3VMMA

Crystal structure of bacd, an l-amino acid dipeptide ligase from bacillus subtilis
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
471
structure length
471
Chain Sequence
b'ERKTVLVIADLGGCPPHMFYKSAAEKYNLVSFIPRPFAITASHAALIEKYSVAVIKDKDYFKSLADFEHPDSIYWAHEDHNKPEEEVVEQIVKVAEMFGADAITTNNELFIAPMAKACERLGLRGAGVQAAENARDKNKMRDAFNKAGVKSIKNKRVTTLEDFRAALEEIGTPLILKPTYLASSIGVTLITDTETAEDEFNRVNDYLKSINVPKAVTFEAPFIAEEFLQGEYGDWYQTEGYSDYISIEGIMADGEYFPIAIHDKTPQIGFTETSHITPSILDEEAKKKIVEAAKKANEGLGLQNCATHTEIKLMKNREPGLIESAARFAGWNMIPNIKKVFGLDMAQLLLDVLCFGKDADLPDGLLDQEPYYVADCHLYPQHFKQNGQIPETAEDLVIEAIDIPDGLLKGDTEIVSFSAAAPGTSVDLTLFEAFNSIAAFELKGSNSQDVAESIRQIQQHAKLTAKYVLPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanine-anticapsin ligase BacD
publication title Structural and enzymatic characterization of BacD, an l-amino acid dipeptide ligase from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Ligase
total genus 140
structure length 471
sequence length 471
ec nomenclature ec 6.3.2.49: L-alanine--L-anticapsin ligase.
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13535 ATP-grasp_4 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3vmmA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3vmmA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3vmmA01
3.90.1170.60 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Aldehyde Oxidoreductase; domain 3 3vmmA04
4M98A 1GSAA 1DV2A 1DV1A 2W6NA 4EGJA 4FU0A 4O7SA 3MWEA 5BPFA 3VPCA 2YL2A 4YJ3F 2Z04A 5BPHA 3E5NA 3HBLA 5LA6F 4MV9A 4YJ2F 3TW6A 1JLLB 1I7NA 1KJ8A 4MV3A 4MV1A 1JDEA 3BSYA 5LXTF 4HNVA 4O86A 3Q2OA 2GPSA 4O4IF 3JZFA 2GLTA 1CE8A 2W70A 1A9XA 2HGSA 1KUTA 2R7NA 3KREA 3NUAA 4MV4A 5EZYF 3GLKA 3N8DA 4O82A 3G8CA 4C5BA 4O4HF 1M0WA 1C30A 1KJIA 5D8DA 1E4EA 4I4TF 4O7TA 3K5IA 1M6VA 5LP6F 4XX0B 2OLSA 3WNZA 2YYAA 4IHJF 2ZDGA 2CZGA 2R7LA 3ORQA 3U54A 2FPPB 3U9TA 5C1OA 3BSSA 4EA7A 5K2MA 3TINA 4O4LF 3RV4A 4ZHQF 2FPIB 4C5AA 5LYJF 2GQRA 1B6SA 3MWDA 4O81A 4FE2A 1KJQA 2QF7A 1BNCA 4FFPA 2W6PA 2DZDA 4M9CA 4XYMB 1OBGA 1Z2NX 4EA8A 2CQYA 5H80A 3MJFA 2R85A 1KEEA 4WBNF 5HV6A 3KALA 2CNQA 5I47A 4O4JF 1W93A 4EGQA 4DIMA 3LWBA 2ZDQA 3HO8A 2YZNA 2W6ZA 1B6RA 4YAJB 3UFXB 4HR7A 4GGMX 1ULZA 2W6QA 4FFOA 3RFCA 2YS6A 4O7RA 3V4ZA 2NU8B 4O7VA 1I7LA 4I55F 2YS7A 2FPGB 3SE7A 2C00A 2GPWA 2V59A 3VA7A 5JQGF 3JRXA 2I87A 4FFMA 2YW2A 3WO0A 1WR2A 3VPBA 1KJJA 4TUYF 2R86A 1IOVA 4EA9A 3KAJA 2NU9B 1GLVA 2YRXA 4YBZB 3G8DA 5DMXA 4MAMA 4O7NA 1JDBB 4C5CA 2SCUB 1EHIA 3V4SA 4EG0A 1DIKA 2FP4B 4FGRA 2R6FA 2R87A 1SCUB 1KBLA 5J2TF 2YZMA 5J2UF 1E4EB 4MV8A 3R9RA 3BG5A 3Q1KA 2R82A 5JVDF 5JQWA 4EAAA 2ZDHA 4MA5A 1KC7A 1AUXA 4EABA 3JZIA 1EYZA 1Z2PX 3U9SA 5CAEB 2X0SA 3WO1A 2XD4A 5IYZF 2PVPA 4IZOA 3ETJA 3GIDA 3R5FA 3KAKA 2NU7B 4YAKB 1IOWA 2YRWA 4O7LA 4NYEA 2Z02A 2DWCA 4YB8B 5JH7F 1AUVA 5CA0F 2NUAB 2VHEA 4FFNA 1VKZA 5KKNB 2VQDA 4ZI7F 2W71A 3ORRA 4O2BF 5CB4F 3AW8A 2YWVA 1CQJB 1EZ1A 4XYLB 4L1KA 4HQ6A 4IWYA 2P0AA 3RUPA 4O7WA 3VPDA 2R7MA 5BMVF 2YZGA 2XCLA 2WYOA 5C8YF 4O7ZA 3AX6A 4TV8F 3U55A 2VR1A 5JVLA 3BSWA 1CQIB 5C1PA 3DF7A 2CNUA 1Z2OX 2VPQA 5LOVF 4ME6A 1PK8A 1VBHA 5KX5F 2CNVA 3JRWA 2PBZA 3R5XA 4O7YA 1BXRA 4MA0A 3BFPA 3I12A 1CS0A 1UC9A 3VMMA 4M9UA 2GQSA 4O2AF 2DLNA 1GGOA 2DIKA 2V5AA 1GSHA 2FB9A 3R23A 1JKJB 5CA1F 1EUDB 1OBDA 5HBRB 3OUUA 2W6MA 5GONF 3ETHA 4HNUA 2YZLA 4IIJF 3TQTA 2R84A 4MV7A 3VOTA 4O83A 2J9GA 4O84A 2PN1A 1PX2A 3K5HA 3TIIA 4IWXA 4QSHA 4MV6A 3K3PA 2V58A 3QFFA 3OUZA 2NU6B 2I80A 1EUCB 4M99A 1UC8A 1M0TA 4I50F 4Y8VB 3RV3A 4ZQIA 3HB9A 3TIGA 4HNTA 1C3OA 1T36A 4E4TA 3R5HA 2R7KA 4TV9F 4J6EA 1VBGA 2HJWA 2W6OA 4FFLA 2QK4A 1A48A 4WD3A 1GSOA 2I8CA 4ZOLF 4XZ3B 3LP8A 4FFRA 1KJ9A 3N6RA 4DLKA 1W96A 2IP4A 5FNVF 4RZQA 2NPOA
chains in the Genus database with same CATH superfamily
4C0KA 1R00A 1YZKA 4IJMA 2LKCA 5TJ9A 1ZD1A 1V9LA 2PKXA 4IUCS 1J2RA 5E7MA 2OB2A 1ZHHA 3EZLA 4UAGA 1WB9A 4JSTA 5BW8A 4C7OA 1JHAA 3JZFA 4JJ8A 1LWNA 4KL8S 3H75A 1GQ2A 2OECA 4GBJA 4BE7B 1FFWA 2EZ9A 4E07A 4BGIA 3CCVH 2SICE 5EZYF 3F8WA 2Z2XA 4FPXA 1QS0B 4HPWA 4OXQA 4RUAA 5CEFA 4FEEA 1YVRA 5T67A 4LQDA 121PA 3USCS 5T14A 2R6GA 4TWAA 4I4NA 4Q1EA 3QNUA 4ETIA 5DQIA 1VE1A 5EXEA 4F92B 2VDNB 1GFSA 1DTWB 4OX9H 1DUIA 1O95C 2UU9B 4NNJA 3QFHA 4BATA 4UPEA 3ND7A 3VKWA 4IXTA 4RA6B 3B13B 3O74A 1KDVA 5DBOA 1M1KJ 1NW9B 2XBMA 3ABZA 3T3PB 3ZQ4A 3R6WA 2BGJA 4HWKA 1LH0A 4U7GA 5AVYA 1TF2A 2EERA 1U3GA 2W6ZA 5ALIA 3DFKA 3K20A 3PENA 1JAYA 1PW7A 5LL6b 1E61A 1FP7A 1CEEA 1QHNA 1UWLA 4B3SH 3MRTA 5J59A 3KSUA 5B5SA 4FC6A 1W9HA 3PGVA 3MWEB 4KNWA 4RLFA 3TS1A 2GPWA 4IG4A 4PYMA 4C03A 1U28C 4H6PA 4NCIA 3WGZA 3C98A 1T8YA 1XHEA 5JXGA 1JDTA 4D4HA 1RM6A 3A26A 4F86A 4AZTA 2GYWA 3MJHA 4U2GA 1DHTA 4DV2H 2V7UA 3C6QA 1AC5A 2DPIA 2O0JA 1JRLA 3TAHA 2ZBRA 3IOMA 2QV7A 3B7GA 3BMQB 1Q44A 3X2FA 1P9WA 2LP4Y 3PUIA 4BNUA 1XVLA 4NJOA 3GIKA 3KQSA 1Z9BA 2JBAA 1W0KD 4FGUA 4Y0AA 1NV9A 1ANKA 1J8DA 1JEYB 2G6TA 4P3OA 4LZJA 4XXHA 4RY2A 4HEA6 3FBGA 4LCJA 1R5BA 2UXBB 5H59A 3T5KA 3SSMA 4UAJA 2IUTA 4JC4A 3DYBA 4FS1A 3HC7A 3A9SA 1OBCA 1R0YA 3P2IA 3H13A 4GPTA 1AKMA 1J97A 1HNXB 3UK7A 1DB3A 3IMFA 2OD9A 4INOA 5GQSA 1IHUA 3H4VA 1TZ2A 3UJAA 3PT5A 3K4QA 4FFBB 5I9IA 2RF4A 4R3UC 2PY6A 2PV0A 1MNQA 2BFPA 3BL6A 3PF9A 4C0XA 1UQRA 4BB0A 1XK6A 4QOSA 1NYTA 4OHWA 4F8JA 2IBTA 4W5NA 2E49A 3QEMB 5SY9A 3KOOA 3IXQA 3AB7A 2IYRA 2Y4NA 2IF0A 3OFJA 4ZCQA 1K27A 3HR7A 1FP4B 2H4WA 4MYRA 4X94A 1RAIA 3AERB 1TYCA 5AOAA 4CV3A 4K05A 1N1GA 2WIJA 5TR9A 4TL7A 2O19A 3KTAB 3RVOA 3HDQA 2V8BA 3EUFA 4OREX 4PFSA 1G2WA 2QB5A 4UHHA 3WX0A 4L5CA 5IFLA 3TAUA 3K8ZA 5HJEA 1FFUB 1J49A 1Z35A 1SHLA 3TZKA 3PW7A 1ZRHA 1OY1A 1PRYA 4R2XA 2I99A 4LTDA 1QF6A 3H1PA 5EFOA 3VR2A 2HPVA 2O3JA 4MYTA 1IL0A 4EZBA 3DVQX 3D3EA 1KYQA 3ZH9B 2R8JA 4LF4H 1IPHA 2NPFA 4BVLA 2JFUA 2VP0A 1XDGA 2H11A 2QAGC 1GPUA 5KG0A 5HRCA 5KPDA 4CHGA 2AFIA 3GK3A 5G1NA 3JWGA 1U11A 3GTMA 4OUKX 3DEHA 1VKOA 2Q1UA 2FZLA 2EYQA 2R92A 3FR7A 2VL7A 1B41A 3WGYA 5HMLA 4RNMA 3W2FA 2AD1A 1ZZGA 4CPDA 3RQSA 1D1SA 3CLKA 3JV7A 1K1EA 3DKKA 4LFAB 4IXMA 2EEPA 4KK3A 2FKLA 4MTCA 3W5UA 2IH5A 1LPMA 3OFSA 3AY7A 4JLUA 3BQ2A 1QTRA 4B3GA 4H31A 4PVDA 2Z4TA 4G9GA 4NYJQ 1UXIA 1QG4A 3I9JA 2ZIEA 2CXSA 1KIMA 2J3EA 4PLGA 5JHGB 3MERA 3G8AA 1YJ9H 1KGSA 3OD5A 1KKUA 5D01A 4BKRA 2JDID 1G6KA 1BEZA 4LGCA 2GZHA 4FONA 2OOSA 2E85A 3DBLB 2B0CA 2LKDA 2HT1A 5FUMA 3Q9SA 1UJ6A 4W1RA 2IWRA 1P33A 2MSNA 1KAHA 4YJGB 3CLSC 4DEYA 4ARZA 2YBDA 3AVYA 5HQTA 1UBCA 4TRNA 4DDUA 1DAAA 1DQRA 2GZAA 3MUOA 2V59A 3HDYA 4NCAA 4C0BA 1JBQA 2NVWA 2IYNA 4G8DA 3MQFA 1C81A 5L9AA 3E81A 2IOYA 3GVHA 1PWEA 2RGEA 3OTWA 2CUTA 3WAJA 2RC6A 1QK4A 2WUVA 2UZ1B 3ZH2A 3QUAA 1J8MF 4DV7B 1L9KA 1D1TA 1N2BA 3ZD9A 4MUAA 1X80A 2GK3A 4CIVA 1SCUB 4D0GA 3PW0A 3M2TA 3RWMB 1PTKA 1XL0A 4TLAA 3CQZA 4Z99A 2CHGA 5C7IO 4MWEA 2BDTA 4J7UA 1L7BA 1UFQA 2WIFA 3RYCA 3WYBA 3P9IA 3VH1A 4JYMA 2C0QA 1WF6A 2NZVG 5KTPA 3U9SA 3QLTA 2IXTA 2HPHA 1BIFA 1E7SA 3BD8A 4MZDA 3FKJA 4LOJA 4TN1A 1R4MB 4FYYA 2P8SA 2Y2VA 5BQ5A 4ZAFA 3VSDA 4BBPA 5CB4B 3K6SA 4CW7A 3KEFA 5B1YA 1Y1SA 1D2RA 1YZQA 5KNDD 3D81A 3P52A 4GM1A 1JQEA 3QVTA 4OTZA 1O97D 1P72A 4QU5A 3G9UA 5JZOA 3P4UA 2H8GA 2REQA 1V9PA 4CHTA 1U2SA 5GJWC 1ZOOA 1YA8A 3STVA 2A33A 5A2QA 1VQ6H 5JNTA 2O8EA 4CM5A 4NBTA 1Z07A 3MRVA 4C7XA 1I6WA 5EUCA 1IY0A 3FPKA 1XDDA 3W5DA 2V65A 3ITNA 4JNKA 1GD1O 4AYBA 1M73E 4ZFNA 4S1NA 1PJTA 4V1CB 4WHXA 2GARA 3C0FB 1I24A 2H2HA 1HR0B 1A4IA 1NL3A 3I9V1 1XKTA 3PC6A 4HNAB 4RJIA 1WNTA 3B53X 4QEZA 1A96A 1N2XA 4HNUA 1TAUA 4PC7A 3TLZA 3TOXA 2DY0A 1FIUA 4E1VA 2OCLA 4K6NA 4KRXA 4NYIQ 2HLHA 3CRZA 2EQBA 4IUDS 3TI9A 4YRCA 4ENWA 3IKVA 4OQFA 3P5BA 3EW7A 3M6AA 4RPLA 4RVNA 3T4XA 3NGLA 4Z0NA 4MQUA 4ITUA 4AP9A 1PNVA 1DE0A 1LVGA 2Y71A 4RF4A 1YQWA 3JQAA 5E1BA 2JJ2D 2ZI6A 1G21E 1SBIA 1VL0A 5L7YA 2EBWA 3AUAA 2HMUA 3OZCA 5BWLA 4AM8A 4MEBA 3LXRA 4YN3A 2C2OA 1IBMB 1NF2A 3OIWA 4B3BA 1A97A 3COSA 2Y77A 1CY2A 2FWMX 2YL2A 2XEXA 1A98A 4X93A 3K1AA 1JLLB 2LE0A 3UG7A 2WIAA 4FNOA 2RGGA 2DPLA 3TZ6A 4O86A 1GKIA 3NBQA 5IBPA 5LLDA 1ISGA 5I5TA 4YMGA 4DEVA 4RKEA 1RBYA 2VDUE 4GX0A 3D59A 5FBQB 4MS3A 2ZT7A 2XB2A 4RKRA 4FJ2A 3X1WA 3D8BA 4HDAA 3X3HA 4DA6A 3PZRA 1O9BA 4L2IA 4XVUA 2W6ID 4FZ5A 5DXAA 3BD6A 1WCWA 1ZM2A 1IXSB 3DE1X 4QDTA 3D2BA 3CX7A 1NVWQ 2VYVA 2YJ6A 3DDHA 3KSBC 3D43A 2YH2A 1UUFA 2EJCA 2D4AA 3VDNB 2Z95A 3I6ZA 2X2FA 1GGJA 4OGKA 4M9CA 4YRKA 4DUYH 3DLTA 1GGNA 1UPUA 3OOJA 3LWBA 3B6MA 2AOWA 4J0CA 3WRXA 2H2IA 1LQUA 1YDGA 4BDSA 3QZ7A 2ZYRA 3EHDA 2JFNA 1I2ZA 4GGMX 1HLPA 2IH4A 4FMCB 4L5AA 4TM8A 1H2RS 4FCVA 5BWNA 1WY5A 3UFBA 4U2KA 3PFFA 4FBTA 1Z45A 2C4WA 4TUYB 5KFWA 1SU4A 4BUZA 4MDYA 2QA5A 1JQJC 3FTPA 1YBAA 3FSRA 2WU0A 1EXVA 3DHVA 2HK6A 2HF8A 3B9JC 3F49S 4R2LA 3HI4A 4QWEA 4LF6B 1VE7A 1XNJA 1U2TA 1TKBA 4EFLA 3IPLA 2QRVA 1IB6A 1C30B 4Z51A 5CE8A 3KQVA 3QF4A 1YV9A 3H2ZA 4M9ZA 1CJCA 3ELDA 1BWQA 4HFMA 3SIPA 4X65B 3ASUA 2M9MA 2O3TA 1DBVO 4I3HA 4WUVA 3FB1A 4P81A 1TK2A 5TY0A 1BHO1 4KR3A 4IH1A 1DC4A 5CXSA 2FWNA 5GOTA 4GKVA 1OAAA 3JQBC 3PUJA 5A02A 3L0OA 1XCJA 1E9AA 4MZXA 1ZITA 4BRWA 2AKEA 1J5PA 3MCZA 2XUKA 2CW8A 1TU3A 4P4SA 1H0KA 1MC5A 5LMNH 4AJOA 5A3VA 1F14A 3QZUA 2WYIA 5FUBA 4DDMA 1O03A 1T2VA 3UJ6A 4L0MA 2IHBA 3OIDA 1RM0A 1JX4A 2QI9C 1I3CA 1IBKB 1G16A 1ZP6A 1U0GA 3G6EH 5JWRA 4AKEA 4EB8A 4DQKA 3AUUA 3I9NA 5KJ1A 1J5XA 1BE0A 5DHQA 4HDRA 2YFKA 4WASA 3ENVA 3AUYA 2HQOA 4HPXB 4KQMA 1WE2A 4XA8A 2R8YA 4F4IA 1QAPA 1A8UA 4J3JA 3KYBA 3GLVA 2YNMD 4MAFA 2DPMA 2IYAA 4FXOA 3OETA 3ZK7A 2OV3A 4Q48A 3CWCA 2VHTA 2ZIFA 3H9CA 4JELA 5AJXA 3VOTA 3CIFA 1H6CA 2NU6A 5E0OA 4M8IA 5FTLA 4G3XA 2OSBA 5FBLB 4CTNA 3AT1A 4OXRA 2ZTVA 1T2NA 2FY8A 3DCYA 4IZ6A 1B43A 4C21A 5DXFA 3GLHE 3EZ9A 1EFAA 3IBFA 5C8XA 3MG9A 4P7FA 4URZR 1RKQA 2ZWVA 5GV8A 1RI4A 2JBMA 3L0ZA 4UUPA 3DL4A 3CFYA 3OIVA 1I4WA 5CGZA 3OTOB 1T6NA 3DFMA 4YAJA 3O90A 5DF1A 3LO8A 4FZJA 4HLCA 2QVXX 4B2YA 4EGJA 1WU7A 3V7FA 3Q0IA 3T15A 4Q1FA 3TUZC 3AETA 2D3WA 2P9QA 1DL5A 4HT3B 1VIMA 4OSEA 3RC8A 3AVTA 3U3XA 4E4RA 4LJ9A 3FF1A 3D4BA 3SC6A 3IESA 1JIJA 5MN4A 3URKA 1JWBB 3UXYA 3RHTA 2HRQA 4JP3A 3IA7A 3ROEA 3I34X 5AI5A 3HHEA 5ER9A 4KWIA 2JFBA 1U6JA 1A5ZA 5KOIA 3FOWA 3C14C 4DLXA 4WPGA 4B81A 1AZTA 3OP4A 2Y1EA 4RTSA 3QVMA 4HGYA 8OHMA 5EHQA 1SIBE 4O59O 3DM9B 3H16A 4ZK2A 1JJVA 4IDNA 2XA2A 1CKOA 1TYZA 4OKSA 2IYEA 2XA9A 3C1AA 2DPJA 4A0QA 2JI6A 1KEEA 1U7UA 1UPTA 2H7YA 4M86A 2CCJA 3A6JA 3QX8A 1NBMD 4OQLA 5AMXA 4PLPA 3EGCA 4L3OA 4RM3A 4LJ8A 4XSGA 3OJWA 4B7UA 3LT0A 3JD2A 4KVAA 2DE0X 3K1YA 4Z0PA 5DNVA 4J94A 3HBAA 2QTNA 1YVPA 1D5CA 1D8TA 1C41A 2Z1DA 1EI9A 1XX6A 3KQHA 3MCWA 1LPNA 3A10A 2VYQA 1IZYA 1HM5A 1PT6A 2Z2ZA 3EIEA 3RANA 5IP7G 1CUDA 4JLNA 4MUEA 4RY8A 5ALKA 1C29B 1M2JA 4ALMA 2A9QA 5HVNA 3BG5A 2BLNA 5FV7A 1U94A 2HEIA 3N41B 5FTMA 4AECA 2QL9A 1RHQA 1TZCA 1CDOA 3OH8A 4JYBA 3IYLW 3W4KA 4H1UA 1XELA 1MZVA 1SB9A 1O9GA 3WB1A 3UH0A 3HB4X 5CRIA 3CJTA 2H59A 1ZY2A 3EWAA 2QYHA 1ZXLA 2VYND 2OYRA 2D1QA 3PEVA 1AXEA 2VATA 3GGDA 2ZB4A 4CT5A 4MDHA 1G20B 4J7AA 4DWWA 5LXTB 3Q8PB 1K3UB 2RHHA 4U39A 2A5DA 3ETGA 2CD7A 3SYTA 5EJMA 3JTMA 2VUIB 1CS0A 1TZBA 1Z6ZA 2BI7A 3DH0A 3EQ8A 4ZI3A 1N34B 5EPUA 2CFRA 5KTNA 1UOQA 3MJ4A 1NRXA 4AZWA 5EWMB 3A27A 5CVDA 4EADA 5FPYA 5A5DA 2QENA 4LXXA 3RPFA 1JJBA 3CTPA 5CHEA 3PE3A 4DLNA 3CUYA 2V7QD 1YJXA 1W48A 2PMKA 2NMVA 3K3PA 3IUBA 1F06A 4BMYA 1E1NA 3HWSA 5LMUB 5BWRA 2ZXFA 3HVRA 3GJZA 2Z9CA 4HGNA 1DI0A 2ZUBA 4AUKA 1KMMA 4D6YA 2PR7A 2O3RA 3IT3A 1DMRA 2CXUA 3B7PA 4A8JB 1HNWH 4TPKA 3TW8A 1JJ2H 3OVMA 5AIBA 4KHPH 2GDZA 5HRUA 1Z4NA 2R751 4G0XA 1M75A 4A2QA 1MVLA 4WCFC 1PSZA 3GHYA 4O0LA 1U9CA 1YB1A 1JPUA 3H2GA 3FWNA 1PR6A 4YR7A 3GQCA 4K9LA 1TUEA 4PCAA 1QFZA 2QGNA 2P9CA 3NALA 5AI6A 1TM2A 2IE0A 3A7EA 4AKGA 5JCOA 1RYDA 2GYYA 4L8LA 4DA4A 1GJRA 4JGBA 1JQKA 3QMPA 5L3SA 4R3WA 1MABB 3KR0A 1CJVC 2Y6VA 2VRCA 3FCSB 4A2AA 1X7WA 5A9RA 1YF3A 4WK4B 2LV8A 6REQA 4UBLA 4X8MA 3DEJA 4LWPA 1ZUD1 3CKYA 1QFJA 1ZFNA 1F8XA 4XRRA 3Q15C 5JCZA 2PR2A 5JRJA 1I7PA 3NOOA 2VKTA 1QC5B 1M66A 1T5TA 3ORQA 3U54A 4MGIR 2Z09A 4EB6A 1R2QA 4PZUA 1FW8A 1NLMA 4BNJA 4JJ7A 1DO0A 3ZHSA 4ON9A 3GD5A 1GYPA 4L8WB 2NQTA 4TVSA 1NRWA 1F5SA 1N2OA 3NHYA 1I33A 1EA5A 1KIFA 4OIMA 2IEZA 3UJDA 3VJRA 1V4YA 1OBOA 3Q8WA 1GFWA 1Q77A 1C0KA 1YTEA 2XUJA 4HK4A 2PRKA 4FR0A 3A6EA 3T5MA 1OOEA 4UUAA 1P0FA 4CQLB 1GTL1 3P9XA 3K31A 2P27A 3T7JA 5K3CA 2GPTA 4MKIA 4J3FA 3FNGA 1G7RA 2D62A 2GKGA 3FYSA 5BUCA 4Z3OA 1QV9A 1S0NA 5HF6A 2VF8A 3IODA 2O8CB 1YFZA 4I1YA 4J03A 3AINA 4RCVA 2HU2A 1QU2A 1G3IA 2WDZA 1JS1X 1MORA 4R8VA 5EP1A 5AVOA 2NYVA 4KH1A 4IZHA 3DNFA 1Q20A 2XZLA 3CE9A 5KSWB 1HF3A 2ISQA 3I3OA 3IDFA 3NDRA 5D5HA 2E1RA 5FI0B 2ZYHA 3ZNQA 5KYVA 1FW6A 4QYTA 4EHKA 2Q0HA 4ALKA 2REBA 3FTQA 2HEGA 4WK6A 4Q0MA 3RTAA 4ACBA 2UAGA 4JV0A 3NYWA 2WWHA 2YIMA 2X5KO 4DOMA 2D8MA 1NJIJ 4GWKA 3L49A 5BT8A 4QNNA 3T9BA 1QP0A 1VKHA 2C03A 4J9SA 3KJQA 5AI9A 4ZI7F 4JV5H 1CJSA 4XYLB 4CE5A 4BU1A 2P5SA 3AVQA 2X23A 5DM7J 5K3BA 1EK1A 3CXRA 1H2EA 3G88A 1HQKA 2YHAA 4A6PA 5AO9A 2ZJYA 4C29A 1MV5A 2ZJFA 2WTFA 4JYAB 3GZJA 4NE9A 5F4BA 5BNIA 3BMXA 2VPWA 1N5LA 4JT4A 1NZJA 3UQZA 4ER7A 4A0HA 3VR4A 2J08A 5AXBA 2PWAA 4M9UA 2R6R1 2HWWA 2A67A 2HB6A 3NAGA 3H2KA 3FCEA 2IX9A 2VDWA 1OI7A 2O1SA 1W8DA 3R77A 2CXQA 1N7IA 1GCUA 4BO9A 1JG7A 3MWLA 1M10A 3ZS8A 3F4LA 3WGOA 1QPOA 2VPYA 3LCCA 4MWTA 1SKAA 3M4IA 3HXPA 2ZSIA 2VHCA 3V8MA 1WMBA 3T7RA 4NH4A 1NI4A 4G85A 4PRKA 1OX4A 4F85A 3H05A 1CUGA 2RSLA 3KPYA 1PG5A 4YHHH 5EYPB 3PNVA 1GYFA 2WK1A 4Q8EA 3RJ5A 4Q3DA 4DRFA 2CV1A 5TEWA 2J9FA 2H1LA 4RM2A 4JQCA 1F4VA 1GTRA 5I5EA 3T8YA 3ZE8A 2UYQA 4IMIB 1JJ7A 4I9AA 2R2GA 1ILEA 3SMVA 4G0OA 5DULA 4DLLA 3DDSA 3PNKA 1E6MA 5JSZB 4FJ1A 1N9GA 2P1ZA 2H9YA 4XB2A 4AY4A 4HAWA 5MPOC 1U8XX 4P7JA 3SJUA 1E94E 4NMWA 4CNQA 4G97A 2KM1A 3P9RA 2JAPA 3G0IA 2GA8A 3RS8A 3U49A 5HG0A 2XGPA 3BWEA 4ZJYA 1SBCA 2IDJA 1V7PC 1J2EA 3PFGA 2P3OA 3H0CA 4HNQA 4I9FA 4KQWA 4DSZA 1W19A 4CLEA 2E4XA 3HJRA 3V4OA 4DT1B 2OR3A 3DAGA 1A9PA 3PEFA 3QUTA 4N41A 3KYDB 3VC1A 4GZ3A 2FAXA 3DZKA 4UARA 1RWQA 4UC0A 3D64A 4Z0HO 2DHEA 4E5UA 2FPIB 3FYUB 2GEJA 1HTTA 1T5DX 3UT5B 1QTIA 5ICEA 3N3AC 3QQ5A 3GR6A 4H3HB 3MJDA 3MGAA 1DBRA 1FX1A 2JA6A 1K8ZB 5CBPB 1C4OA 3GTOA 1NP7A 4YX9A 3NT4A 2ZRQA 3DMGA 3MMPA 1E63A 4QGFA 3SFZA 2ZJ2A 2O50A 5IJ0B 3T5GA 1SBQA 2MWMA 4JT9A 4O7RA 1S96A 4R41A 4MUNA 1Y6GA 3WP0A 2ATEA 3HZOA 2H1OA 5EJ5A 3Q9UA 4H7PA 4HFRA 4S0XA 3KLPX 1R9GA 1P2TA 2ZBFA 3QYPA 3KQPA 1TQ8A 2FEPA 3IELA 1CRPA 2RGCA 1JDUA 2HA4A 3CZ9A 2ZG6A 3U48A 4DBVO 2ZIVB 1GILA 1RWOA 3QK7A 1VM6A 2HK9A 4RZUA 4FDUA 1ZL2A 1P39A 3RNOA 1EUDA 3HXOA 3I76A 2ZI4A 3FFTA 3Q41A 1K92A 1P6XA 5JEDA 4YJFB 3V42A 3HWRA 5JY1A 2V9WA 4BMPB 1I50A 4UMFA 2R82A 3CZCA 1X7GA 2QU8A 5C81A 5IEBA 2NT3A 2HI0A 1I3LA 4UUQA 2H1FA 2VC2B 3I30X 4Q43A 4F60A 3P94A 4BVKA 4H0CA 5HKAA 2BGIA 3KJGA 3BB3A 3EXHC 4JU9A 4MJXA 1PJCA 5KAPA 2E21A 5EKDA 1EWYA 4QUEA 4D9NA 5K03A 2VWPA 1CQJB 1IQRA 1P9LA 1NVEA 3W2IA 2IBKA 1I8TA 4PAGA 1F0NA 1XZCA 5KQLA 3CLTC 1UJCA 1JHUA 1VC2A 1C7FA 2PD3A 1YQUA 4M55A 2COUA 2A0KA 2D8AA 3ECSA 2XGJA 4LDRA 1WVGA 1G6OA 4DAEA 4BAGA 4W5OA 3GFRA 4HAVA 1FXWF 3A4IA 3WYGA 1Z15A 5FJJA 3MB8A 4KJXA 1G2PA 4LKOA 4AO7A 4Q47A 3Q3EA 3T9EA 2D3TA 2DFVA 4AD8A 3V6KA 2Q2TA 3GQBB 5AK3A 2E4VA 3IQWA 2G9VA 1BU5A 4ZHSA 3EBOA 2DQYA 3PGMA 3PUXA 2PUJA 3ACBA 1JKMA 3WMWA 3GMDA 2P8JA 8MHTA 1L4UA 4PLHA 2D5AA 4ZWNA 4W9NC 2CNDA 2VQEH 4DC9A 1AMUA 4KFUA 4TV9F 4QIWE 4FFLA 1VGQA 3RJ0A 1C7RA 3QBEA 4IQ0A 5FP0A 1UXGA 4NZNA 5HSGA 1DX6A 1OKKD 1Y6ZA 2F90A 3ZLJA 1QHEA 3VH4A 2CSXA 1QH0A 3PI6A 1PBNA 1ZK4A 4GU5A 4I55A 4EYKA 1K3FA 4YAIA 4ECSA 4E2ZA 1KNXA 3ELBA 3ROFA 5DP1A 2ZYVX 3E03A 4FX5A 2X7JA 2D0DA 2VH1A 3QU7A 2JFYA 4XR5A 5BYJA 4Q3LA 2GWRA 1NMQA 3A6HA 4WACA 2V6GA 4DHWA 1Z22A 1KWGA 1D03A 3PIDA 5TXGA 3Q7EA 4H59A 3IR5A 2FEWB 1TU4A 4FEAA 3IFSA 1T1GA 5LVAA 3DTVA 2O4CA 1H1LB 2BVNA 4IO9J 1NI5A 4TTVA 1JN0A 2WJVA 4J1NA 2PLWA 1KHHA 2PZAA 5F9MA 3UGQA 1NAHA 3SGIA 1MH9A 4URWR 2XWQA 1SVOA 3D0OA 1CJKC 4UW9A 5JJIA 4MRVA 3TRDA 1Z0IA 2CWDA 3IQIX 5EJ2A 3JYOA 1DAIA 3EVNA 2I5PO 1M34E 3HUUA 4OSPA 2WSMA 1OXUA 4ND7A 2XITA 4J9MA 4V0OA 3V1NA 5I7VA 3LDHA 4ZGBA 3SQLA 3CB4A 1SHUX 3EGXA 2F1OA 1X7ZA 4WBNF 4QQRA 5ENZA 2JG3A 4XUCA 2LIPA 3BH6A 3K6KA 3AVPA 4QHYA 1DRKA 2B83A 1KEWA 3LNTA 3OF2A 3B51X 2VJBA 2ZREA 4UHDA 3BGDA 1JLHA 4R71A 1S6YA 3A3KA 5AKYA 4YMSA 3CD6H 4JIGA 4P4TA 3TO5A 3LZDA 1OYOA 5DV9A 2NP6A 4X54A 1E79A 5AI8A 3LX6A 4D81A 1ZGAA 1ZHQA 4YV7A 2BKEA 4PNZA 6ADHA 1H8HA 2ZRKA 4GYKA 3RFVA 1J06A 1LI5A 4KE6A 5BORA 3L04A 1GR1A 3ZGYA 1Y4SA 1I94H 4FW8A 1E6EA 2YXLA 4IOAJ 5J40A 4Q4AB 5AW6A 4OJYA 4YCJA 1LI4A 3DM5A 2YRFA 3OMXA 3ULKA 3G9QA 4WFNJ 1GHTA 2A59A 3MTDA 3NW9A 4BNGA 1RIIA 2PRIA 4HGPA 5JZSA 3WL4A 4EMTA 2I2FA 3GFOA 4Y2RA 5DASA 2OAP1 1BMFA 1DQSA 3IRVA 4EBCA 2O5RA 4G1UC 3S1AA 3U37A 1P29A 4LJ6A 2BTQA 3NDIA 3GDOA 3A3OA 2J0UA 5ICFA 3HCAA 2VQDA 2Z5FA 3ZI0A 4KQ2A 3DAAA 3W5CA 3OTQA 3M3HA 2PH3A 3ZE1B 1C1HA 3INNA 3DEAA 4YJ2A 1T3LA 1NVMB 3KL4A 1KVRA 3CUUA 2VP4A 3N0RA 2HWUA 4OU5A 3RSLA 4ZPXA 4YRLA 4LFCB 3GEBA 2ZIWB 4O4IA 4Q45A 1XXHA 3L7JA 2RD2A 3GFPA 3GA0A 4Q82A 4BNDB 3G5TA 1TRHA 3PX2A 2MYNA 1YI1A 1IPEA 3BRQA 4KUHA 3CMEH 5M3BA 3RC3A 3QQMA 4G0YA 4PR0A 1A8QA 1DIBA 4JLAA 1U9YA 1OBVA 3C3JA 1YAHA 4EMSA 1X77A 1H4QA 2BF4A 2E4AA 1ODSA 5AH0A 2PX0A 5GTDA 2OVBA 5FA6A 3V1TC 3HCNA 4PIPA 2R84A 2XMSA 2WMOB 3T7CA 3L1KA 1U2EA 3PPIA 1JG4A 1GY8A 4NARA 4R7TA 3A2MA 4YMHA 3QE9Y 1RCUA 4HG2A 2E7ZA 5L4NA 2WABA 4GEKA 4A23A 5P21A 5BWTA 2PYZA 2YFYA 5KYUB 4A10A 2J0FA 3AH8A 4M0PA 3ABIA 1ARZA 3JQPA 4WE3A 1DJLA 2JGMA 3GELA 3AUXA 4JJ6A 4ED8A 4YJ3B 4RVGA 3WWCA 3U09A 2FUEA 3SNOA 3FHLA 1VPEA 3W1EA 2WZDA 2BC9A 3FHOA 4OM7A 1NUSA 3W05A 4TMKA 3VZPA 5M7EA 5C34B 3ENNA 3H9QA 3EGDB 4CCAA 2PZBA 2OGTA 1FJGH 4TT3D 4GI7A 5JIBA 3KFVA 1USVA 3NR2A 1NF9A 1X0VA 2FMHA 3EUWA 3RYFA 2FW0A 4DR2B 1SKYE 3QKIA 5KFSA 4YQEA 2JEZA 4D9IA 3NPMA 4KYVA 1QLJA 4O6VA 2YYYA 4LRTB 2J4FA 2O6HA 5LP6F 2NTYC 2VZ0A 9ABPA 1RQ7A 1N4DA 2I3GA 5KYXA 3IDOA 3Q6MA 4RD4A 3KR9A 4G5GA 5IYZA 1ZU4A 1XQXA 2XXAB 3QX9A 2JD1A 3F7NA 3PTAA 1P1JA 4QWCA 3BL5A 5K6TA 3QVWA 3FBTA 4BNMA 2XUIA 3CF4A 2H6EA 2ZTMA 4CF4A 2EQ5A 4HBZA 5HV6A 2QTVB 3RVDA 5I3ZA 3S1LA 4E5KA 3ZCPA 4JJIA 4Q6WA 3MTEA 1FM0E 2WZBA 3SC4A 1VBFA 4PZ0A 5HKKD 2VG8A 2UUOA 2F8LA 5BWXA 1OXTA 3T1QA 3U7RA 2VT6A 1WCV1 3ROPA 3KTOA 4OHYA 1W8IA 4M9QA 4M60A 4EO9A 2BMWA 4OATA 1ZSVA 1CEQA 2FFHA 1S72H 2LRHA 5J5CA 1X8XA 4JYPA 1D6SA 2X42A 1H8ED 3YASA 3W6ZA 2DWPA 5BN5B 2IYFA 2VUGA 1YUNA 1PFKA 1FVXA 1SNYA 4LN1A 1OV4A 4ND3A 5KYKA 4NJEA 3HJUA 1XMOH 1H3FA 1YS2X 2VOJA 4QDKA 2ZS8A 2C7VA 1N1MA 5IAKA 1VPDA 2OYCA 1GNTA 3CE6A 3MJTA 4FLEA 3KUCA 4BVGA 3FLEA 4JR0A 4RTJA 2R2AA 1QPNA 3UWDA 1Z2PX 5E6SB 3LYAA 3CR3C 2B8EA 1R8XA 4B6RA 2MR5A 3ELYA 3RCBA 1EVLA 1XQ1A 3WA7A 5DCLA 3S28A 3V8QA 4BNYA 5EKUA 3NWBA 1ZIXA 1MAAA 4X71A 5T64A 5HKLA 2OGZA 3UEOA 2A1TR 3KETA 5AD1A 4U1RA 1P8JA 4ED2A 2XE7A 2ZLBA 1K88A 4GUAA 1T8PA 2X9VA 4GLWA 2YU9A 4RZSA 2B4TO 1E9RA 2V7WA 2EFDB 1L4BA 4LYEA 1R6DA 1RTTA 1LDYA 1QK3A 5CUQA 2QTZA 2I4LA 1U9ZA 3V9AA 5B1IA 4C1NA 2I03A 4IQFA 5GZ3A 1VKRA 3GJXB 1EK6A 1DQNA 4PXYA 1RFLA 3ZU4A 4GPIB 4RD0A 2X58A 4DUPA 3PTZA 3ZHYA 3CCUH 3NOVA 3F97A 3I12A 4CUJA 4ND5A 1HWYA 4MW5A 3O03A 2XCAA 4K2AA 2DLNA 1BGXT 3WIVA 3ACCA 1Z6XA 3IUMA 4I1VA 5ETJA 3UHJA 1YZFA 4ZCIA 3R23A 4KI0A 3QNWA 4R3NA 3QVKA 3OUUA 1RE0A 3EUEA 3AHGA 4WY8A 1AHPA 5B4UA 3LE8A 5CT6A 4Y0VA 3ET4A 3ZCSA 3SC2A 2X4GA 3PJFA 3T99A 1A8IA 4KC0A 3G68A 3UHAA 1OGYA 4FR2A 4PTLA 2J9YB 1NWCA 4P2GA 4KR7A 3OU6A 2PYDA 3VR3A 5KMGA 1XLUA 1CCWA 2WTEA 5B1DA 3WL6A 1W35A 3Q0EA 2HHHB 2HMVA 5FD5A 5JZBA 1LPAB 4EEQA 2I66A 3IDZA 4BQPA 4EFEA 3QX7A 2AYZA 2CE7A 4GR5A 2YJ4A 4KODA 4ZYYA 3JAKA 4GX1A 4LTNA 2D06A 1VYHA 4IZIA 3S7TA 2R8IA 1TOAA 3E9NA 3RSOA 5CR9A 3NI2A 4TKMA 3AFOA 4MYUA 3AF1A 2HDOA 2NT4A 4LY3A 3TOCA 4GF5A 4B47A 5FL7A 1OT5A 4DPMA 5JNWA 3JATB 4S1VA 1E3SA 2C4NA 1KS9A 2VNKA 3QF7A 2IXGA 2R25B 2YCLA 3EY9A 4EYSA 5KYYA 4CKWB 2OP1A 4KYTA 4JI4B 2WPNA 2JGKA 3HNOA 4HJRA 1GAXA 2FZWA 3T6KA 4Q7MB 3HBJA 2M1ZA 4BO3A 2A6PA 3HCDA 3HYRA 3S99A 4QW9A 3TZCA 1U7PA 1JVBA 3AI1A 3EA4A 5A6SA 2J3JA 3V97A 4RPCA 3CY6A 3T3NA 2CW7A 3MWDB 2LPMA 2ASJA 4C43A 1OBGA 1HG1A 1N5RA 3AIKA 2R44A 2BKUA 2QG6A 3H9EO 1CZOA 2N46A 4KNVA 4XVCA 3SZGA 3WDSA 1PJAA 2FP3A 4OA5A 5D2CA 2CFCA 1YS4A 4RTRA 1DXYA 1F51E 4G5RA 1Z39A 4WDQA 2G3YA 4MRAA 1NXQA 2X41A 4TV8A 4G01B 1BFUA 2Z83A 2V4UA 4QUGA 5AVKA 3HUDA 3MJVA 4YRPA 2C8KA 1GQRA 3OZVA 4ILKA 4BE4A 3MR5A 1B8PA 2RJNA 3QYFA 4GSYA 2BKVA 2DQKA 4BRSA 4O3OA 4KFCA 1YULA 4NECA 3VNNA 3N8KA 1IY1A 1JEAA 2GAIA 4IDDA 5KNBD 3TSYA 3ZVKA 3EH2A 2Y0BA 1UBFA 1XVVA 3I9MA 4FB5A 3GZNB 4TT8A 5IC5A 3CRQA 4ZTUB 3HJBA 3U56A 1WETA 1W36C 3RWBA 4PNHA 3PGA1 2ZBDA 3GMSA 2NIPA 2XUFA 1JA1A 2W2PA 1Y63A 5BXYA 4O3RA 1N2GA 1RABA 1I6MA 5AKGA 5CA0B 3GB9A 1G7TA 3DS8A 4BGDA 3BHIA 3KKKA 1E6KA 1Y48E 2A4KA 2R7ZA 1YJNH 5AKJA 3MS4A 1V11B 2PWYA 1YQQA 4PG6A 3PC8C 4HQFA 5FTWA 4JY7A 1HT2E 4FGLA 5KQGA 1AQNA 5C8YF 3IQDB 5JDIA 3TTVA 2W2MA 2NTVA 1SC6A 5HXAA 1GTMA 2CBGA 2HF9A 2ARKA 1N9ZA 2ZRLA 4CZ2A 5JNUA 4DV4B 3OAAA 1KC8J 3KT0A 5EE1A 1J42A 2XVMA 2VRBA 3B3JA 4DV6B 2GUWA 1X1SA 4RD6A 1NHGA 2C4MA 3WJ2A 4MJ7A 4GW3A 4K6HA 1FTGA 1NW5A 4ZYZA 4MQ4A 3ANSA 4US8A 1VGVA 5CJJA 1WQ3A 5IBCA 1JSCA 3RWOA 3W9YA 1PT5A 3GIIA 1RRKA 1XU9A 4ZD6A 4B3FX 4DM7A 1R9JA 3IO5A 4KRFA 2BONA 3FPCA 2FFRA 2DSJA 1PSWA 1TUBA 1A9TA 4J9NA 4L4XA 1WXDA 1Y8CA 2JANA 3QKRB 2IVFA 3M4XA 4HTAA 5JSFA 3WG9A 1X3SA 4M8KA 1FMAE 4LV6A 1CY7A 1E3WB 3AZPA 1WSAA 3AYHB 2R6DA 3UCFA 5LQCA 1K7EB 2F8SA 3B38A 2COIA 4MAAA 2X3YA 1TCVA 2QLTA 1J7JA 4HI0E 1D09A 1E2QA 2AG5A 5HFNA 3HK2A 3L1JA 4JI8H 3FCXA 3JYQA 7AT1A 9MHTA 1AU9A 4I36A 4HAXA 4PYKA 4INZA 4P7KA 3T1VA 1PNRA 1DG3A 3MYRA 4HUQB 4KWTA 5DRYA 3SP1A 2P67A 1R27A 2H1HA 2PJZA 2Y1KA 3NC1C 3VR5A 2X0RA 2WD8A 1US8B 1Z2DA 1BGVA 1CY4A 1DBPA 2XB8A 2X9GA 4RS4A 4CEIB 2JA8G 2IHYA 1HEYA 2VSQA 4KXVA 1Y8AA 2W2XA 3ETLA 4TL9A 4B44A 4O4HF 1L7VC 1LBHA 4MVJD 5J2UA 2BZ0A 2R1VA 2GFHA 3I0NA 3P45A 4RNOA 1RJFA 1CZHA 3CEPB 4HYEA 5L3QB 2WM2A 4GSKA 1JZTA 2FVXA 4EG3A 2CNWD 2XE4A 1QE3A 4HQRA 4RY0A 1NVBA 2XCSB 1RVDA 2F55A 3BIWA 3MHPA 1U2QA 5LYJF 2ID8A 3TLGB 4KN6A 3NVWC 2HREA 2GNOA 1PZMA 3ZCQA 1M7JA 1GVHA 2QE7D 4RTOA 3RAJA 4MSUA 4NEGA 2FCAA 3J81A 5E9JA 2NW6A 2OMEA 2XXJA 3HO8A 1XN4A 2C4HA 5CIYA 1Z7BA 2B6HA 3A4TA 3D2CA 4KR0A 4UMVA 4F3YA 1MEEA 2C3PA 2CMKA 1QHSA 3G2HA 4R1PA 4YO7A 3SQWA 2ZZMA 3JQFC 4YT8A 1B93A 1XOIA 4HB4A 4KPGA 5ALGA 1NFFA 2HU7A 3TPFA 1DZ3A 3OWOA 3FTDA 2G4CA 5JAPA 3TD6A 1UPCA 2IXAA 1VSVA 5K6AC 3C6BA 5DM70 1BEUB 4YT2A 4LI3X 3HU3A 4GRAA 2BMFA 3IVXA 3NC0B 3UK6A 5DN6D 3TM4A 3BIFA 2PLAA 1X87A 3LT1A 2I2XB 4ODIA 1W2BH 3G5AA 5FBZA 4C80A 5IM5A 3CA8A 3HT5A 4OQMA 2PQ0A 1JKJA 4KK4A 3RADC 5FD6A 2I2BA 5DTMA 4F7WA 1GAWA 2FEXA 4N76A 4IICA 1T1EA 1UEXC 1YK0A 5JS8A 3Q1KA 3WMGA 4AICA 2HF2A 4XKJA 4B3RB 5JVDF 3U0BA 1YRHA 2HA7A 4MA5A 4JV1A 1QGZA 3DZBA 2G08A 2XOKD 3LKVA 1AO3A 4S0ZA 3E3MA 1FXUA 3F71A 1ZH4A 3C5CA 4Q05A 3MRXA 4A2CA 1Y8ZA 4RORA 4ZZIA 2GYVA 1SB8A 5JLAA 4L76A 2AW3A 4K6FA 4F4CA 1J8FA 5EXSA 4KFSA 1H9BA 3EZYA 1CUYA 1H4TA 1A50B 3U0GA 4X20B 4GS5A 1SIOA 1T2UA 4X1YB 3N8NA 4KUEA 5EQJB 3ZV7A 4DR7H 4X8HA 2H9IA 4I1OA 4JB3A 1EZ1A 2D0PB 3SHWA 5E3HA 1A9RA 3VSBA 2DQZA 1QO7A 4QU0A 3ADDA 3HSKA 3VPDA 2EIHA 5HUOA 1I1HA 2FE1A 4QPPA 5LA6A 2Q0XA 4A1OA 1J0AA 2Y8EA 3BXHA 3S81A 1NFQA 1ZSYA 1T25A 3DP9A 3LI2A 1DBIA 5COBA 4HAUA 2BFDA 2CXPA 2XD9A 4HH0A 5DI9A 4J0DA 3T1TA 4N3BA 2HZBA 1X15A 4B31A 2W43A 2CNVA 1JFLA 3WNBA 1EVZA 5ALHA 1G5RA 4FMDF 4J9LA 4LDPA 1XMQB 5CEEA 4MRMA 3PW5A 5F52A 1T5SA 1KEVA 3F1KA 1ISJA 2BFWA 4WI1A 2ZGIA 1YD7A 3MYYA 1SUWA 3H9UA 3BJIC 3TLEA 4YRIA 3UOGA 4XH9B 4QO8A 4CIWA 4LNHA 4DZTA 1MGOA 3PJGA 3RTDA 1A9OA 4FKMA 3ISTA 2A9FA 3Q40A 5C44G 4XM2A 1E1CB 5JECA 4OBWA 3ITDA 4I6GA 4MPDA 4E4TA 1EFTA 3SC3A 1UBGA 2BEUB 4D57A 1OVGA 1WV0A 1H6AA 2VAXA 1P4GA 5COAA 3NH6A 3GLFE 4ZVMA 3R8XA 1E2UA 2WV7A 1DEHA 1Y9DA 2J0QA 4OUDA 3GTPA 2E18A 2OCGA 4EI9A 3OCXA 3WK9A 5EOYA 5JD3A 2GVZC 3RJ9A 2WHXA 4Y2PA 4DSAA 4CIBA 3ODGA 4IM7A 2XMRA 4CIAA 5K3FA 3FSJX 3W2TA 1K5HA 2GN9A 2V6FA 4ZIRA 3EGVA 5AK6A 5B2FA 2IYZA 3V7NA 4HN2A 3E15A 4UCWA 5F9FA 3K70D 4QRIA 1L5LA 1Y1WG 2R93G 5C37A 2HXYA 4N0PA 4PWQA 2Y3IA 4NXMB 2ZTUA 2DTXA 3P8ZA 3HJHA 2JGJA 4EW3A 2IV3A 3FFXA 5KYWA 5CP8A 4IFIA 1W44A 3H40A 1TAEA 3W5HA 1Z3CA 2H2WA 2ZDGA 5IS2A 3NHLA 4C4SA 4QWMA 1FFBA 4CTJA 2ZUCA 1VE5A 2DECA 1B0UA 5EJ8A 3GAAA 2UZAA 3T0FA 2JBWA 4E94A 1W1UA 5KFGA 3ZE7A 2ET6A 2IMWP 4QHTA 3R6LA 3ZI7A 1MEJA 4Y6RA 1VG1A 2ILVA 5GIOE 1U0BB 4DG9A 1MJNA 2Z5GA 1PS0A 4WZAE 4R68A 2RH4A 1A2BA 3W7BA 5BR8H 2WPDA 1B0ZA 3ZUGA 3OJOA 4E3WA 3F6SA 4KSYA 3KQUA 3FCYA 3R9IA 1YZTA 1PN3A 4OFWA 5T4EA 4LH7A 3EFBA 4NDNE 1HNZB 3ESBA 3EISA 1N32B 3ROZA 2X9LA 3N5CA 5J58A 1KYXA 3SSAA 5IXJA 1Z4JA 1NF3A 4DA9A 2B25A 2G71A 1P1BA 4C7OB 2P9YA 3QFTA 1WQ1R 4BBZA 1RJDA 4UEWA 4GA5A 2ZU6A 4RF3A 3HEMA 3BE6A 1YOVA 3FN4A 1VJ5A 3WZMA 4BU0A 2X2EA 3FE2A 5CA1A 2KPOA 2Q99A 3FKIA 3F5QA 1YL5A 1ZBDA 3EXIA 4PQYA 4PQFA 3K1ZA 4G24A 5IYCG 3QBJA 4ATNA 1S9FA 1QPQA 1EDDA 2PT9A 1D8AA 3TVDA 5IKEA 2UUCB 1PZXA 5K8UA 3LLCA 1XRNA 2Q5LA 4F21A 3K0SA 2RKWA 3DTYA 1A88A 3IJPA 4LHXA 2IY8A 4C2UA 1G2IA 1QGDA 2CDNA 1XAHA 1GPDG 4MW2A 5JSKA 4FFNA 3GRYA 2J3MA 1E92A 3COZA 5LN1A 4CM3A 3CB2A 2FDXA 4UCXA 1RTKA 4J0MA 4BAZA 3VNUA 4CGZA 3HM2A 1M8GA 2PMEA 5FLXW 5E25A 2VAPA 4PTZA 1RAFA 4PANA 3O0TA 5ERGB 3DFIA 4KN9S 4WOPA 4KOEC 1IRIA 2G1AA 4MVCA 2ZJ3A 1P80A 1M72A 1MZBA 1RC8A 4D6XA 3SHTA 1XYGA 5H1YA 4PZAA 4JI1H 4RLHA 4TVIA 5HK8A 1JAHA 4WKCA 4XSHA 2O4UX 4F5WA 2JGAA 1UM8A 5FOTA 1OH7A 2C59A 3MJSA 3SVLA 2Q5WE 1NNI1 2G9RA 2JHGA 4E33A 1VBNA 1QP4A 1LF5A 3FM9A 3DPUA 1PSDA 4BBSG 3H7AA 1FEZA 3TX6A 2G7MC 4EIWA 4AQYH 4I7EA 3CN7A 2JBAB 4MARA 2CV0A 1ZD8A 5I5UA 2ZAMA 3LBIA 3V4VB 2DFNA 2G36A 2HLDA 3CNNA 1HOXA 2WKRA 3FMGA 3S4YA 3NTUA 1SUAA 2C58A 5MFPA 3BAAA 3RT1A 1J8QA 3P32A 1L8XA 4HUTA 1V7QA 2JS7A 1VG9B 5B36A 2Q6IA 3C41J 4EF5A 2VJYA 3QNMA 3H8SA 1CPYA 1H4SA 3T9DA 3SD7A 2FPKA 3EOBI 4C7VA 3AHJA 1V97A 1MLDA 1J0EA 5K0SA 3BXPA 2F48A 4MLDA 3W9BA 4NK4A 1HE1C 4I14A 2P9EA 4X3CA 1U5AA 3EVEA 4A3FG 3N0WA 3CU5A 3DHEA 3R75A 5AW8A 1O94C 5AOVA 4OHBA 4KKXB 2YYZA 3K8OE 2AEMA 1G98A 2HVSA 1LLCA 1FS4A 2VK4A 4XAQA 1P0QA 2Q1TA 5K8CA 4X8OA 3P5SA 1JGTA 5DSXA 1JG1A 3BK1A 1P1RA 1Y81A 5BUSA 3UPTA 1JH9A 2HL6A 3UQYS 1P2GA 4ETSA 4ZV4A 1G0NA 3J80A 2MMCA 2KW5A 2QKYA 5BSWA 1HL3A 3AOGA 3NOXA 4XWTA 3IHTA 2V7TA 4UMEA 3FWZA 3WMEA 3SBEA 1MHPA 2WJGA 3P0JA 3CKLA 2EJ2A 5IBRA 1E18A 1NUAA 1W52X 4G5YA 3ESZA 2CZQA 2B61A 5LZ8A 1AZSC 3ZKAA 5KFDA 3DE4X 2C22A 1CWUA 4S04A 3S70A 3D8SA 4TWBA 1W30A 1C3VA 2BMJA 3RKSA 5BNZA 2XGMA 3C24A 3H17A 3ENZA 2WINI 2Y1CA 3LXUX 2CDRA 3O2NA 4TSFD 1XA3A 1ZLYA 3ER8A 1QYXA 3MBIA 3LVRE 4KNYA 3RSZA 5LD2B 3I9LA 5BYKA 1NWHA 3QXCA 3ZXXA 4RVUA 2ZAIA 4TQSA 1JJIA 4C0AC 1P7CA 2AFIB 2IP2A 4EYIB 2CE2X 2NV2B 1Y1LA 4NSNA 2B5WA 1SH7A 4JQZA 3FX2A 2C5LA 4MVJE 4ETWA 2NVYA 3HPQA 3THSA 5DW3A 3I23A 5AVSA 2PMCA 5ALYA 5ALRA 4BJHB 5MGNA 1DRWA 1JDBB 3IAS6 2RH9B 2HA0A 4EJ6A 3PCXA 2P30A 4UM5A 3N2GA 4PX3A 2ERYA 5ALQA 1KVSA 2ZQYA 3PQ5A 4DKXA 3GJTA 1OXSC 2EJVA 3A05A 3I58A 2IC5A 4CL8A 3GJ8A 2JL1A 2Y2UA 5TRTA 4CR6A 1AGNA 3WWJA 2WWIA 2ZSFA 1D0SA 1N2EA 2NU7A 3L18A 3N2IA 4V24A 3VNAA 3NEAA 3X44A 5HE9A 3J81k 1I3QA 3ZJYA 4NBWA 4B6OA 1PEYA 1EWVA 1USUA 3FHTA 1VA4A 6PFKA 4IMJB 2CD9A 2UZ4A 3D7NA 5DBHX 3RAEC 3I1IA 2QBYA 4FD3A 4EG5A 2JAOA 4A8TA 1USKA 1ZGCA 2VJQA 2XW6A 3IEPA 4FC7A 2AQHA 4ARZB 4GBED 3T3GA 1BWRA 1VCIA 3LCRA 3TQCA 5DGDA 2QRLA 1Z25A 4ZP1A 3OIGA 3FH0A 4CV0A 4ZT4A 1NZDA 1YASA 5FR1A 4R2JA 2PMZA 4EKNB 3TECE 2ORED 1LSJA 4CM4A 4O08A 3N0TA 3OSZA 4F6RA 1QCYA 1RSZA 2NQ8A 2VBGA 2C31A 3NQ41 1Z0ZA 4U4AA 1G5IA 4AB1A 1IHXA 4MW0A 4I4TA 1MO4A 2QLBA 1S2NA 1ZETA 3K8QA 1X80B 1VRVA 1OD6A 3WNCA 1RMQA 2AE1A 1PGNA 3PHIA 5G40A 4HY3A 2X5NA 3T3EA 3RYCB 3VR6D 4QODA 4EW2A 4YNBA 5JASA 4QO7A 1SOAA 2OFXA 3G85A 4NP6A 1NQVA 4QEDA 1RWWA 4UTVA 4RJLA 1DS6A 4NG4A 4DV1B 1GL3A 3HJAA 2ZE5A 4GPZA 1XYYA 3H97A 1QGYA 1G9SA 2ZRHA 3K6SB 3NTXA 3VPHA 3FGOA 4NFLA 2TPTA 1UAAA 3CW2A 5AP9A 2PT6A 1EFRA 2REQB 1TK9A 4GPD1 2BFBA 4C7YA 2GK7A 1T1IA 3IP8A 1XG5A 2GBFA 2J0SA 4K3UA 3V6MA 4UTZA 1TT7A 4E1BA 4Q37A 1O96A 4E5PA 1NDHA 3VAAA 3R0JA 1D2EA 4KPUA 3TRFA 4DLAA 4RW0A 1JHZA 5A5FA 2R6JA 4PZEA 2BISA 4DBLE 3W9SA 3OIYA 5FI1B 4TZ0A 3HI6A 3DZIA 1P3Y1 1R18A 3BTVA 2AHOA 2WT9A 2RAFA 4N18A 1VHDA 2O54A 4QXMA 5DLFA 1FFVB 1UINA 3N76A 2M1XA 2F00A 5DH9A 1I2MA 3DO8A 3SXUB 4U7JA 1WS6A 3LDFA 1E64A 4YO8A 5THXA 2RHJA 1G3UA 4XEHA 1NBME 5GAHN 3DL0A 2ENUA 1RLTA 1QUEA 3JQAB 4DIMA 3EPLA 4KQ9A 2JVKA 3RHSA 4OAPA 5JHHB 1WLSA 1V95A 2B69A 3JVDA 5E4FA 1GWNA 4IR1A 1PU2A 2OQRA 2OEPA 3UJ9A 3R0VA 4ZVKA 5I5XA 2V6JA 3K1AB 2BF7A 2NU9A 5DLYA 1SN7A 2IGTA 3W8NA 1DMSA 4DCCA 3O8QA 1J1IA 3PL1A 3C6XA 1QFSA 4DLUA 3WQBA 1SU6A 3ADCA 2V7PA 3LGSA 3CSUA 1SD2A 2O2GA 1ESDA 4IX9A 5T5QA 3QJYA 3EZGA 1N78A 4MS3B 1DIKA 4NAHA 4OYLA 4KIUA 4P80A 4H18A 3ZI4A 1ZJJA 1GUAA 1L1EA 1GP2A 5HIMA 3UC9A 3C45A 3E9EA 4L2IB 1YCHA 2TYSB 5JJKA 4YY3H 3GHHA 3MMZA 3RTCA 5HUPA 4RAYA 4KWVA 3IEMA 4NCKA 2PZMA 3OQNA 1KSGA 4MV5A 5FAKA 4WHMA 1RLMA 5I3CA 3H87A 3LBAA 5HZHA 5CPBA 2Z8YA 2YN2A 2DUJA 5AK5A 2UZIR 1CU1A 3LLSA 1MOSA 1XZ8A 3ZK9A 1JALA 2LDXA 1PKEA 3Q85A 4RSRA 3PI7A 1XMSA 4FE4A 4HH4A 2B2XA 3JD1A 4IWYA 1FRVA 4RHFA 1C4WA 5EESA 2C1XA 3NTOA 1LA2A 2FUG6 4C4PA 4DQUA 2KBEA 1P5JA 3WFZA 5I7WA 4JX9A 4DLPA 3DXZA 4IRDA 5IT9W 1YDFA 4R8RA 1SIUA 2GBIA 1QWSA 1K97A 3FMVA 1OGIA 2OPBA 3RVPA 4LVNA 2D13A 1CJTC 4GDFA 1NYQA 2PIDA 2E2HA 3PXEA 2QRVB 5EY5B 3A1CA 1U8TA 5TPZA 1CFJA 4J90A 1ELOA 1E4GT 4IDPA 3KSAC 3QF4B 2O7NA 3IJRA 1Q6YA 5DAAA 4ZHQA 2EJ0A 5KO2A 1X74A 1MO3A 4EPWA 3DD1A 3B89A 1P16A 3M70A 1VL8A 1X13A 1WKBA 5KKAA 4ZT3A 3ZZNA 4WKBA 2XMBA 4R98A 1T36A 3B9BA 1RWNA 4KO4S 3RVJA 2CB0A 3MWJA 4M2LA 3TY8A 4ETNA 1BFDA 3FNFA 1E5LA 2C98A 4ZVSA 3T52A 2Y66A 5DM1A 3D0RA 4J4BA 4RCYA 1W6RA 4P4SB 3MXOA 5E7IA 5G0UA 3T1HH 5KDDA 1UOUA 1J21A 2YWCA 4V2IA 1FSSA 5FLEX 1KAQA 1GN8A 2TMYA 3SX4A 2P9FA 3RVKA 3K15A 4JUDX 2XECA 3B1KA 3ZLVA 3AG5A 5HIKA 3ND9A 4P34A 4IQGA 4OGWA 3KHKA 3PDHA 1Z8HA 3KOUA 1QP8A 3JU3A 2EL9A 3U39A 5KNLA 4HDRB 4Z6KA 5FJ8G 3KSZO 4MRSA 4CMEA 4RXTA 2QVBA 2IRWA 1BCSA 4XGKA 3B6IA 4AKSA 5FV4A 4F3CA 3T5AA 2FJPA 3EPIA 2Z1NA 4LIPD 2PMBA 2B7CA 4WLNA 3LY7A 1T0JB 4NU6A 1TZMA 4YUZA 3NBAA 4NS4A 3VX3A 4MICA 3BSSA 3TBHA 2HHJA 5K2MA 3I5UA 1LX6A 4Y30A 4E12A 4ZVNA 4BX2A 3AY0A 4C3VA 1E1KA 1IM8A 2GB4A 3BWDD 4Z1OA 2D0IA 1TO1E 4L7QA 1EJ2A 1WSCA 3CUKA 4YCLA 3WYNA 4XOUA 1JIVA 4BP9A 3KQTA 4U9HS 1SPXA 3DLLJ 3ROMA 1T2AA 2AOXA 1DPGA 1PW5A 4YAJB 4Q9IA 4EYGA 3TJZA 5I7RA 3UA3A 1CEYA 1U4OA 3A1EA 2D5LA 3L8GA 4FE3A 4EVIA 1FE8A 4E30A 3H1GA 2JD2A 4JQYA 5KINB 3P9KA 4RWEA 2VXOA 3G0OA 3BCSA 1Y69K 1ORIA 3AJDA 1WEKA 4EK9A 3AETB 1BD4A 3H4TA 2G9ZA 2SHKA 4JI5B 4UCUA 2ECKA 3LXXA 5IX8A 1SUSA 4Z5XA 2XDAA 1VL1A 4HCJA 1GL6A 3BC1A 3R41A 1UXJA 3KB2A 2JGDA 3LBYA 1C3JA 4LSZA 2R6FA 1UPAA 3ZXIA 2V7VA 4R8LA 1GEGA 4ZZ2A 3L7LA 2H29A 3B8EA 4M7WA 3OWXA 2FSVC 1R37A 3KXPA 1CYEA 1DDIA 1QAMA 2G1PA 1ZCBA 2WW8A 2J07A 4PG8A 2GJAA 3CX3A 1DXOA 2C2EA 3COVA 1AUXA 1EYZA 1CF2O 4DJFC 3SPXA 1JW9B 3PC7A 4ECVA 1N5MA 3MT7A 3NHAA 4E7PA 3L5OA 2EKDA 1UKYA 3E8MA 4HEA1 2CNOA 1N33B 2TMKA 2GHIA 1Z4KA 1J2UA 3Q5GA 3KT3A 3RR5A 4G25A 5FWYA 4GC6A 1ZH8A 3MQ4A 2FG7C 4IJVA 4M8NE 3G71H 3IRUA 2VDOB 5EJIA 3PRYA 2ZRCA 3SQMA 2WILA 4UBIA 4O7WA 3SBDA 3CO0S 3E9YA 3G23A 4UVEA 3DEKA 1PO7A 3MD0A 4ITVA 2B0JA 6Q21A 4LMAA 2GEBA 1VG0B 5I5YA 5KC9A 1PK8A 1KZYC 4D9CA 2YWHA 4OI1A 2WZQA 3OJLA 3L06A 3TL2A 4PHCA 3F6EX 3GA7A 2GA9A 5G53C 5JROA 2F7SA 2DIKA 2GF2A 1EBUA 4V0QA 5EKXA 1M74A 4N03A 3T3DA 4J29A 2EIYA 4N6NA 3C7TA 1J8VA 4QYWA 5DM6J 1JA9A 4CDNA 1EWQA 1FKAH 2Q3FA 1G4UR 1OFVA 4QARA 4MUBA 4LXHA 3IJEB 4QAQA 3B7WA 4BEBA 2E5LH 1ECFA 2G9NA 3PHCA 3VYVA 3OHBA 4L8YA 1UBHS 1PEKE 4N3GA 2C3OA 1TTPB 1LTQA 1E99A 5KG1A 1QCCA 1V0JA 3A9CA 3DOOA 2NYRA 3S44A 1Y42X 3RASA 5FUYA 2HM7A 1P2UA 3DLIA 4PZYA 2IIVA 2QP3A 4EEXA 2GJKA 1WL8A 3BA6A 3WQQA 5IC6A 4H3VA 4W1QA 2PCJA 2XWSA 1PDOA 3R5TA 1JPNA 5SYNA 2I1LA 1BQEA 1YO6A 3T7TA 4HDOB 1Q57A 2K6GA 2OZVA 3FBWA 1E9DA 1KZ7B 1WDLA 4MR9A 1QRSA 3FRHA 4P38A 2JGFA 2IK8A 2P1RA 5KFLA 4DMKA 2C3YA 2ECOA 3KXDA 1CS0B 5KHLB 1WW3A 3UWOA 4GPAA 2YVLA 3KKOA 5TQJA 3R9XA 1NOIA 5JI3E 3GD7A 4MYSA 5KT5A 3WWOA 3WK8A 3P97A 6AT1A 4D8WA 3GEPA 4Y9SA 3MR6A 5EHXA 3F2VA 4LJYA 3ORSA 2ESRA 5KWSA 1CY1A 2FPWA 2OBLA 5DNYB 1GTG1 3AVUA 2PKQP 5A05A 1RC0A 3TN7A 2ZJ4A 2BTOA 4LBYA 5HTKA 3X1MA 4YJDA 1NUTA 3RB0A 5EQFA 3QUCA 5TIIA 1Y5LA 1KI7A 2JK1A 5CXQA 3M83A 3FWHA 4BX3A 2DZDA 1F2TA 2C82A 2WKWA 2J6IA 4ZARA 4M0KA 2CFMA 2EZUA 3PICA 5ELLA 2WTMA 2JAXA 5PGMA 4I46A 3TW8B 1UIRA 4GVLA 4QU8A 5I4IA 2CW5A 1QVWA 1B6RA 4B45A 4EX6A 4RUKA 4PVCA 2AQIA 5CXXA 2HK7A 3MA0A 1KYTA 2QN3A 3K0HA 1RE1A 4WFAJ 3OLQA 4TS9A 3AR6A 3WGUA 5DKFA 2XUZA 1L7OA 4ZGWA 1SXIA 2XF8A 1CG6A 3UAWA 5H3LA 3TX2A 4DS3A 3UAZA 3OU2A 5I5GA 2IXDA 4H7KA 2WTAA 3AHFA 3INGA 3UMJA 5L3SB 2ZRJA 3RE1A 4PFKA 2C7BA 1GLNA 1VCHA 3FGZA 2W37A 1X7WB 3BXOA 4N0EA 5D7NA 4R8UA 6REQB 4CM8A 4KO8A 2AJTA 4PXAA 3OF3A 4DCSA 4PO8A 1SCIA 1B23P 3V4RA 3SJAA 4MIYA 1AN7A 2JF0A 4DR1H 3K9LA 4HVLA 4IV5A 1VJ1A 3K73O 3I09A 4OOEA 3EE6A 4EB6B 3GT4A 4EHHA 5CB8A 2RGDA 4UNIA 1RQNA 1Y89A 4J1TC 5JADA 1WCIA 1X9IA 3A28A 3L4BC 2HDNB 3OOHA 1N2HA 2YIJA 3AM5A 4M7RA 1YQDA 1E9VA 1G4AE 5LZ4A 4IKOA 1Y7PA 3U4CA 4OYRA 5KNCA 5JH7F 1P1HA 4GP7A 3EVGA 1EP2B 3OQIB 3KJEA 1VDZA 5IZCA 4GMFA 2GEVA 2QYTA 4P54A 3UXHA 3AV3A 1SJ9A 1G8PA 4B32A 2OWOA 5KG3A 3RJMA 8GPBA 1XTQA 5KFEA 2ZBPA 3GGJA 2W8ZA 4BTEA 4R2HA 2QL6A 4TTSA 3NVZC 4TLEA 2RK3A 1L5HA 4UCSA 1RAEA 1M5UA 1F2UA 3T54A 2H16A 5IJZA 1RS0A 4PO9A 1N25A 5J4HA 1DTSA 2MSKA 2BQRA 2IYTA 1Q3HA 2ADOA 4DLBA 1LZLA 1CXZA 5F9NA 2QZSA 3MTGA 2V5AA 4C3UA 2Q7DA 3MIIA 5GVRA 4HF7A 3ZLTA 2V6BA 4BRZA 3O4GA 1YQXA 4ZYVA 3ETHA 1V8FA 3R7BA 3FSGA 2QRKA 1PJ8A 4O83A 3I4FA 4HLUA 3EVDA 3OZDA 4TQ9A 4FLMA 1MT0A 1Y3BE 2FFJA 1JBKA 4C88A 4A3EG 1MC8A 4XLTA 2CFSA 1R1DA 3WGLA 3PUHA 3R6TA 1RHKA 5EAIA 3IEUA 1HDZA 2AK3A 1ODTC 4H16A 5D86A 3M2PA 5F1PA 2BE9A 3AL3A 1KYVA 3WTCA 1SKMA 4JJKA 3ILVA 4UAVA 1QYDA 4IIVA 4IS3A 1U0HC 3VNVA 2A58A 4IO0A 2YV2A 3L07A 3GZ4A 1QIFA 4IQ4A 4UNSA 3SVTA 1T15A 2JEYA 3IE0A 4R6WA 3G89A 1P6UA 1V16A 2E87A 4JITA 2OORC 3EQ2A 1RYBA 3UBTA 4EG4A 1W7AA 3QA3E 5FFFA 1TVMA 4PPFA 3W5AA 2XOEA 3AVOA 5KFTA 1GTZA 1Z17A 2JI8A 3GCGA 5KT4A 4HX2A 4NMXB 2DUMA 4I1PA 2QMUA 3EUAA 1BWPA 3N2ZB 2IX3A 2WIBA 2POQX 2ZAYA 1H6DA 1NJ5A 5JAOA 2R4TA 1B8NA 1THGA 4FYHA 4R2IA 3VR2D 2PV7A 3HU5A 2VDWB 3TKAA 2OCIA 4OMUA 1KJNA 2GQ0A 2DT5A 4CFZA 1DINA 1NI4B 1SXJA 3PFBA 3I8OA 1HPLA 3HGMA 1OX4B 2D4HA 2WQZA 5BSKA 1ZHOA 3OEWA 3M6XA 2D5CA 1N6HA 1W73A 1NIPA 3OJFA 1RI2A 4DFDA 5EHIA 3TTWA 4EQ6A 3MTJA 3KALA 1UDXA 3ACDA 4O4JF 2J9FB 1PG0A 2ZDQA 2IIQA 5JCXA 4MKZA 3WB9A 4IPTA 3GGOA 3J7AC 1XTRA 1N9GB 3ZCXA 4CI9A 5IWCA 3DHWC 4A3SA 5HGJA 1U0NA 2B82A 2WHPA 4JIMA 1BCRA 1N8NA 2Y99A 4WKOA 3FAZA 4Y98A 1TM3E 2O8DA 1CZLA 5FUWA 2ZBQA 5KFYA 1WEHA 3E6AA 3DP7A 4RS3A 4LE1A 2CC2A 3WGGA 2N3ZA 2OO3A 4DCPA 1G55A 2HDWA 4MGEA 3HEAA 1QO0D 5C3MA 3TSZA 5LZ9A 5GONA 3HOWG 3TKLA 1QB7A 2VXCA 1HLGA 4FBGA 2QQEA 5TQ2A 5LLTA 4CG3A 2PXXA 1OROA 5I9TA 1OZ0A 1TJ3A 3ND6A 3GGCA 1QIHA 1JR6A 3ZJ5A 4FFVA 5HS6A 5CYGA 3KXYT 2QM8A 3T3MB 3KSRA 1VMEA 3ZW9A 4FYXA 4FS8A 1AVTA 1MGPA 1U8UA 5LJIA 4DARA 1SHJA 3LF2A 4M21A 2YRWA 3NIFB 3QOWA 2XQJA 4DL3A 3COWA 1D2CA 4RPGA 3R7AA 2J87A 1WXXA 1VQOH 1CKNA 3FYTA 1ZM4A 2X6QA 5EHNA 2CVFA 1A0GA 3UPDA 5I9SA 4DREA 4B40A 3QG5A 3Q3CA 1DU4A 4BNZA 1I80A 5ADUS 3GPBA 4UULA 4DYHA 3D8HA 3BQNB 3EVBA 1MRSA 4H15A 2OKCA 5DK4A 2IXFA 4KWEA 1VLLA 3FPHA 3HHPA 3RQIA 1L5ZA 1TEXA 3BFVA 5LOVF 2E9SA 5TGTA 4YXWD 2P2YA 1G17A 3AONB 1GPJA 4RVSA 5IYBG 2PKRA 4DW8A 1ZMRA 5CNJA 3SYLA 3BIIE 5EUQB 4C6TA 4BEWA 4Y9DA 4JI3H 4AF7A 4O2AF 4FYIA 1J09A 5JJCA 3JD0A 5F3WB 3OZEA 1Z62A 3M4JA 5DGAA 4KGDA 3WV4A 4QQKA 5LQUA 2L2QA 4Q3AA 1YIJH 1EUDB 4MLCA 3OESA 5K05A 1UPBA 3V9PA 2PRJA 1SVNA 1TLLA 1QVFH 3FUUA 1MN6A 4B1FA 4X63A 3L6BA 3GUHA 3VU9A 4E70A 4UTXA 3ESYA 4BNXA 3ZJ4A 2AZ4A 1B8UA 4A3IG 1WA5A 2A78A 2WJHA 3N5KA 3OOWA 3K05A 5K3OA 4KO2S 3A7DA 4N7MA 1KJ9A 4AY6A 5DBFA 4RZQA 3H0KA 1SRRA 5JI2E 1M1UA 4AF8A 1O8CA 1XRQA 1H2YA 1T5IA 4AW9A 2AXNA 2C94A 3LJKA 1WRBA 2NGRA 1ADFA 3W8RA 5BPHA 1C7ZA 2FJ0A 1V8PA 3U3MA 4DMRA 4EECA 4Q1CA 2YV1A 3WI7A 4PYQA 3BA9A 3VKGA 2WE7A 2H06A 2VDPB 1M8KA 1E4YA 3A1TA 4P3NA 3COPA 4AMVA 1WP4A 5LKRA 1NT4A 5FQNA 4BXOB 3AL0C 3N8DA 4C01A 4I8DA 3ZXUB 2V4ZA 1L3BA 3JQAD 3EASA 4MKHA 1LK5A 2RAVA 1QB8A 3C2FA 1KPGA 2UUAH 4ZEVA 3FR8A 3FFBA 1B1CA 3KG2A 1RW4A 3B1JA 2RHTA 1F38A 1NFRA 2G88A 2ZRGA 3U6KA 1J70A 4B2IA 6YASA 1Z83A 4EATA 1RRVA 3RO7A 3VSCA 3LHKA 7MHTA 4K6KA 3EYWA 4I2NA 3Q6IA 1HMYA 4EA8A 4X64H 2YINC 3IAXA 3Q7QA 2XH8A 1JHPA 4QJ5A 4KITB 2W8BA 3C2EA 2RHGB 3H2IA 1SU8A 3DCJA 3DZDA 2QV0A 3KD3A 4I0WB 2CKMA 4N6OA 1A2OA 2QX4A 2Q6LA 4GXTA 4D99A 3O8RA 1ZJ6A 4I55B 4E88A 2PSEA 4OXXA 1I7LA 1KAMA 1IFXA 1A9YA 4FMBB 4Z2YA 4UU0A 1WRVA 2PZLA 2QRJA 3WY9A 1YQEA 2PAFA 3VV3A 2WSLA 4EA9A 1XI2A 3RBAA 2BBWA 4XGRA 3QPVA 1NG1A 1YHYA 2Z2KA 1PJBA 4O7NA 4I5FA 1VJCA 1LGYA 1S10A 1K6XA 1XEFA 3DTVB 2B35A 3B9RA 1TADA 1XRLA 4A6EA 3D2AA 3NPAA 1NMYA 4OQYA 1NUQA 1OUMA 4DB2A 4ALNA 1NXTA 1Z7EA 1TAGA 1BVYF 3IBYA 1G20E 2WF7A 4DYDA 5UKDA 4D9EA 5CLQA 3RTGA 2X0SA 1MTOA 4KTTE 2PA3A 3H1TA 4AUMA 4TMTA 1ZW1A 2GXAA 4Z9YA 1ULUA 1AKEA 1JEEA 2DBYA 3Q12A 1VE9A 2RKOA 3EGXB 3LQ4A 1X7ZB 3FG9A 3TW0A 3H65A 2QRGA 2WF9A 5AWFC 3H5LA 2PSJA 3TJMA 1R0LA 4GI2A 4CEJA 1J1ZA 4EHFA 4R9SA 5ITWA 2JZNA 4NONA 3NFRA 621PA 3SR6C 5MLCO 5EG5A 2QLJA 2QUAA 3TLKA 3ZDRA 2OK7A 2EP7A 3NBUA 1VCMA 4JEIA 5FDFA 3NNSA 2WYVA 4AP8A 5C8DA 2OTLH 2MYTA 3EF0A 1P3DA 2ZB3A 1YI8A 1EA7A 1YJ5A 2OAGA 3CCQH 3W7VA 1U3WA 3CGWA 3O94A 1L4FA 2FLKA 2DB3A 3ND8A 4NQRA 3G5UA 3WDLA 5MN6A 2C7RA 4MWZA 4YLEA 1KOGA 4S35A 1MJHA 2GZ1A 5AQEA 5FKJA 4JROA 3I4MG 1I2DA 5BN3A 1K8YB 4HMPA 3LDUA 4GZLA 1XQVA 2J3QA 2ID9A 3DE2X 5MDHA 4NENA 2JFZA 1EKPA 1D3AA 2B99A 3EDMA 1HDRA 1C3OA 4DDHA 4KZPA 3UB2A 3S1AB 1NXOA 4H7JA 2R8ZA 4CJXA 2BTQB 2CBZA 4A2WA 3VH3A 2J0UB 4YQWA 1H23A 5EQDA 1LLQA 1FFAA 1DOAA 1K5GA 2IP4A 2INGX 2ES4A 1EWKA 3S8MA 5JSQA 2CDCA 2DR3A 3FNIA 2ORVA 3VGJA 1W34A 3DB2A 2OD2A 4YJ2B 2J9ZB 2VWGA 2B7BA 2QJTA 2F9MA 1R88A 2D5IA 4RB1A 3WJAA 3O6VA 4O4IB 4QE3A 4MV1A 3EEYA 3OQMA 2SKCA 2YVAA 2XGOA 1KYWA 1XXHB 2P75A 4J9VA 3FCCA 4YBZA 1IN7A 3AF0A 5AUNB 4L6CA 2EZTA 2Y1FA 4EITA 5F51A 3LH5A 2OSVA 3HXTA 4ESHA 4D4KA 2IWHA 4DN6A 2FXVA 1FYWA 1RQXA 1E1DA 5IF9A 2PH1A 5GOZA 3HDJA 3LUGA 4NS1A 3GCWA 1I51A 4BMVA 1MC1A 4F4XA 3PGLA 1M33A 1ENYA 3D6VA 1JDSA 4OMDA 4UE6A 4LA4A 4UBMA 2PZJA 1ZESA 3GO4A 1E5VA 3LLVA 5BQFA 4TQGA 3DFZA 3NRCA 2YIDA 2PLFA 1T9AA 1WPGA 3ZU5A 5TVKA 3G79A 4PDBA 1VYUA 3RI3A 3DOUA 4ICIA 3UO8B 4RIGA 3SHQA 2UYYA 4HEQA 3OSNA 3BXXA 2B4QA 2O7SA 3P4XA 3WKAA 2LBPA 3EDCA 1E6WA 3TNFA 1PFYA 2A0FA 2XUOA 3O8OA 2QAIA 3WLPA 5U1PA 1Z3IX 4X1KA 4IEFB 1VQMH 4A9AA 1XU7A 4J9RA 4HV4A 3PFCA 3D9QX 1MMFB 1ZHSA 4J4HA 3G9XA 1EESA 2YDYA 1NOKA 4DV5B 3RYFB 3RJTA 4WOCA 2W48A 1VHTA 1HZZA 2Z08A 1R9TA 1R6TA 2GN8A 2YWGA 5DX1A 2YOFA 2CDAA 3QXXA 3GXOA 3AU9A 1Z6GA 3JQ7A 1JECA 1QDLB 1JDPA 3K6RA 4H7EA 5KYXB 1RHJA 2X14A 2JPDA 1M8PA 1R3UA 4NU0A 2XKJE 5IYZB 5AJTA 4F06A 4FGKA 3PA6A 3SJZA 4LBZA 3HMQA 3U3ZA 2Z5LA 4YRBA 3GLIA 2E3JA 1T1JA 4YLYA 2VHYA 2JATA 2MTBA 1N3BA 2YY6A 2UXCH 1WMSA 4LHSA 2I9KA 4AIIA 2G28A 3D8NA 5L1JA 4M38A 1K7XB 2J45A 1RPJA 4NBVA 1J56A 4RIIA 1CUCA 4RK4A 1A9SA 8ATCA 3QPBA 2WWVD 1F6BA 1EP9A 2MSLA 2YMLA 2NSYA 2BHRA 4F6LA 3JXEA 2VR1A 3KFLA 5JVLA 4UFOA 3O75A 4NXNH 5CFLA 1R0SA 1X39A 3L01A 3DSRA 3I37X 1ZINA 5FADA 4MGHA 2JCGA 1XTZA 3OT4A 2XB6A 1GGHA 1QV6A 1CKMA 2HG8A 4YCNA 2AE2A 3BXGA 2K7ZA 4MYDA 5FOQA 1ST3A 1QJCA 1F48A 4ZMSA 4NJEB 1HL7A 4RHUA 3DR3A 4MVWA 1NVFA 4J9KA 4BZQA 4KBYA 1W47A 2H31A 5DJ5A 1XQWA 2R00A 2ZRFA 4D6PA 4NATA 3JSLA 2V1XA 4B3DA 2R65A 3S7ZA 3WP1B 1P7VA 2IA6A 2HA3A 3MHTA 1GT6A 3UKDA 1M3SA 1FSGA 5DBEX 1N0UA 1QR2A 5KT2A 2IEAA 4YMVA 4UZFA 3SE0A 1WTCA 1YS7A 1M2NA 3IQZA 1Z4PX 4RTPA 2H0RA 1KGDA 2OV4A 3OCCA 4P84A 2HWYA 2ASEA 4CL0A 3DEYX 1PE0A 4CMKA 1JYFA 2OV1A 2ZIGA 4ZOBA 5EIWA 4RK6A 3MAAC 3Q2IA 2GK4A 4N0DA 3KWFA 5T8KC 3IC5A 4W5HA 4A6XA 4BKQA 3KQOA 2OWEA 4P7BA 1R5NA 4CLDA 4LPSA 4BPRA 1XDSA 4KZKA 4LSXA 2B20A 2QS9A 3VHXA 3BHMA 3OICA 5LXTF 4F4FA 3UMBA 3LWNA 1E1QD 2CLMB 4K03A 5DTEA 5K3AA 4LWQA 4TQAA 2W8LA 3W4JA 1W9MA 3CUTA 1Y14B 4WZZA 1WLYA 5AIAA 4P58A 3D8RA 2LR0A 4EARA 4XUGB 3HY4A 3UJ7A 4BRUA 5FYDA 1YR2A 1IK4A 2WKPA 3SXJA 2DBRA 4MW6A 5HIIA 3EGOA 3I6IA 5EIBD 1KIAA 1P45A 2C2DA 2Q4BA 1RXUA 4LWOA 2VQFH 1ENPA 3DE3X 4BCCA 1CNMA 4RXUA 5SZIA 5TGDA 3LF1A 1MDFA 3AR3A 1VB5A 3WB0A 2FUCA 3SC2B 2GTPA 1VFNA 3ANNA 1AE1A 1A1SA 1N2IA 2OLEA 1B6TA 1N77A 1E69A 3ASYA 2M6KA 5LP6C 3H3JA 2NUAA 3ZBTA 4MYCA 3L7DA 2VRCD 3B52X 3AF4A 4ZRMA 4RCNA 3NU1A 3PW4A 1JQAA 2DQ4A 5KMGB 2PMDA 1SBHA 2XA1A 3IOEA 3K9BA 4OKNA 1NRJB 2VOBA 1YAJA 2ORYA 4GOXA 2K7FA 3ZCRA 4A4DA 3GCXA 4EJSC 3AJAA 2FTKE 1Y9JA 3ZIAD 3T1YH 4HDKA 4CMHA 2NYAA 4M0DA 2NZXA 5TNXA 2W2OA 2AB0A 2WB2A 3IUYA 1ZIDA 3JAKB 4X95A 2BLLA 3DE0X 1H9AA 2P9HA 1WHTA 1QWOA 4U6QA 5JXHA 3I2IA 4UUOA 1ITZA 4J16C 3HDTA 1IM5A 3ZY6A 2EWMA 4FVTA 3IIKA 4IOCJ 4XE5A 4K0KB 5A62A 1S5PA 4PZLA 1J39A 2IPOA 3B5JA 3EMKA 4C3OB 2XYVA 2I34A 3QU5A 1WU8A 2RH8A 1F4LA 2VT2A 3N28A 1EGQA 1IXRC 3U1TA 2G1KA 1S9HA 1RQ2A 5ESRA 3ORYA 5KWIA 1JFVA 4WQMA 5KYYB 1YRLA 1KO5A 2ZBUA 1TWCA 4I50A 5ALFA 3OM1A 4LI0A 5DM60 1TCAA 3FKQA 2ZYUX 4PXSA 5A9TA 2XYPA 4J6FA 4JWKA 5A6SB 4ZOLA 2P6MA 4L7VA 1FBTA 1BXKA 3WRWA 1YS1X 4TKLA 3VVLA 4HWRA 2D1FA 2O2DA 4Z7OB 1BSVA 4K6OA 2YWVA 1KQSH 4KXQA 3OE7D 2AZTA 4URXR 1U99A 2R7MA 2B7QA 2OA0A 4TV8B 2FK1A 2ZI3A 4L5JA 2BM0A 2VK8A 1KSFX 1E7RA 1ZVQA 5FWNA 2O8EB 4GAEA 2FRVA 1C9DB 1IYEA 4BFZA 4R2MA 3K0CC 1Q2UA 1MJGA 4R6XA 2SKEA 1YR9A 4LWZA 5B3KA 5CIQA 1R0BA 2X1LA 2H85A 5LFAA 4LF7B 3GROA 2CMGA 4HFNA 4DE5A 4K9KA 2ZGVA 4KQXA 4IRMA 1SVWA 1ENZA 1AUQA 3QFRA 1LDGA 1VJDA 3N40P 1DXHA 1QZUA 1CULC 3CWQA 3KZOA 3DDWA 1QG2A 1PWZA 1T2FA