N8HA 1PJBA 4MPRA 3FKQA 1ULTA 1D1PA 2IU4A 3SHQA 1LRLA 5IF9A 1VFNA 2HK9A 2XMQA 4BPRA 1XEXB 1VL0A 3EC1A 5LQJA 2ZK7A 3EXEB 2IU3A 4ZAWA 3U44B 3C98A 4XCQA 5JPDA 2WP4A 1H8ED 1ISMA 1XF9A 3JARB 3GOQA 1IRIA 3EMVA 3WRXA 3AMVA 1NPTO 4PFKA 5AR1A 1Q50A 1E6EA 2JGNA 1W44A 4L78A 1R0BA 3QQMA 5AKYA 1ZUD1 2WLTA 5DK6A 2Q0HA 3E7FA 4Q1AA 3A7EA 3FMPB 3R5TA 3WAGA 1XHEA 2H4FA 1ODCA 5DV9A 3WIBA 2EP8A 2ZUEA 3ELBA 1GADO 3KB1A 4FDLA 3RUDA 4LZLA 1J6UA 5B2FA 1RC1A 4BRWA 1CR1A 3I4MG 3PB3A 3VYTB 4EUFA 4U0JA 2FG5A 5ALIA 1E4YA 3A1EA 3EQ2A 3MJTA 4WJKB 4UY8M 2HVQA 1KAQA 2J5RA 3AESA 2H5JA 1UXHA 4D79A 8LDHA 1QRTA 4KN5A 2G0TA 4BNYA 5A7FA 5TRTA 2ZG6A 4B48A 2NXNA 3HB0A 3NBZC 4EEKA 4B87A 2BHTA 1DCMA 3SS8A 2O54A 2I99A 2W6JD 2BM0A 1JHAA 4OIMA 2AFRA 2NLOA 1AVTA 4APMA 1K2VN 4GLJA 5BN5A 4XFKA 4HX5A 4X64H 1HUQA 2CFOA 1WUHS 1CE8B 1FLDA 3AERA 3AESB 3IEIA 4OL0A 4BNXA 2FW8A 2JJ2A 2B1RA 4NFYA 4ODIA 4V0NA 4KE8A 4CIDA 1LDNA 1PT5A 1WM1A 4FI3F 4LXUA 5KFXA 3COYA 3M1LA 4RBNA 1E4EB 3TGWA 5CB0A 4DV5B 4AKIA 4UKDA 1EK2A 3NT4A 2WP8J 2H48A 3AOEA 3DAOA 3OZSA 4LKRA 1Y1WA 1DQPA 1FS5A 4X6YA 3ENVA 2NGRA 1DQZA 5FR9A 5KYGA 5DGXA 2WUWE 3IPCA 5K6AA 4G3XA 3FYUC 4UFOA 2IS4A 1FRFS 4GMKA 4M1SA 4MX8A 3B1YA 3ZXIA 2D7DA 3FYSA 2B1IA 1JHMA 2FDXA 2VCYA 3DM5A 4IUCS 4K6HA 5DGIA 2IUYA 3GJYA 5JZ9A 1Q0PA 4ASUA 4CEIA 1LCIA 4YMWA 2QM8A 2Y9MB 4B6SA 4PYJA 4KTTE 5LDHA 4U63A 3AL3A 2RD2A 2E1RA 5A2QW 4R8MA 4C80A 5E1MA 2IH4A 1OBOA 2X5NA 3D0RA 1ZWLA 1U98A 3AEQB 5BW5A 4QEZA 5I7UA 2VKTA 3C39A 5K4HA 2M98A 1XTUA 2HCBA 2DMRA 2VVTA 4EHBA 4W9MC 2CSUA 1FQWA 4HSEA 4TQAA 1XZFA 4OP1A 1MO3A 3EY4A 5ICCA 4WF9J 1Q95A 3ET5A 4DT1A 3L0DA 3QZUA 5K4AA 1KMIY 1R4AA 4Q18A 1H93A 4XWOA 1UP4A 4IBOA 4YJ3A 1W4BA 4W5TA 4DR6H 2R8HA 1JSCA 1U65A 1W4AA 1ZW6A 3F3MA 2OFXA 3GVCA 4RDHA 1S8NA 1U2GA 2Z98A 2PYIA 5E8RA 3ZTWA 4C06A 3RWOA 4F6LA 3EVBA 3ZBTA 2JA5A 5L53A 4XWTA 1HRKA 5CD1A 1Q14A 1G8FA 3ECCA 4QOIA 4J0FA 4A3LG 2DLDA 2QVGA 5ALWA 3WGUA 1Z62A 1GQYA 5AVZA 5JXGA 3VZCA 2EXXA 3GC6A 3GEPA 3GNSA 1DWQA 4KYVA 4J2TA 1C7EA 1RBZA 2JJ1D 3HJTA 2BN4A 5ESWA 2VOJA 3N41B 5KFDA 1VJRA 3BIOA 4BO5A 4CKBB 1DBRA 5AW5A 1DHTA 3TQHA 1YMVA 1ZN8A 3KFXA 4O4IF 2HA4A 3LJKA 2W6PA 3R5JA 5ERYA 5GGYA 1D7OA 2HO5A 1CEQA 4QEKA 1TD9A 1YBFA 3MTQA 4R9NA 4R2HA 5GGXA 1SUEA 1LSJA 2IS1A 3CISA 1BQ4A 3R3JA 2NPIA 3T7SA 5C5EA 1XNQB 1E96A 2C8KA 2H08A 1BMFA 1UMKA 1V35A 3IUPA 4G5YA 1KERA 2ZJ3A 2FZCA 4E51A 2NZVG 2VQSA 2WIFA 4AS3A 1K4KA 1ZEJA 4IFIA 5HHTA 5C4XG 1RYBA 3MB5A 4PTYA 4IV8A 1P7CA 2LCIA 3VZDA 4DAOA 1XTRA 3WKAA 2MSLA 3BAZA 5D3MA 2WM2A 2AGVA 1R12A 1YL6A 4Q3DA 5FF9A 1GNRA 1VJTA 4QATA 5DFAA 2OWDA 4OHVA 1V11A 2BIFA 3HCFA 1H66A 1WZ2A 4J07A 4Q1DA 5JS8A 4ND1A 1X15A 2BGIA 2CQYA 1P39A 2QTGA 2VR1A 1J5PA 3I2IA 5K7SA 1T0UA 3PBKA 5LQMA 1MQSA 1JHOA 5TR9A 2GZRA 3INTA 4F2DA 1IBSA 5IYZF 2I8AA 3A6DA 5DQGA 1R50A 1Y81A 2FRDA 3HCPA 1Q0RA 1LDEA 1FO4A 3L7NA 2Q9CA 4DQVA 1I6MA 4K86A 4X94A 5AXAA 4OA8A 3DV0B 3LHDA 3A1WA 3PA8A 1R16A 5HMMA 5FDFA 1EWQA 1ZAUA 2GWRA 4CWAA 3G02A 1MRSA 3PJRA 2IP2A 1L4LA 1RI2A 3T7CA 2O2ZA 3LBIA 2GEBA 4RFVA 2WPNA 5K03A 1FOEB 3USZA 3HDVA 2HWKA 1T9ZA 1VOTA 2YRXA 1VG0B 3DO8A 4PLCA 4RF4A 5CHEA 2WAYA 4X64B 4BNTA 3PTAA 2Z5FA 2XLCA 1HYGA 5BYAA 1OKKA 1WSDA 2A1UB 3DEIA 3DFUA 4DEXA 1HRDA 2RKBA 1ZW1A 1CF4A 1JQLB 2VP3A 4HLQB 4TKVB 3VTAA 1HC7A 3TDKA 1KI6A 1DKRA 2G04A 3HOVG 4YQFA 3GLHE 3IUSA 4JT2A 1C3XA 3TDNA 4DABA 2HBYA 3AWIA 3FFTA 1VL2A 1FU7A 2P2DA 2XZTA 3D1LA 4LMPA 4RYLA 1BKSB 3W6UA 1IPHA 4P8RA 1YR2A 3H20A 1NTRA 5JMWA 4O3OA 3O1HB 3GY0A 2KM1A 1EESA 3H5QA 3BQ1A 2C3PA 3PQFA 4ZXFA 5JECA 1VYUA 1U0EA 3CCCA 1O6BA 1YU6A 4DN6A 4MKRA 4KIWA 4UXJA 4DR4H 4R0MA 2EHDA 1UM9A 3EZNA 3WLKX 5HIAA 2YVQA 3B2NA 4HP8A 2IV3A 5LLDA 2WJHA 4A3CG 1BFDA 3IXQA 1XQ9A 3OIUA 3DEJA 5H16A 3ZCRA 2DJ5A 2F1JA 1AQLA 3ZX5A 2R65A 5HUJA 2A0XA 1HZZA 5EZ6B 4LEIA 3N42B 1LX6A 2HA3A 1JRPB 4Y1EA 1Z4PX 1XOIA 4O86A 4C4PA 3DR5A 5KNDH 5MF6A 2ASJA 1IBCA 1RC8A 4J0MA 4NZYA 3TOSA 5EE1A 2C31A 3JWGA 1FFWA 2YR0A 3ED1A 3L3BA 3M82A 3CWZA 1P3DA 1XZQA 2IT1A 3K20A 1N8RJ 2D5LA 2HXSA 4CFZA 3LUBA 1B73A 4DR3H 2Z9DA 2HI0A 2WF5A 3P2YA 2CV2A 3VRHA 3U40A 5CAEA 1MB9A 3DKKA 4KXMA 1GQFA 1WSBA 5E3JA 4E3WA 1IFXA 3V1YA 3B5JA 3GNNA 4EFDA 4ARCA 3I1IA 5FRDA 3VKWA 1AO0A 3LCCA 5DU2A 1ISIA 2BFDA 2FWBA 1V2HE 1E64A 1BFKA 2X9GA 5J5CA 3VBEA 5KC9A 3OTOH 3LECA 3PFNA 1Z4MA 3P9RA 4MXDA 3RVJA 1VIMA 3I05A 1UKBA 2BE9A 2HLNA 2VZ9A 3MIZA 4BAZA 4LF5B 4CJXA 4I5DA 5DGAA 3DEHA 3KT8A 1EP1B 2HMSA 1CNMA 1K98A 1UDCA 1KR5A 3ETDA 2WIDA 1BO6A 4JUAA 4LJRA 5EDWA 3ELWA 1SIUA 1M7BA 1PLKA 2R9VA 3GAFA 1KYVA 3F6BX 3MPUA 1U8FO 3R7LA 2GXSA 4R9SA 1CV2A 2QT1A 1QVRA 5F33A 1X1BA 1XRRA 2EFCB 1LQ2A 1Y8QB 2P5SA 3R40A 3F5FA 1LPSA 4RK0A 3N28A 2W37A 2I8LA 1K97A 1ADYA 4QGHA 3VR2A 3O4JA 2FKLA 1QRSA 3JQFA 4MQ5A 1QR6A 4O2AA 2ZSFA 5DNEA 5ICEA 3DEFA 4MSUA 5ECGC 3WMGA 4ENTA 1DKMA 3X1YA 2YS7A 5HKBA 4MAAA 4AG5A 5DNCA 3I61A 2WV7A 5KU1A 2GDJA 3O8NA 1Q2XA 1T10A 2YIVX 4DRZA 3A6ZA 5I5UA 1TL7C 3I2JA 3EF1A 4LXGA 3CKKA 3THSA 2DPJA 4PWZA 1EFAA 2OO5C 3REOA 2Z2XA 3N9IA 3MWYW 5ENZA 1FB5A 2SBTA 5HQ3B 1G4UR 3IOMA 3ZE1B 4UFPA 2OXTA 1WAMA 4NJEB 2BOVA 4ADSG 3PS9A 1K1QA 1W88A 3KAKA 3IT1A 3ZWKA 1KSJA 2AS0A 1N6IA 1M1NB 3QX8A 1FDWA 3GMSA 1KVRA 1NUAA 4BRSA 1N9GA 4KHZA 5ECYA 4A36A 4GI7A 1INLA 3JD0A 1R8QA 4OBWA 5G0TA 4ZI7B 5JFGA 3THYA 1IXRC 1C30B 2Z4TA 3Q41A 1YDFA 3SBOA 5JOQA 3TN7A 1N2HA 1U28A 3LPCA 5D2CA 3QE3A 3STHA 3HUDA 3SHOA 5EJ6A 1U3CA 4C0SA 1W87A 1YV9A 2F1OA 2YNMD 3SR6C 3AVVA 3JWJA 3QG5A 4KHPB 1E6WA 4QTZA 3K5IA 4LH7A 2HSDA 1G4AE 4NENA 3VPHA 4HXYA 4XW2A 5KTYA 3OEYA 4B3GA 1S0UA 1A50B 1BU5A 4WCVA 3FCEA 1Z8HA 1AKRA 4IKOA 1OD6A 1CUDA 2WKRA 1ISSA 4I6GA 4ZOAA 2YV2A 5LCXA 2G36A 4EW3A 2ZCJA 2GVNA 5LB2A 3RSLA 1AK1A 1AUPA 3IE0A 1XVTA 1M5UA 4Q15A 4DCGA 1DU4A 1TJNA 4ZI7F 4JYAH 1UKAA 4GBGA 4RQTA 3VGPA 4W5HA 3IMGA 4N39A 3K6SA 4J43A 3F4LA 4HS9A 3U16A 3WX0A 2JI4A 2ODAA 3B6EA 1HXHA 5KOHA 1O94D 3SMQA 4C2TA 3LVQE 1M2KA 2RMKA 5SYAA 4FS1A 3D8NA 3V1KA 4Z51A 2DFDA 4O4HF 2V98A 4A0QA 1XRQA 4OX9H 2O2GA 4UU8A 4B32A 2C7PA 1N9GB 1PKXA 4L74A 4RA9B 1M2JA 5CCDA 4TWAA 1LDGA 1E5LA 3N43B 1V5EA 4JBYA 2HCJB 2P9CA 4ZT3A 4OSPA 4F4UA 3T3NA 2EEPA 2XAUA 2F1HA 3P20A 2J33A 1W52X 4NBLA 3RT9A 4OHMA 2QX4A 3LGXA 1DEXA 1UDWA 3ODGA 1Z4KA 4MICA 2P6MA 4MRAA 3TZ6A 1P0MA 2J4CA 2NVUB 4EW6A 1P7YA 2AFIA 1YZTA 4IDNA 4XB2A 3GJXB 2XNDD 5A7HA 3SC6A 2R8YA 5LMCA 3AO0B 5K3BA 3G2IA 1VI6A 3W2FA 4DJFC 5LP1A 4NBVA 3UN1A 4BY7G 3EAGA 2J46A 3ZNOA 3ZK9A 4I1VA 3L2PA 1Y3IA 1O89A 2HV8A 2JBMA 1A9OA 2IA6A 2O8VA 4X7RA 1F38A 2WZDA 3RNOA 4AW9A 4LJ8A 3DOFA 4N5HX 4DJEC 3U37A 3RSFA 4X6UA 1ORWA 3FTNA 3P9SA 3W5OA 2CXXA 2XTJA 1J09A 3STWA 4EJ6A 1IYDA 1L9XA 1GTG1 1FRZA 3AGQA 3FZEA 1ZA1A 2VA8A 5HNKA 3BSWA 4RCNA 1Z16A 4QNMA 4US1R 3IRUA 1PD0A 2XYHA 4ZALA 2WWVD 3DV9A 2AUTA 5GIPE 2ZQYA 3O5AA 4BHTA 1M8FA 1HX7A 4BJ1A 3KE8A 4H1UA 1BX1A 2BKLA 3PJDA 1QPGA 3PR3A 4GM0A 2RHCA 5FEUA 4DSNA 3VJRA 2BUCA 3QVXA 4AY6A 1VHDA 1B26A 1C3VA 3D2AA 4ZU3A 3K8YA 1O6ZA 3GI1A 2I22A 2J59A 3SDBA 3WWEA 4PLZA 3HL0A 3LT1A 2FW9A 2D1RA 2VHCA 3KZKA 2H51A 2IDMA 3Q2OA 2Y9PB 4NABA 1VZ2A 4YK7A 1O0BA 7MHTA 3AMZA 1PNTA 1OI4A 1R6XA 1WSAA 3O9ZA 1X3SA 1OYWA 5A4AA 1CDDA 3MGCA 3OQVA 5H81A 4AZ0A 4B6QA 5KNCA 2H0QA 1UDAA 4F9TA 2CB0A 2RGBA 3TSOA 3Q4GA 1NG9A 1J2YA 2H1HA 3DKVA 3G2MA 2CXHA 5FUXA 1Y69K 2GRJA 1NGSA 4C04A 3EIUA 1YZHA 1RACA 1KNXA 2WYVA 3GNLA 2PZGA 2ZB4A 3DVAA 1PJZA 4IJWA 1E3JA 3O03A 4TWIA 3S0JA 1E63A 2YMMA 2V6IA 4HKTA 5KVQA 1OXSC 3VYWA 3WGOA 2RGUA 2OVBA 3ZHVA 4NCIA 1ID8A 1H69A 3CSWA 5CNJA 4EHLA 1TC2A 1HQCA 5LQAA 2UVUA 3DMYA 1ZLYA 4YB8A 2XTMA 1BE8A 3JD3A 1Q11A 2PH5A 2L42A 1NNLA 2B5VA 1Q92A 2B4KA 2VKQA 4FDAA 4G97A 3T6KA 5BWBA 1SVWA 1WCIA 4HQKA 4MLZA 2J6CA 4W4TA 3GMIA 3IVGA 5AH0A 4AP8A 3T3EA 2ZYTX 4FONA 1D1SA 3SF8B 1U3WA 1I6KA 1WKCA 3JQ6A 3QX9A 4RXTA 3AF5A 4WKPA 1AZTA 3TY5A 2ROQA 3GEBA 3NTVA 4L28A 4KGDA 4UCFA 1E3IA 3S40A 4Z4EA 1RJQA 1V71A 4TPKA 3ADDA 1JLSA 3CH7A 4JH0A 3ZBUA 2PJUA 1PT9A 3WWCA 2CWWA 2WYUA 1NZDA 2DPYA 2PVPA 4HGPA 3ZD8A 4V0ME 4L16A 4O59O 4RGQA 5IT9W 4R0VA 2C07A 4U7DA 2G1PA 3KCNA 4HQRA 2HBZA 1SD1A 3DT8A 1WABA 3NTQA 3R23A 2DSJA 5CD9A 2QD5A 2DUMA 2WZCA 3N2NA 4IIVA 4TM7A 4AMVA 3CT6A 4CTJA 4N65A 1QX3A 4DCJA 5GTDA 2GJAA 3RYHA 1O77A 2WR8A 4BB5A 3GP5A 1QIKA 2XCPA 3W4JA 3ZCTA 4AQ7A 4IINA 4NZZA 1GPDG 1ET0A 3OQNA 5JH7F 1YZNA 4J7CA 2VWHA 3DTGA 4KQIA 5L8VA 4DE5A 1VQOH 4J0IA 2FMFA 4JX9A 1VQ7H 2W2KB 1BDBA 5BWXA 1NBIA 1O95A 3EEOA 2C98A 4BZXA 2BRUA 1C81A 1EE9A 1X14A 3M8KA 4DQKA 1B7GO 5A7GA 1KAEA 3DJFA 2Q45A 4YR0A 3VJMA 3K70C 4J7AA 4FFNA 4ECXA 2BHRA 1GPAA 2CYBA 3LPNA 4ARZB 2QRKA 2JFVA 2ZDHA 4YR3A 1I3KA 4LF4B 3A11A 4L5AA 2E2IA 4YBZB 1EKVA 1L5WA 1YHZA 3CKMA 4MR9B 1Z0UA 2GPJA 1FY2A 3WWHA 4CLDA 1V3UA 2ZR9A 4EJ0A 4HNVA 3FDJA 2V7WA 5EIEA 5ED0A 1YUNA 3F5DA 1IN6A 5F23A 1W47A 1UOPA 3T3IA 5HQ3A 2AB0A 4QJIA 5DKFA 4HNAA 1HLGA 2I7DA 4ZVVA 2XXAA 1V1RB 4HDOB 3GBSA 4QGBA 3S55A 1P4JA 4IIJB 1OBVA 4PSVA 2ZE6A 3F67A 3HVJA 3KKNA 3MR5A 1Q0QA 5BWVA 1BGXT 1Z8FA 2A59A 3NTOA 4DR7B 1WXIA 3KREA 4GGOA 3PSAA 4LHVA 1U6KA 3MT7A 4YJKA 4CV2A 5KG4A 3BWBA 4RPJA 5L45A 2OLEA 4D02A 4NDNE 1FMLA 2C5FA 2GEFA 4JUIA 5AM0A 1E2FA 1E1QD 2VDKB 1DXQA 1YCFA 1T6XA 3OIFA 5CXSA 5AM5A 2OV4A 5HJ7A 1U5BB 1ZMTA 2Y68A 3HBLA 3L41A 2I1WA 4L6AA 1Q7TA 1XQ6A 3LUAA 4KDEA 4ERXA 2F1RA 4A3GG 3DQPA 2QT9A 3OLXA 2OK7A 4RZQA 1DC5A 2XSZA 4TUYF 4AN0A 1DT3A 3EZ9A 1XQVA 1JSRA 4MKZA 2GAFA 3HGQA 2JFHA 1JT9A 4LY9A 3NVKI 1XDUA 4X1KA 4RAOA 4MB2A 2X0FA 4ZHQA 2XUJA 4AM8A 5HA5A 3TCKA 2KJQA 1ECGA 2F00A 3I45A 4ER7A 4QDZA 4U5XA 3OFND 3F73A 4O4LF 2H54A 4EBEA 3MJSA 3RTBA 5U9CA 4EGQA 1Z35A 1VE1A 4RFSA 5IJZA 1RI1A 1O87A 5HR5A 3VNQA 2WB2A 1QBGA 5HIMA 1SC9A 5DM6J 3WISA 4Z2AA 4GKKH 3MWJA 4GOMD 4YRSA 2E2HA 1YC2A 2OOSA 1UPUA 2OK8A 5GAJA 2AOUB 4RM2A 4UUPA 2BI7A 1AKNA 2VNIA 2KSQA 2R4TA 1O54A 3DUWA 3JRNA 3OX1A 4UCXA 4ETMA 4F4FA 1FRQA 5EJIA 1ILWA 4U4AA 5T6BA 4DUYB 2HH9A 4JUZA 2JCVA 4REOA 4BMDA 3LCJA 3OJLA 2YZLA 1E0KA 1K6IA 1KHTA 2CNDA 5FUVA 3GMDA 5G3ZA 1N2JA 5I01A 4G8DA 4YASA 3FM9A 4AJIA 3BXZA 4LSWA 2B4RO 1ETUA 1K6XA 3UFBA 4O4JB 2B4QA 2VAWA 3UT5A 4F56A 3E03A 4IO9J 3BERA 1KZ4A 3HOXG 5C81A 5AW9A 1Q0TA 5HCNA 1H8HD 4C4AA 5GP1A 2BF4A 3F3YA 4ZDJA 1R27A 2HVRA 2NX2A 2OFWA 1KH2A 3NM4A 1G9TA 1YE5A 3Q3IA 3R3UA 1CZNA 1U99A 4BJ5A 1I0ZA 2E5LB 1N61B 3BTOA 1QGUB 3LAWA 3RSCA 4FDVA 5AVWA 1HSZA 2V6JA 4RLFA 1H5UA 3ON5A 1BHJA 3MD0A 5I7EA 4KYUA 5FR1A 2ZJ8A 3WRXC 4ZVUA 2AFHA 3MJVA 1K83A 5IYDG 1NBOA 5DM1A 3WL3A 1B0ZA 2FZWA 4LZNA 4Y9RA 3NASA 4ETIA 2C7GA 1QVZA 2C9ZA 2JFPA 4I1SA 3V3KA 3ETCA 2BM8A 4Q37A 4U7HA 5CLLA 4F6RA 3ER9A 2RHLA 1LVHA 1J24A 1B8NA 2J9YB 4FZ5A 4OKNA 1E7QA 2HMAA 3D3EA 1RHQA 4FC7A 4MR8B 4P3PA 5FOWA 3UJ6A 2IHJA 4WK4B 2FPPB 1L7XA 1VFPA 2Z6UA 4BC0A 3I72A 4PXAA 5CA0F 1A9TA 1FVOA 2X9NA 3VUEA 5LWQA 1BGVA 3MN1A 5E0KB 4B47A 4EABA 3SNOA 2BFWA 3QG1A 1UAYA 4G9EA 1IUPA 3DW1X 3H8JA 1R00A 1YIAA 1F5NA 4PNPA 1TYBE 4PPQA 3QU5A 2AZTA 2JGLA 1RFGE 1ZAKA 4XCVA 1OI3A 3NC0C 4YO7A 3TAXA 4CLRA 5HUHA 5T7BA 1KY4A 5HBRA 2XDQA 3O2NA 3O8LA 4W7IA 3AKEA 4GYWA 2ZW9A 3P94A 4ER5A 5I3CA 4ENVA 5A5FA 4O25A 2ECKA 1BYUA 1TEVA 1XNQH 1DG9A 2JLUA 4EFLA 1CR2A 5DGDA 1W0JD 4JXUA 3FMIA 5ITZB 4C29A 1K7YA 3TW8A 1XK5A 3SY8A 3AP2A 5DWDA 3V97A 1VLZA 4MYHA 3GD7A 2J32A 1HNWH 2HIMA 3ZG6A 3NUZA 1H23A 3ZX4A 1R6TA 2VUMA 1S2IA 1Y6QA 4RV5A 3B51X 3BE5A 2DUNA 3GZ4A 2AQ4A 4QPPA 3C2VA 3FKSD 4FLFA 2E37A 2JAQA 3KOUA 1XNHA 3LY7A 1VIYA 3SHWA 5BMOA 5KWIA 3C4VA 5IVHA 1XALA 5AYXA 1SK9A 4Z4FA 4CHGA 4BB0A 3G5TA 1GPJA 3S27A 2G3YA 1C4OA 3L6BA 4O2AF 4RIEA 5JXJA 2Q4EA 1KPIA 3E3NA 3JQPA 3OFKA 4LCBA 3TB6A 2QB5A 3T1YH 2EL7A 5A04A 2PR7A 1TZMA 4DR6B 1DIOB 5B1IA 3VR4H 2GXQA 3LQ2A 1TM2A 3BWXA 4PZDA 4MWEA 2H7CA 4YRKA 3BJIC 4E7OA 1GZ4A 3PD1A 3BJMA 1GPBA 1ONBA 1DFIA 2AI2A 3A26A 3AZQA 4JGGA 4R5HA 2RIRA 3SEZA 2YCLA 5CBPB 1AB5A 2QRGA 5JYCA 2OVFA 5EMHA 4NYJR 5ARCA 4P7KA 4RTMA 2PL9A 5FPHA 1DAHA 1T26A 1SC6A 1Z08A 2QUAA 4KMOA 3I4LA 3GAZA 3K4QA 4OEHA 2AG0A 3D8HA 4QPCA 5BV0A 1GEGA 2WSIA 1LLUA 4EUHA 2UDPA 1UKVY 1HR0B 2N47A 1V9PA 2Z6QA 4I9HA 5JCOA 4DRXA 4YAKA 3GJ7A 4NAHA 1GY8A 4L6CA 5TQ0A 2YNMA 4KQ1A 4FCCA 2IHBA 1CRPA 5IN4A 3GYBA 4PC2A 3RKUA 3W1VA 4OHXA 2WTNA 3TLCA 2GD1O 4EF6A 2CLEB 3CNQS 3O4GA 2RGCA 3B12A 5IG2A 5D51S 4F46A 3SHVA 3NDPA 4GLXA 1PFYA 2IKSA 3ZLBA 3CX8A 3BIXA 1J20A 1ETHA 3UUFA 2F4NA 4IILA 1WDLA 5B57C 2IYOA 3ZXYA 2NO0A 1FX0A 4C0KA 1Y3HA 1W0KD 2X8AA 4MUMA 1H8EA 3HSSA 1MOPA 1SKAA 5B1DA 3T3DA 1OT5A 4QTTB 2HHFB 2X6QA 5MFPA 3CVXA 2CNKA 4DS3A 4V0OA 4TLCA 3RIXA 1PQWA 2RKOA 1G18A 3QYAA 4KAAA 3ZD7A 1ZH2A 4KQGA 1L8OA 3C0KA 1CQWA 3IO5A 2DFTA 1SH7A 4J9SA 1SG9A 1P2SA 1BCRA 1ZCZA 2WF9A 3GH3A 4L6IA 2R8ZA 4LDZA 4NJOA 5FCDA 5C52B 1TIKA 3KD3A 2XNSA 1WNFA 2GZHA 2OO7A 3Q7RA 4ZC8A 3UAWA 5EOVA 4CIBA 5LJIA 1F3OA 2OB2A 2ZZKA 1DGSA 3EN0A 3MERA 4TRJA 4WADA 3JVEA 3W7VA 1WMEA 4RTNA 1TA8A 1L5HB 2C4HA 2CVOA 5I9LA 1DKPA 2I91A 1HO3A 2XT9A 2NT3A 1OILA 3V2UA 4LJLA 4YT5A 3RCBA 1YGPA 4XX0A 1U8EA 4Y2YA 3ER8A 4LVNA 1DBSA 5TF4A 3A3NA 2V7QD 4U6QA 1TLTA 2IP4A 3DL2A 1Z6TA 3EVTA 3LY5A 4QU5A 4TTQA 2Z2ZA 5HBRB 2ZUUA 1W6RA 3TG2A 1Z18A 2HIXA 1L4GA 1UINA 1B1AA 2J9FA 4MVWA 5FBVB 2VHQA 1OLSB 3S2FA 3HCEA 1BJTA 1GDTA 3FVRA 4RQUA 4URHA 4MW6A 2R48A 1TZKA 3OF3A 1B74A 3IAEA 1S3SA 2XUFA 3RSHA 4EHKA 3TM5A 1E1KA 1H22A 4XIJA 4MI9A 3RJ9A 5HULA 1QWSA 2XCLA 1X80A 1N7JA 4DKXA 1CY4A 1MB4A 4GI5A 4DA6A 4A8JA 4ZQCB 2C0CA 5F5NA 3O21A 3ACDA 4IHQA 4ACAA 1IY8A 1CF9A 2IUEA 4CNQA 2Q9BA 1QK3A 2GDZA 1VCOA 1K7SN 4MWZA 1KJQA 4DY6A 1M7HA 1OFHA 5IKEA 3LRTA 1ZHOA 5AOCA 2PX3A 3S5JA 5REQB 1ZK1A 1YI1A 3SIRA 5JSZB 3VC1A 4G0MA 5EXPA 2A1HA 3OPNA 4N82A 2YICA 4BX0A 1Z73A 2Z57A 3KLPX 5KVAA 2FA9A 4RTSA 2NUBA 2ZT6A 1SVUA 5CDTA 1PLLA 4I1PA 1RXSA 1ENPA 3RH0A 4P81A 2OESA 1SVIA 3V4VB 1FUEA 2GAIA 2CXQA 1PK9A 1ZD2P 3AR6A 1V8FA 4RH0A 4R9VA 3COJA 2HFJA 3CCJH 1HK7A 1CUIA 2Q0QA 5D6OA 5LXTB 4WY8A 3QENA 5A2GA 2BE7A 3IULA 4WLNA 4UVIA 1ZHHA 5KWVA 1DTEA 1USIA 3ZHYA 3OZTA 3IPXA 2JIOA 4A2WA 2IEGA 2W5UA 1USKA 3CC8A 4JP1A 3OSPA 2LCFA 1XAIA 2D7CA 3IFSA 4KE6A 3CB4A 4MRVA 4NDZA 5CGQB 2A35A 5JAQA 4DB2A 1V5GA 4GI1A 2EU8A 3HO1A 2FJUA 4WRRA 3VH4A 5D7NA 1KS2A 2AYZA 4XPIB 3MMZA 5G40A 5GM2A 1Y48E 4ON9A 1ZSYA 4WLUA 4EGFA 4Y6LA 5L1IA 1V1MB 1XP8A 4GOJA 3U5ZB 3T7IA 3D7NA 4FQ5A 3TNLA 3KHSA 3ISJA 1YHNA 3JVVA 2BWJA 2JVJA 2P9EA 3K6KA 2PWBA 1DOHA 1ULBA 2VJMA 2IFTA 4KN9S 5EHIA 1NBHA 1YWGO 1ZI8A 1CNEA 4FP9A 4OG2A 4BLWA 5AIBA 1CUWA 4HJRA 1PS8A 3F6EX 1XNRH 4Y6QA 4ZCLA 2BFFA 4BWYA 3OO0A 4QU8A 5B58T 2OXEA 3BABA 1B3BA 4MKFA 4Z6KA 5BV8A 1MX1A 2WDZA 3GOHA 4K5QA 2FLVA 4B2IA 2I4OA 5LR6A 4JI0B 5IASA 4DR4B 1ACJA 2Z09A 1P9OA 2IPAB 2W6CX 3QM1A 5C7LO 1UL1X 3H7AA 3P52A 3IRVA 4EBBA 2ZQZA 5GWXA 3F9CA 3U9LA 3BAAA 1ZCBA 2N9UA 1IXZA 1T9AA 2VUHB 3RROA 3DFMA 4NCHA 3LE8A 5JSFA 3PIPJ 1RNLA 1W7AA 2ZGIA 4IDQA 2WK1A 3ZU6A 4OAOA 3U19A 3NYRA 2CNWA 2CJWA 3G6WA 2SKEA 4LZPA 4EITA 3IBGA 2W6NA 5CVVA 4A5SA 1RAEA 2RH8A 4PBCA 2FZVA 2NSHA 1R5BA 2FNAA 4XXHA 5H9VA 5J4VA 3BULA 3U56A 3MWEB 3EXFA 4LXYA 3LQSA 1PFUA 3E5HA 4BWFB 2XUKA 3QFFA 1VBKA 4R1MA 5IDYA 4G8BA 1VYHA 2QA5A 2BZ1A 4M0MA 3S2ZA 1RAGA 3RF7A 1SCBA 2O5EA 2YWJA 1XMOB 2WICA 1NQ5A 4YONB 1O96B 2JAPA 4WNIA 3DVSX 5ED4A 3COZA 3F5QA 2HQ1A 3V7WA 2DTDA 3IP6A 1QIGA 3T1VA 5AHRA 4HVCA 4HNHA 5AUPB 1QZXA 5EAIA 3WYNA 2CUTA 4YHHB 3M4ZA 1FTNA 2A5DA 2YV1A 3K09C 1Z56C 2BI8A 1WULS 4YB8B 1VLLA 4HMPA 2VP2A 4OMFG 5C8VA 4J1NA 5T8KA 4C0AC 1N0IA 3RS9A 3JAWB 4BVHA 3EJ6A 3FTPA 1CY8A 4QDUA 5BNWA 4OX9B 1JHZA 3NAGA 1H2ZA 3ETJA 5IK2A 2RE8A 3LUGA 1DIHA 4Q9IA 3TOZA 4B3IA 1OFTA 2QD1A 3F3KA 4BU0A 3PNLA 5AW6A 3HO6A 5IC6A 2WSLA 3P4XA 4Q8FA 5DVZA 3W2TA 1Q74A 4MV1A 1QGZA 2R68A 4EYOA 2FOIA 3ZVKA 1VQPH 2D2XA 3DDCA 2NG1A 4GI2A 3SIPA 5B7PA 1PW7A 2GCOA 4AN1A 3P2MA 4EB0A 3UZBA 1MO2A 1E98A 3C5HA 3HCNA 2IBSA 3JQCA 4LRWA 2WW8A 4X66H 3TW8B 4QQNA 4WXPA 4I55B 3OX3A 2K87A 2PUBA 2IYYA 5DO9A 5LQSA 4UMVA 2ZRQA 4BQIA 3RJMA 4DUGD 4G89A 3IJ5A 3RS4A 2NXEA 4HDSA 2BZ0A 4TZ6A 4YY3H 2FX5A 3GMTA 1VKJA 3I5AA 3QI2A 4D3SA 4DIDA 1L5FA 5FX2A 3K71B 2LDBA 3TFOA 1EA5A 2WU0A 3GLIE 4QO8A 1T2EA 3DLLJ 1Y34E 1BMDA 1MB2A 1C9KA 2ZJ7A 3ZK7A 2HSEA 3IURA 3RB0A 3I1JA 5DGTA 1E9BA 1H4TA 3SE0A 3E84A 1FJGH 1L7PA 1P44A 1QOQB 1Z8DA 1A0OA 1B6SA 2FMAA 2E0IA 2KWIA 1N6LA 1UXIA 3PG5A 1C8BA 2OMEA 4ZAXA 2YY5A 3CF6R 4GG1A 2ZWAA 4LW8A 5LU8A 1JDBC 1F2TA 1O9HA 3PR4A 1HDGO 3DO5A 2XX3A 1L5VA 1JLRA 1G6HA 2GI4A 3C15C 4HOYA 2PZJA 4LF7B 4QW9A 1LEHA 1U8UA 3RK0A 4DCOA 2ID8A 2RBEA 1VCMA 4HQ0A 1YJBA 4MV7A 1P19A 4LX8A 1Z7BA 2EW8A 1XVAA 2REQA 4ROTA 2X9LA 4MW7A 3TPCA 4QUAA 2VPTA 1W5AA 3S99A 1J0DA 4CTKA 4ZCQA 4A0GA 4DF3A 4DLWA 4EJ2A 3BD8A 3S2GA 3EGWA 5J43A 2XKBA 3GT4A 5IAOA 5HNEA 1RHUA 3M6UA 4N9WA 4OHBA 4XEHA 1ZJZA 1XZLA 2Q2WA 1P7ZA 5JFTA 4D44A 1DNPA 1X13A 4GUAA 4URXR 1S0MA 4NFHA 4FN4A 3ZZ1A 3O2JA 4EG1A 3I34X 2X14A 1Z6ZA 1SU7A 4BN4A 4NK5A 4WQMA 3IAFA 4ARSA 4CBVA 4QLAA 1KOJA 1KJ8A 1YZYA 4CKCB 4DAAA 1TVCA 4JBIA 1LJ8A 1Q1EA 2BDEA 1SXJC 3HS3A 2Q4DA 1QGAA 4Q9JA 5EVJA 3RBAA 4BNVA 2DF8A 3KJZA 4C4TA 4O4JA 4Z8XA 2H65A 1T4MA 2ZP1A 1IY2A 1NVFA 3QZ8A 1Z2NX 1V45E 2I87A 5KHOC 4Q7KA 5E2BA 1Y4SA 5LIPA 1B8UA 5CB4A 4PSKA 1E1NA 1NVAA 3UHFA 1NXOA 5AD1A 1KO1A 3EZGA 3EAQA 2RAFA 2CDRA 2I3ZA 1ZS9A 1BNCA 3KDSE 3TZKA 5EIOA 5JWOA 1EK1A 1I5OA 1JQAA 2WU4A 3DXZA 3HJHA 4PFQA 2FF5A 2ZR8A 1FF9A 3RPFA 5LQDA 2DBVO 3UK6A 3DFIA 3A1DA 1DL5A 3RGGA 3ZXXA 2PEZA 3OUUA 2Y0SA 4NBRA 1OZGA 2I4TA 3LYHA 3TVDA 4C3UA 3WXBA 3D3WA 2CNWD 2X0JA 4ZQHA 1WB9A 4YALA 1RQRA 1UJ6A 1IAQA 2BMVA 3QOXA 3D2BA 3EUAA 1PGQA 2HXGA 4V24A 3LNTA 2HY7A 3P9NA 3IT2A 3OQOA 4R1PA 5ISMA 3ZC3A 4KR0A 4NYJQ 8MHTA 3JD1A 3KXKA 3ABQB 5E1OA 1RWPA 3N8DA 4U0KA 2IDZA 2OCYC 2JFUA 4JU9A 5TMPA 1IUNA 2WILA 3T4XA 3DONA 1C1HA 5I7RA 3JZIA 3FMGA 2XVMA 3TO5A 2EWWA 1NJIJ 5IZ4A 2QOEA 3G0HA 1UM8A 2D2VA 2Y1CA 1L5HA 4JBWA 4ENQA 4AKGA 3UOWA 3HMQA 3M6VA 4P3XA 4FR0A 2UVVA 5FNZA 2FFQA 3RSGA 5KNLA 5FHQA 1YFZA 3LBYA 2MU1A 3WL5A 2WBLC 3EFEA 1XAHA 2F3TA 1FMFA 2ENWA 3MBIA 1LX7A 4X54A 4C4ZA 1JKMA 5ICGA 3CR7A 1JEAA 4YJFB 3UQYS 3BX1A 4NBSA 2ZANA 5E38A 4UTPA 2C03A 1XYYA 1PO7A 1H1LA 2XIJA 5I4IA 3KEGA 2WJ3A 4CQNA 4K6CA 1TQ4A 4GMFA 4DYVA 1TYDE 3F6CA 4QWAA 4K9PA 3H2JA 3PEYA 2WE7A 1IH8A 4N5MA 3GRUA 4BLRA 5JUWA 1CKNA 4HAZA 3QWUA 3G79A 3IP7A 2AGOA 4I19A 4O5AA 1JTEA 4S3MA 3NLLA 1FTQA 1T2UA 4ED7A 1CUBA 1CXZA 4OQZA 1C7IA 8ATCA 2GOYA 4QSHA 1VPVA 3LK6A 1D4OA 1PRYA 4J2OA 4AICA 3KQPA 1XXHE 1O58A 2C4WA 5MN6A 1HMYA 1J5XA 4GSLA 2C5HA 3HH8A 2AHRA 1VGRA 4PCAA 5U4QA 1M7JA 4XWKA 4BXOB 2WHXA 1OWMA 1VBMA 1DKQA 2W7TA 3ZQ4A 1WWKA 1R4NB 4B6RA 4KGZA 4Q8EA 1SD5A 3NRJA 4RZ3A 2Z1DA 4P53A 5AJVB 5TXGA 2PJZA 1VL8A 2EQ5A 3LT0A 4UJ3A 3D81A 3UK0A 4YMUA 1B93A 5BWLA 1S10A 2C22A 4EY3A 1D2NA 2X5OA 2XUZA 3FBWA 1HT1E 2XYPA 5ESRA 2VDPB 3T5KA 4IFBA 1LY1A 3R44A 4JUDX 2G9NA 1X1AA 4HLUA 1C29B 2FUG1 1ES9A 2XA2A 1FM0E 1ODIA 2OCBA 4KAXA 4AI6A 1KC8J 3H6GA 1CZLA 3SC2B 1GDDA 4FMBB 1R9MA 2F7SA 4ENUA 1MORA 1P77A 2BCJQ 1RVV1 2HJHA 4ZCTA 5IKXA 1J5EH 3RJ0A 4POAA 2FXVA 1W2GA 4BV8A 5H4HA 4C03A 4L9AA 3IHLA 5EP8A 4K3VA 2VT3A 5HOEA 5AQEA 3ESQA 1DFHA 1GQ2A 5T4BA 4YAIA 1ISRA 3F90A 1L1EA 1ORRA 3OO1A 5GPBA 3WK8A 4LY3A 1G20E 4BASA 2CXSA 3HI4A 4FYVA 1CQIA 4S0XA 5KQPA 1R0LA 1AKYA 3NFYA 1EFKA 3AEZA 4YP6A 2XR1A 2ZPUA 1FRNA 2AR9A 5A0TA 1KZ9A 1AXGA 2GN6A 2V0NA 5A3VA 3TF5A 5DWVA 5GAGN 4CKCA 4FR5A 5ALZA 1HTWA 1VJGA 3GUHA 4L9SA 1LB1B 3ZDAA 3QWHA 3HKBB 1UMCA 3V6HA 5EZ5A 5KJ6A 2FPKA 1VTKA 5IJ0B 1Q83A 4EA7A 3NHYA 2P2LA 2RIPA 4Z1MA 5TJ9A 3BC1A 5BV7A 4HNQA 4M0PA 1KEZA 5EUBA 3TMAA 1YACA 3C3YA 1F60A 1YUBA 4Q5IA 3NHFA 4ECSA 1BS1A 1XTIA 4JIMA 2OZLA 1GKUB 1FBTA 1KSFX 4ED3A 1A8QA 3RLIA 1MIOA 1VCIA 3V5NA 5KYXA 4MUGA 4IJVA 4M7RA 2QM3A 3EIEA 5IBRA 1NUTA 2V58A 3IVXA 3SSMA 4ZZIA 1U0HC 2A84A 3MWKA 1YOBA 3ROGA 4E5DA 4JI2H 1WMFA 2LXNA 3T94A 4DVJA 5A4DA 3CNEA 3UTDA 1V96A 1B6RA 3EF3A 3MLAA 4Q39A 1EP9A 2FPGB 5KNDA 4DMLA 2O8BA 5JFOA 1RHRA 1IOWA 4MWBA 3ORQA 4LSGA 1I6WA 2FP3A 4TWBA 2V7XA 4R01A 4ILEA 4C6RA 1U80A 4RZHA 5CDSA 3N05A 3M6WA 1BZYA 1E99A 5I9BA 4DMMA 1LA2A 4MVJF 4QYTA 3LYAA 4F72A 5KTMA 5IARA 5KDDA 4XR5A 3T0GA 4ITUA 2VNAA 1N2CA 3NBFA 2P0AA 3CKYA 2QQ0A 1UANA 3V32A 5J40A 1EUCB 1RJ9A 1TM7E 3Q11A 4NYIQ 4UDYX 1N5WB 1KYTA 1XXLA 3Q5EA 3G9XA 2A1TS 2ALZA 2C3MA 3INYA 3V6JA 3WGVA 2J8ZA 5B12A 2QNRA 3COVA 5FLEX 5EJ9A 4DCVA 2QI9F 1QVVA 3EARA 3F46A 4P5PA 3M3HA 2RGEA 1SXPA 3ZWOA 2JHCA 1PZGA 2W2LD 3FDZA 4FHCA 1L8LA 1V41E 4WLEA 3UEOA 2HWWA 4EELA 3TWOA 4B6PA 4BRZA 3ENQA 1W73A 2BFBB 3NG1A 4QBKA 3IIMA 4FGSA 2C92A 3PNKA 3JASB 1IZ9A 1T8UA 5I5SA 1ZU5A 2JEZA 3HC7A 3BIWA 2MR6A 4AJOA 2VT2A 1N33H 2FPSA 2PS9A 5DHSA 3QUBA 1CG6A 3REQA 2R6CA 4MUBA 2AWOA 3HJCA 3HN2A 3FHJA 3LHKA 4I3FA 4JV1A 2O4CA 1O9GA 1XA0A 1LXCA 4JGIA 1JQEA 1WCWA 1Z6XA 3GN1A 4ITVA 3WL4A 2ZRLA 1I6UA 1FYDA 1NI4B 2R7AA 5LNK6 4O1MA 3DF7A 1TO6A 1ZOOA 5E7JA 4L5CA 4MHTA 1Y1VG 1CJUC 1TWCA 5BR1A 2ZWOA 1NI3A 3GX1A 3OT5A 4NPAA 2RHTA 4W6QA 5A0FA 5I7VA 2C2OA 1TW3A 2BCEA 1TFUA 2OY0A 4GW3A 1L5NA 3ZHQA 1TVKA 2OHFA 1K3FA 2IIBA 4L51A 4Y0VA 3ANNA 5AI4A 3E4DA 4ENWA 4QLBA 1Z88A 5A3QA 4UEKA 1C14A 4BV9A 4KXUA 1T1RA 4G37A 4OJKA 3PK0A 4CMKA 2H1IA 3BFKA 2YJNA 3IKVA 4FMCF 4GZMA 4OBBA 3HCCA 1CX9B 1DO2A 3DV0A 1YA6A 1V16B 3VDQA 1R6DA 1HI9A 4UOQA 2E6UX 2GYVA 3NGMA 3G2OA 4Q4LA 2Q41A 3AINA 4EHAA 3QKRB 4LF7H 5FD5A 5BN1A 3HM9A 3AUYA 2GRUA 2E4AA 2Q6IA 3LWDA 3NIDB 4YJGB 2WQ6A 3U7HB 1E2GA 5JAHA 4QM7A 5EGNA 1CUUA 1EMDA 1U81A 1SCAA 2P5YA 3A10A 1J2TA 3T9DA 3RI3A 4BECA 2WKQA 5JRJA 1J0XO 1PJCA 3JR7A 4PPGA 2PQ2A 2JEYA 4N0QA 4PR0A 3C7KA 4WZZA 3E8SA 3TKAA 2UUCB 2IF0A 1IPEA 1JYEA 5AHOA 2PSEA 4CIAA 3BTVA 3L9XA 4FMCB 2FI1A 1USGA 1Z4LA 2ID7A 4MUXA 3EPHA 1PVOA 3MGKA 2IPXA 2PGXA 5TVKA 3UUWA 1U7UA 4EB6A 4E1VA 2FMKA 5DTRA 1I4EB 4I4LA 2IPOA 1RRCA 3GDHA 1K7FB 3H2IA 1GGEA 3ABOB 5JJ5A 2WK5A 4EEZA 4CFSA 4G5RA 1QONA 4JS0A 1Z15A 4JUBA 4MA0A 5JYEA 3G2NA 5BPHA 4AULA 3MG9A 3AR8A 2VSYA 4X66B 3UKOA 1J8MF 1N6RA 1P74A 2ARKA 2C88A 2Y71A 3MGBA 5FH9A 4US0R 5DCUA 4INPA 4CR7A 4PHCA 3BD9A 3T3PB 1ZGBA 5I8WA 2G28A 3DTNA 1NLFA 1NR1A 2CLKB 2HA6A 1BROA 1K0UA 1SPBS 2NYRA 4M4SA 5K99A 3UMBA 2VUSA 4N7BA 3D6TB 1Z26A 4LGMA 2WAOA 4ZQFA 3QU4A 4AWAA 3H5VA 4L5IA 5TIIA 4TQ9A 1J5EB 5EWGA 3VH1A 1Z74A 1NI5A 1WH2A 3D5TA 3KAPA 3OPMA 4B84A 4ETWA 4C7JA 2IY7A 1MX3A 3U17A 4LNUA 4RH3A 4XSVA 2PKWA 1OFGA 1WXEA 3ECAA 1RXYA 4TYYA 4IGIA 4RB1A 3BGSA 4TMFA 3CVZA 1GM5A 4YMGA 4HPWA 1YONA 4PWYA 4Y9TA 5CDHA 4RNNA 4FXPA 3OHAA 2CFCA 1CY0A 1QCCA 3WC4A 2AOUA 2R8PA 3AEQA 1QV7A 4N18A 4BQSA 5AW1A 3LM8A 3PXGA 3IG0A 5EHQA 3W4KA 2NUPB 2FF7A 5IUKC 4X60A 2IEBA 2OAEA 2DQSA 3B20A 1H0RA 4C07A 2W6MA 4XFJA 2V4ZA 1NNUA 3EMBA 3IEPA 3PIIA 1NU6A 3T0IA 2VUUA 3OZWA 2R6ZA 2WWXA 2ZB3A 2WTEA 4TOIA 5JC1A 3L0GA 2PX4A 3O74A 3TVTA 3AFNA 3WWJA 1N3LA 4B7AA 1SXGA 2ZRPA 3JQRA 4U2DA 1CETA 4HF7A 1UFOA 1EGQA 2ZIGA 5IJ9A 2FDCA 4I4NA 2GCIA 3FSJX 4Z4GA 1GLNA 3I4FA 5AI8A 3OOYA 4EOGA 3G5MA 1QRDA 2W8BB 1VHQA 3WBFA 1NVGA 2O2YA 3TLBA 5IULC 4RZ2A 3GPLA 4QHYA 3NT2A 4HAWA 5TQ0B 3URKA 4YQYA 3KBOA 4BB6A 2QPAA 3SS9X 3KDAA 3UJ3X 3I04A 1HFKA 1M6WA 3AL2A 4DA0A 4L75A 5C5IA 3ERCA 3RKRA 4D4KA 1XMQB 4EQ6A 3G2JA 1JNXX 2PYZA 4UCOA 3KPVA 3TRFA 2IPMA 3TUJC 2FAXA 2IZ7A 4W82A 1NF8A 3HP7A 4AMGA 1XELA 4A6PA 4IZ6A 3B2EA 3K9NA 1KTIA 3HFJA 5J2UF 1MAWA 2BUBA 3NDIA 5TVGA 4DG8A 2P8SA 1NC3A 2VHVA 1SURA 3R6DA 4R54A 4L5BA 1P17A 3V48A 4EBFA 1RAFA 5E1DA 4TT3D 3WNCA 2CLHB 4X1OA 4YMTA 1FQJA 3TTXA 1W581 5HWSA 1KI8A 2XT0A 1RMTA 4MRNA 1EDEA 1PN3A 5BQPA 3OJFA 2OT3B 4DSUA 2Q3MA 4AU1A 3X0DA 3RVDA 1YQUA 1RZVA 3RF6A 1GCAA 3B60A 3K96A 1ZK3A 2JFZA 3CY6A 3Q8XB 1FTGA 1MEEA 2GQRA 3U7FB 4Q00A 1J0BA 5JATA 3GLHA 1NFFA 4MUHA 1QGYA 4PAWA 3X1XA 4KPYA 3P8ZA 1E2MA 3KSDO 1A76A 1AZWA 2AC4A 4AO8A 4DWJA 3H3VH 1D2HA 2EF0A 3TQTA 4F5EA 2FETA 1Q1GA 3JQGA 1KUTA 4RIFA 1SBZA 3I2KA 4W1PA 3T5GA 1GAQA 1XTPA 2AQIA 3N39C 3QI7A 4EEXA 2QL7A 1CC1S 2D4AA 1ODSA 3NKLA 6YASA 3ROZA 4EYHB 4O3FA 2W71A 5GONF 3TSCA 5I6DA 3L0OA 3BXHA 2J0FA 1X92A 1YVDA 1DJQA 1U90A 4LHEA 2W0SA 4F60A 2EIYA 3FPGA 3JWPA 2NU7B 1BFUA 1DQNA 4CMAA 5DN6D 2R60A 4XJXA 1DWPA 3HV0A 3EXG1 3R9XB 3LUJA 4J7XA 3BMNA 3N0VA 3JCZA 1XI2A 3P5SA 3D7SA 4KV9A 2PSDA 1TF7A 5K0GA 1QXSA 5KI6A 5KZMB 1ZCJA 1JPJA 4KO8A 1GGFA 3C70A 4H27A 1M8PA 4L5YA 4R83A 1KAOA 4A0FA 4M1ZA 4OHPA 4UHHA 2B8NA 4GKBA 2ZUWA 3V33A 3PFBA 4CLHA 2YQ5A 2OH2A 2QLJA 1EGMB 4DLVA 1Y37A 1YTLA 2CWDA 1AUXA 1N32H 1M2OB 3AY7A 3IUNA 3FAZA 1KEUA 2DHDA 5EQDA 2YQ4A 3KSRA 1US8B 5DQHA 1Z8NA 5D85A 4CFYA 2HGXA 2KYRA 2W4QA 1VIVA 1GNTA 2GTPA 3JSXA 3IHKA 3PQDA 2HHCA 4MIKA 1KOLA 4CKEA 4WD3A 4DCMA 4LF8B 3ABIA 1GUYA 2XHEA 3SBEA 3ABSB 3F0TA 2G1UA 4MYRA 3LS2A 3ETRC 3G8YA 4JNCA 4TT8A 2WMYA 3LQ4A 4BY9E 3HKZE 3C7CB 4FFDA 4M38A 4EY4A 3ILHA 4LC9A 4RV4A 2IE8A 4BBZA 5HTKA 1BXZA 1N6OA 4PLTA 4TS4A 5DHTA 4E22A 2C42A 2VJAA 2QXTA 1CEEA 1Q81J 3UM9A 5KG6A 3AHGA 2IUSA 2JFXA 4E5MA 3HG7A 2WY2D 2B1GA 2HDNB 3GCZA 2XF8A 4MZDA 3I8XA 4ACBA 2F9LA 4MVJM 5BWOA 4RZRA 2XT6A 3B2QA 1IBLB 4FBTA 3DCYA 2HO4A 4NJMB 4HT3B 3INNA 3VNRA 1OH5A 3KR1A 1E69A 2VI5A 1YFJA 2M6LA 3KLMX 2UVRA 2ZAIA 3A36A 2XH8A 3BB4A 4G0YA 1OSNA 2OG2A 4IXTA 4X8OA 5A05A 3V1LA 2ZJQJ 3OJWA 3NXKA 1I7LA 3I9MA 5E4YA 3DUFA 5BYKA 1R66A 5KKCA 4CEHB 2V65A 5FFNA 4DCUA 1GNVA 2WTMA 4RNCA 1NAHA 4WK6A 2ONJA 1SYXB 2JCSA 2VRBA 3ELDA 5I4CA 1ACMA 2H16A 2PANA 3FNFA 4MEBA 5ES4B 3O94A 1QAMA 5I51A 2ERCA 3MJEA 4LHXA 1JMVA 5KNBD 1KK0A 1XQ1A 2Y1FA 1XAGA 2E7ZA 3GLTA 2G82A 4BEBA 5KNCD 5JHHB 1SCUA 3CZPA 2BJHA 4WXYB 1A27A 2HX1A 2HEGA 3ZHZA 3AF6A 3WRYA 2QNIA 4UM8B 1FSGA 1O5IA 3AIKA 3WNZA 2MYTA 3CEPB 4G9GA 3U31A 1V39A 4ZRMA 4U39A 3C6KA 1ANKA 4DLAA 3I5UA 1JQJC 4LX0A 3BSSA 5BRAA 2FUCA 5HPYB 4CEIB 2QAGA 4YDHB 4PZCA 3GCXA 4V0SA 4LAFA 4XB1A 2JASA 1ZOPA 1RTTA 2H2GA 1N2ZA 4F93B 3G2KA 2R2GA 2WPDA 2XOKA 1B15A 1E8MA 2ZB7A 3IP3A 2C97A 4GLOA 1D2CA 1C7QA 1MLDA 2F3QA 2ZTUA 3N0WA 5AESA 1MA3A 5F7XA 2YZMA 2I2FA 2E4UA 5FTKA 2CL6X 2OXIA 2YIDA 4RCZA 4J9PA 4TWRA 1K08A 3ZWWA 4D8VA 2E3JA 4PEVA 4TS3A 1F5SA 1YNSA 3ZV3A 1M90J 4ND4A 3WLRA 4EWLA 3PVSA 1PVVA 4ZIRB 1E92A 1WV1A 1TW2A 4I9FA 3RTEA 1F1BA 2J41A 2QP9X 4JI2B 4UFZA 3Q6IA 4UCWA 3O83A 1XEAA 4R7ZA 2QPOA 1NONA