3VMMA

Crystal structure of bacd, an l-amino acid dipeptide ligase from bacillus subtilis
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
471
structure length
471
Chain Sequence
ERKTVLVIADLGGCPPHMFYKSAAEKYNLVSFIPRPFAITASHAALIEKYSVAVIKDKDYFKSLADFEHPDSIYWAHEDHNKPEEEVVEQIVKVAEMFGADAITTNNELFIAPMAKACERLGLRGAGVQAAENARDKNKMRDAFNKAGVKSIKNKRVTTLEDFRAALEEIGTPLILKPTYLASSIGVTLITDTETAEDEFNRVNDYLKSINVPKAVTFEAPFIAEEFLQGEYGDWYQTEGYSDYISIEGIMADGEYFPIAIHDKTPQIGFTETSHITPSILDEEAKKKIVEAAKKANEGLGLQNCATHTEIKLMKNREPGLIESAARFAGWNMIPNIKKVFGLDMAQLLLDVLCFGKDADLPDGLLDQEPYYVADCHLYPQHFKQNGQIPETAEDLVIEAIDIPDGLLKGDTEIVSFSAAAPGTSVDLTLFEAFNSIAAFELKGSNSQDVAESIRQIQQHAKLTAKYVLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Alanine-anticapsin ligase BacD
publication title Structural and enzymatic characterization of BacD, an l-amino acid dipeptide ligase from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
total genus 140
structure length 471
sequence length 471
ec nomenclature ec 6.3.2.49: L-alanine--L-anticapsin ligase.
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13535 ATP-grasp_4 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3vmmA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3vmmA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3vmmA01
3.90.1170.60 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Aldehyde Oxidoreductase; domain 3 3vmmA04
1EHIA 3K5HA 3BFPA 2CQYA 1C3OA 3U55A 3HB9A 1KJQA 3QFFA 1B6RA 3RFCA 3R9RA 2CNUA 2R7LA 2I8CA 2YZLA 1EUDB 2IP4A 2YWVA 4EABA 2QF7A 5DMXA 2V58A 5JVLA 1A9XA 3RV3A 3U9SA 3R5XA 4ZHQF 4M99A 2CNVA 2R7MA 2VPQA 4O7SA 4M9CA 3OUUA 4EA8A 2R82A 2XCLA 5LOVF 2GPWA 2CNQA 4GGMX 2GLTA 4NYEA 1JLLB 4EG0A 4IZOA 4QSHA 2NU8B 2WYOA 3V4ZA 4I50F 1M0TA 4I4TF 3Q1KA 2NU9B 2I87A 1VKZA 1KEEA 1BXRA 3ETJA 1M6VA 2Z02A 4O4LF 2J9GA 4MV1A 3AX6A 1KJ8A 2W6MA 1KBLA 3OUZA 4YAJB 4O4IF 4MAMA 1DV2A 1VBGA 5C1OA 1EUCB 5LYJF 2OLSA 2GQRA 1A48A 1PX2A 2W70A 3RUPA 1EZ1A 5J2TF 3UFXB 4ZI7F 2CZGA 2Z04A 1B6SA 2W6ZA 2W6OA 1CS0A 2YZGA 4O4JF 3MWEA 4XZ3B 5KX5F 5CA0F 5LP6F 4FFPA 1UC8A 3GLKA 1GLVA 4DIMA 5JQGF 1M0WA 3VA7A 3ORQA 3MWDA 4C5CA 4MV7A 2YL2A 4C5AA 3KALA 5HV6A 2DLNA 3E5NA 3WNZA 4FU0A 2R87A 3U9TA 1PK8A 2C00A 2YRWA 2R7KA 3HBLA 3TIGA 3BG5A 1AUXA 4O83A 3LP8A 5CAEB 3DF7A 1SCUB 3TQTA 3ORRA 2W6QA 2YYAA 4YBZB 3TW6A 2FP4B 3BSWA 2GQSA 3VOTA 4FFRA 1GSHA 2V5AA 4FFLA 2R85A 1CE8A 3VPCA 2DIKA 2YS6A 4MV8A 4DLKA 1I7LA 4ME6A 3JRXA 1Z2PX 1DIKA 4O7RA 2GPSA 3VPBA 2NUAB 4O7ZA 1UC9A 4XX0B 4O4HF 1JDEA 4L1KA 2NU6B 2R7NA 1C30A 4WD3A 2YS7A 3U54A 1E4EB 2YRXA 2FPGB 2XD4A 4TV9F 1I7NA 3KAKA 4HQ6A 3G8CA 4IIJF 3JRWA 4E4TA 2YW2A 1KJ9A 4YB8B 4HR7A 3VPDA 2R84A 2P0AA 1OBGA 1GSOA 4ZOLF 2V59A 4O86A 2R6FA 4FGRA 4Y8VB 3GIDA 5H80A 3N8DA 3MJFA 1DV1A 4J6EA 3R5FA 4MA5A 2DZDA 2YZMA 4O84A 4IHJF 2W6NA 4HNVA 4TUYF 3KAJA 4O81A 3R23A 1KC7A 1JDBB 4O82A 1AUVA 2SCUB 3NUAA 3WO1A 2ZDQA 4YJ3F 4ZQIA 5KKNB 1T36A 4IWXA 1ULZA 3SE7A 4O7WA 3K5IA 4RZQA 2W6PA 1KUTA 4HNUA 5LA6F 4HNTA 4FE2A 2W71A 1OBDA 3BSSA 5K2MA 1E4EA 3KREA 2VR1A 4M98A 4FFNA 5BPFA 5JQWA 5JVDF 4O7VA 2VHEA 5JH7F 2DWCA 4EGQA 3AW8A 4MV3A 4FFOA 4MA0A 2NPOA 2PN1A 3G8DA 5IYZF 1VBHA 5FNVF 3BSYA 4MV9A 3Q2OA 2FPPB 3V4SA 1JKJB 4O2AF 4IWYA 3HO8A 5EZYF 2VQDA 3VMMA 1W96A 5CB4F 4O7YA 4O7NA 3JZIA 2NU7B 4M9UA 3WO0A 4YAKB 5BPHA 2FB9A 2YZNA 4O7TA 2PBZA 2ZDHA 3JZFA 2PVPA 2HGSA 2X0SA 4O7LA 1CQJB 3TIIA 2ZDGA 4C5BA 3LWBA 5C8YF 2R86A 1KJJA 4EGJA 5D8DA 1IOVA 4XYMB 5GONF 4EA9A 4EA7A 4MV6A 1WR2A 2FPIB 4YJ2F 1Z2NX 3RV4A 3R5HA 3I12A 1GGOA 3K3PA 4WBNF 5LXTF 4I55F 1IOWA 1CQIB 5J2UF 5C1PA 5BMVF 4MV4A 5HBRB 1EYZA 1W93A 4XYLB 4EAAA 2HJWA 3N6RA 4FFMA 4O2BF 5CA1F 3ETHA 1BNCA 4TV8F 1Z2OX 2QK4A 3TINA 1GSAA 2I80A 1KJIA 5I47A
chains in the Genus database with same CATH superfamily
1IUPA 2JEYA 5FOWA 1BG6A 2A88A 4G1EB 4LC9A 2A7XA 4ONEA 1C3OA 5AO9A 1P9OA 4P3NA 4X64B 3RUFA 4DXDA 4GPIB 3BGSA 3WLKX 2CNWA 1S3GA 4TXMA 5CPFA 3IBYA 4TM8A 1TMKA 3TIXB 1H5NA 3CRQA 3Q3HA 1U0BB 1GLNA 2A9JA 3U7EB 2D8MA 3PEWA 4M99A 2C2MA 1O03A 3IDFA 4P83A 2X0RA 1SD1A 1GL3A 4RULA 2ZU6A 5BSTA 3A9WA 4QO7A 1MMFB 4FOTA 1ZEMA 1MDBA 5BN5A 3Q40A 4OJYA 4FKMA 2O19A 5C7IO 2ZCUA 2GZ1A 1EE1A 3WYNA 4EHBA 3Q9NA 4DR5H 3C6MA 4JENA 4RV5A 4E30A 9LDTA 4ZYLA 4K2HA 2EG5A 1NR5A 2FQWA 4RK6A 1QHIA 4IKOA 3PGXA 4WOJA 5JS6A 3FAZA 5K3AA 3BWDD 4AMYA 3GRPA 4M6WA 5I9IA 3NRBA 3OKFA 4LF7H 3U39A 4XYEA 3MRSA 1GO3E 5E9AA 2O3JA 2LD4A 5C9ZA 3W7BA 4HXFB 3NHLA 4K6NA 4EA6A 2P90A 1A1SA 2G77B 1Z5UA 4NBVA 3FRJA 3O4GA 1E20A 3SPXA 3OIGA 2XT0A 2CBGA 4H1VA 3PUJA 2ZBPA 1ZY2A 1UQTA 4GLFA 4B6RA 3DGFC 3U6BA 3M4YA 4P53A 4LSWA 4XOUA 4GSYA 3ORRA 3HJCA 2WVAA 1W35A 3W5UA 4F8YA 1OHHD 3BMNA 4Q47A 5D51S 4UVIA 4JC4A 4IZ6A 4KFSA 2ID8A 3WLRA 2IXGA 4YMWA 1RP7A 1J7KA 3CTMA 4P2BA 2EFHB 3PCTA 1X13A 2GPSA 2GA9A 2QROA 2ZZNA 1HLGA 2NO9A 5IAEA 5GV7A 1FFCA 1H85A 4BZPA 3E4DA 3HJGA 4CCYB 2W4QA 2MJLA 1F9AA 5L3ZA 4MWBA 1UNNC 2PD6A 3N76A 1UWKA 1JSRA 1E32A 2DHDA 1RAAA 4OXXA 3FNHA 4KXMA 2KB0A 1C1HA 1O94A 3TAXA 3WNQA 3D3NA 1Q0SA 1Q0QA 2YVAA 4CKWA 4Y1RB 4NJMB 4MW0A 4HAZA 3GGJA 3SG0A 4K03A 2PA3A 1F4PA 1KI4A 3SVLA 4F3RA 1FDRA 2NG1A 2W48A 4L7QA 3WVNA 2JEZA 3QWIA 4RNNA 4CMIA 2AUNA 4J07A 4ECZA 5JSKA 1NX9A 4URYR 3RVMA 4J03A 3VPFA 4K88A 3H5IA 1JHPA 1CUGA 4M0EA 1MAAA 3S2ZA 1W52X 3W9UA 3OLYA 1HOXA 4ALMA 2AGQA 2V7GA 4CQMD 1Q1EA 3BRQA 1GAJA 1I1NA 4ZEOA 5A6SA 2ASDA 1MEEA 5BR8H 1J0EA 3C97A 5K05A 3WWCA 4US0R 1IY1A 4EKGA 2CVPA 2VDJA 4LS3A 2IYPA 2O6HA 4G8DA 4TXNA 3EW7A 1DUIA 4GBJA 3T7TA 4KBGA 2HNBA 1JHMA 3ASVA 2DE0X 1QDLB 1PWZA 4RKEA 3U9LA 4C7KA 4LF8B 4ER5A 2C77A 5ITVA 1XTQA 1VLZA 1V41E 4ID3A 3B1JA 5K4GA 5BOVA 5LA6B 3Q7QA 1E5XA 1RLOA 3ZBUA 3FPHA 1XHLA 1B6TA 4MLZA 4QWEA 3RB6A 3TW0A 1NVMB 1DHTA 1XMIA 4MGIR 4QUEA 4R1UA 1Y82A 2WAMA 3Q9SA 3UWSA 4C9BA 2J3IA 4UNPA 2AMFA 3M5PA 1EUDB 3V8MA 5I5EA 4M54A 3BRWA 3CWZA 4F56A 3NBXX 4V0QA 3NASA 1G8SA 2HK9A 3FYHA 2I7VA 1FDTA 3GIJA 4R81A 4PZ8A 4KJZA 4LJ9A 2JIDA 4F45A 1U4SA 2B2XA 5ALTA 2O52A 3KHRA 3C8ZA 1F2DA 1VDZA 4QLOA 3GHHA 4DV6B 4DMGA 1X8KA 1NVGA 1JECA 1J25A 2ZRFA 3RUDA 4NMLA 4GLBA 3WK6A 4RPIA 5HF6A 5DBOA 2CDBA 4WZAB 1H9CA 2VQ6A 4WBXC 3L07A 1DRKA 2HVQA 5EJ7A 2Y4OA 4ZQBA 5H16A 5HK9A 1T1JA 1L4EA 1SOUA 3NYRA 2B3TA 2VDVE 3VAAA 1IJBA 3CSSA 4LGVA 2OXCA 1ZOSA 4ZN6A 3QF7A 1GP2A 4RB3C 4JI1B 5E9WA 2ZBRA 2PYZA 3AUSA 1OI4A 2UUCH 2NZJA 5CG1A 5HEKA 5BW5A 4Z5XA 1M2OA 2HWXA 2Q4BA 2UZIR 3UMGA 3FYTA 4US1R 2ERCA 3SYKA 1UM9A 3BGOS 4FJ2A 3UJ8A 3V9AA 4EADA 2OXRA 1ZJYA 4MDHA 4NTZA 3IL2A 3ZD6A 4DV5H 2ACWA 2OGSA 4MSUA 4FR5A 2BY4A 3NONA 5KNBD 1HNWH 1PU2A 3NHPA 1NOJA 3IR5A 2DCUA 2VBCA 3WFJA 2DFPA 5FFNA 3C5VA 2Y1EA 4CM9D 3E27A 2ZVJA 4PRLA 3ML1A 3OAAD 3RRJA 1NQ5A 5AM5A 4EECA 3JASA 3ZUGA 3O2NA 1K68A 1JHXA 5I8PA 1E2PA 3F7TA 4YWHA 1IOZA 1VMIA 1SOAA 1V5GA 3OF2A 1LVGA 3ZHOA 3LFUA 1A76A 1XKLA 2BCGY 4LZWA 1E1DA 3OZAA 3IQHX 4LSZA 2H63A 2AE2A 5AOBA 1SUCA 2FF7A 3E3OA 3NDRA 5EIBD 1D9ZA 3BWEA 4HH4A 4N7MA 3HU5A 1BU5A 1GRCA 3VYTB 1SOVA 4F7WA 4JMLA 3QXJA 2DFNA 3I2GA 3D81A 5E1BA 5EHZA 4QVKA 1FJXA 3BHJA 3GX1A 3K5WA 2P0AA 3Q2IA 4IPTA 3NCHA 4LQ4A 1BS9A 3I2KA 4JI3H 1V25A 1DHRA 2QN8A 2X8AA 2EZ8A 3EH1A 5EIAA 1CY7A 2KMLA 2OD2A 2DAPA 4GX0A 4ALIA 5GINE 1EA5A 3L8MA 2UZAA 4O5OA 3L8ZA 2Z3VA 4II7A 4KVAA 3AB8A 5KKNB 1Q0UA 4OHMA 4K6KA 2VYCA 4DVJA 1FP1D 3S2SA 3PE4A 4P84A 4J91A 2CBZA 4LF6H 5LQKA 4L4SA 4Q9JA 3BMCB 5KAPA 2UXDB 1UK6A 4FK8A 1MC1A 4DQUA 3VYWA 2C0QA 2AH5A 1MAUA 4IXMA 2OENG 1CQZA 2D2IA 2O3RA 2XOKA 3VPHA 1Q12A 1RAGA 4JI6B 3O5AA 2YTZA 4JR2A 3GJ5A 4TMTA 4TN5A 4U0JA 4UCVA 4Q93A 4RKRA 4R1NA 5IJWA 1R0ZA 4C4SA 4ZOAA 1YU9A 1IVNA 2POCA 4YRKA 1CEEA 3TOCA 1H9BA 4LCJA 1T0JB 2HLHA 5A4FS 4C7YA 4LRQA 4O0LA 4PBRA 2P2NA 1GO2A 1NVVR 5DISC 5HDQA 4NEGA 3PL1A 4X7PA 4C03A 2FPRA 3U19A 3PFBA 3DL2A 2PLRA 3KOUA 3LOQA 4PS0A 2JA1A 2JVJA 4BNDB 1SR8A 2H3HA 2H29A 4ZI7A 3C87A 2OORC 3CTPA 3R40A 3KYCB 5ESXA 2XJ4A 2HH9A 4UBOA 2WWIA 4LZOA 3DCNA 3IIJA 2BFFB 2YHUA 5BYAA 2W57A 4IJ5A 4CBVA 1Z4PX 5IT4A 1NBWB 5IEJA 4PEVA 3D2CA 3MELA 4X1YB 4ML3A 2G5PA 3UUFA 4PZCA 4PW0A 1Z5VA 5UKDA 4QDXA 2CBXA 2YASA 2AX3A 2P3SA 4OX9H 5HCNA 1FQJA 2NP6A 2OHXA 1GEEA 2ZZMA 2MOKA 3IJPA 1QONA 1T8YA 3JQ8B 3JQFA 4HSEA 3MERA 3G9UA 3GPLA 4XVHA 4JV5H 1RQXA 2JFWA 2WTMA 2WHRA 2BOVA 1USWA 1HYQA 2DQSA 2P4SA 5H3HA 4C88A 1XD8A 5TQ2B 3EGDB 2G0AA 1UPCA 5JASA 4M2LA 1GV0A 2HKIA 2YN4A 4INAA 1EZ1A 3JSXA 5DNVA 5IF3A 4WNAA 1U2SA 3JALB 3GAZA 3KT0A 4ZC1A 4FWIB 2HA4A 1YMUA 5A5FA 5K3OA 3GRKA 4G36A 1CJKC 3P2EA 1FPMA 2JANA 4ZVRA 1FVFA 1XAHA 5AW8A 1NXTA 1JKJA 2W2TA 3CNOA 2GH1A 3OIFA 3L9XA 4DIMA 4HS4A 2HSZA 3IVXA 1SHLA 1MU0A 5HJ5A 1WB6A 4HAYA 3WMWA 5MF6A 1PQYA 1I3QA 3NAMA 3R20A 1PZEA 1Y7TA 1T5HX 1DAAA 1X9GA 4LY0A 3EVBA 3BM5A 1ZO8A 3DTTA 5I9BA 1HO3A 1ESDA 3TKYA 2FK8A 3N2KA 3GTJA 4KE6A 4QJBA 1R9NA 1BGXT 4DM7A 4XB6B 3RS9A 1OROA 2JPDA 4BLUA 3WAKA 2RBGA 4YI3A 1S2IA 1YIDA 4N47A 3FOBA 3X1ZA 4PHGA 3ZWVA 3T0GA 4O2AA 3PXGA 4IGIA 2I1LA 4N39A 3ZQJA 5D84A 3BXEA 1VKNA 2PQ0A 1XL1A 1R66A 1QLJA 5I7WA 3ADPA 1P2DA 3LXXA 3WLNA 3ED1A 1JEJA 4FBLA 2JZOA 4UCWA 5GWXA 1FJGB 2PUEA 3DWEX 3MEQA 4J1TC 5HKLA 4LFBH 1PFQA 1ULHA 2O0HA 3G2PA 3WWOA 5G1PA 4ND2A 1N1GA 3BIIE 4BVLA 2WF7A 3DEAA 4KSCA 1FUKA 3AMZA 4I55A 4H3SA 1XDGA 3PW2A 3R3YA 3S8EA 5T57A 3GZNB 4FW9A 4IRKA 5CE8A 3TVYA 3JVDA 3WGNA 1XRJA 3DAOA 3NIBA 4C2BA 1UBGA 3FPJA 4XQ0A 2F3SA 4DCUA 5CCEA 4JLBA 3EBLA 4AQYB 1ZCJA 1LU9A 5BQ5A 4A3IG 4CLOB 4X8MA 4OYRA 1UJ2A 2I91A 2GN0A 4CIWA 2EBHX 2F1HA 5FBRB 3ZWBA 4IWYA 3LRXA 1GZDA 3EVEA 3KYJB 2F6RA 1V7ZA 3OJFA 2YCHA 3DUFA 5H9VA 2XY4A 1Z0SA 5DNEA 2GN8A 2PWAA 2X1HA 5ILOA 2RD2A 3BXFA 4PFSA 3D54D 3S5JA 3WLQA 1NX6A 5ED0A 1PBTA 1MJGA 5ICFA 1LKZA 1BKSB 4TTSA 1R6VA 2XRZA 3FDSA 2G9RA 2P5TB 3ZEIA 4NS4A 3F97A 4HUQB 4FX2A 4JBIA 2XITA 1EK1A 1O6ZA 4RK1A 2X13A 1A4IA 2NT3A 1QTIA 3QU9A 1CQIB 4DLPA 2CLLB 2RHGB 3QVXA 3OHBA 3AF5A 4JUAA 3RS2A 1FXWA 3ZIAD 1GA6A 3AM3A 4KWHA 2MCFA 2NYUA 4OBWA 2FZ5A 1EFVB 3CCEH 2PXXA 1PTJC 4JUBA 3RIMA 3Q11A 3NVDA 5LIRA 3JWEA 4RXUA 1LQTA 4ZANA 4M4SA 3E6AA 4HCJA 2JA5G 4LZZA 4RVSA 2G25A 4YJGA 3EX7C 2FYTA 1TVMA 4EUKA 5JVHJ 2EX1A 2JJ2D 5JY1A 2FLLA 3OPVA 4GRIA 4TQGA 3UUWA 3R0VA 2HK7A 4FWTA 2FK7A 3JSLA 4MLDA 1ZCAA 1OGJA 2ATEA 2W43A 3NRZC 3LQRA 3V6KA 1SEIA 4P4SB 3U7HB 4G0WA 3L6OO 3K09A 1S6YA 1PL6A 1QJ4A 3LY7A 4XVUA 1JBQA 3AYXB 3MM4A 4IZIA 1UWVA 3Q1KA 3FUTA 4JV1A 4PCAA 3CJRA 4OV6B 2IGTA 2Q2QA 5L40A 2Y05A 3Q85A 4PICA 4QQRA 1XJWA 4BVAA 4GP6A 6NULA 4GT1A 4D96A 2HA5A 4TLCA 1A8SA 2BMEA 3PC8C 1SIUA 5LYJF 4FFWA 1IU9A 2GQRA 4R01A 2F7SA 4ASUA 1GUBA 3CCFA 5JEDA 4ZI7F 3V8NA 1OBOA 1Q0RA 2OWDA 4BU1A 5CFMA 3ZCUA 5JR3A 4NAUA 1MEOA 4M1ZA 5FCDA 2B1RA 2C9CA 1W8IA 4OPMA 4WY8A 1FMTA 3GLKA 2XE7A 5AJWA 2DR3A 3R3WA 2YDXA 2XGOA 2HK6A 1QYVA 4XQCA 4EJ6A 5LUAA 3H1EA 1R3UA 2ZE7A 2DFTA 2WUWE 2ZFUA 3DB1A 2WJPA 1PZXA 4CLEA 2B4KA 3WBBA 2C7GA 1ZPDA 1IZZA 5T8KC 1E0JA 3QXSA 1GTSA 4LF9H 4D9FA 1ZRMA 4J4HA 4R68A 4OH1A 4EL0A 3LJKA 4O4LB 1UC5B 4U9HS 1Y3FE 4ETWA 2I6TA 3NC0B 4LRWA 4HFNA 4HVAA 2ZE5A 3X1JA 2VUTA 5BWNA 3QWUA 1QGUB 2GPNA 3T1YH 5L1KA 1N1EA 4GM1A 1I7LA 3RBXA 1ZR4A 2FWIA 5ALGA 4LE1A 1JYFA 3FCYA 4KN6A 2VDMB 3VUEA 5T3UA 2DUUA 4UU7A 2CXRA 4XCXA 5WRFA 2C2RA 4D43A 2NU6B 3ZIUA 2PPVA 3WB2A 2PUVA 2M2IA 1SO8A 1H4QA 2IV2X 4YRNA 1DARA 2OXIA 1BHO1 3HM2A 4I50A 1YIAA 1AMUA 2R84A 5EP1A 1I0LA 1J20A 3SM3A 4ECTA 3HO1A 4M8NE 4EPWA 3CVOA 1M75A 1VHDA 1T5DX 5IJ9B 3OCVA 5U4XA 2ZWVA 4PIPA 3CLTD 1BMFD 4BNUA 4HFRA 3AKDA 3R75A 3QXXA 4BX2A 3WGTA 4F4UA 2GZHA 2LW7A 3I9MA 1KR2A 4KPUA 1Z22A 3EFBA 2HXGA 4J0MA 2CFCA 3UY4A 4GI5A 2QT0A 4F4XA 4DLBA 1ZOOA 4L51A 4INPA 2XKJE 4I1IA 2ZQ5A 3OQHA 5HX7A 4PNEA 4FQ8A 3P9SA 1RMTA 3GPBA 4HN4B 1ESCA 1TFUA 3UWOA 1MVOA 3EOAI 3OC0A 1TYDE 2G06A 4OAQA 1E60A 1U8EA 4X62B 1YB5A 4O2AF 4QRIA 4IR1A 2BZ1A 4IDBA 4ZKDA 1JR3E 1IQRA 4ZHQA 1RCTE 3VUFA 4HVCA 4LV8B 3QKSA 1MD9A 1H8HD 4PIMA 4PZUA 2W22A 5GADl 4WNYA 4RV4A 3VSCA 1UFOA 2FJUA 2X0SA 2IJGX 3FOAA 3LWBA 5J4VA 3IQGX 3K8OE 3GTPA 4BMPB 3IOBA 2Q7DA 4AJ4A 4NZZA 3OEWA 1JPVA 4UBNA 4M7OA 2XBUA 5AW4A 1N2HA 3F7MA 4I55F 2ZWIA 2AYXA 3EDYA 3EJWA 1S0MA 4K9QA 4A36A 2AEMA 3J80A 2X7JA 4IDAA 3HOVG 3T7KA 1BNCA 1HL3A 4ZOBA 4W9NC 4NU6A 4Q4LA 2EHDA 5CDFE 1VBNA 3AR3A 5EZYB 2FUCA 3GIIA 4AIIA 1GPYA 3MR2A 4QU9A 4Q82A 1QXSA 1J5PA 2GDJA 3O94A 1QGAA 3DHEA 4X94A 4YRGA 1QGYA 2Y6VA 3GB8B 1P6QA 4P9NA 4M3NA 2I9KA 2ZRNA 4EG1A 2E48A 3I2IA 4IMPA 2VJDA 3Q5DA 2XXBA 2R1TB 1NBEA 4CIVA 4J76A 4DT1A 1JKXA 2HI0A 3W5DA 5H81A 3OFVA 3UBTA 3BQMB 2BV3A 1QZ3A 3IP6A 2B1QA 5FTLA 1CJVC 3TTXA 4G1MB 2RSLA 4KAFA 3AHIA 3F74A 4GXQA 2A1UA 3LD9A 3PA6A 5K1ZA 4IRCA 4W9MC 1NG1A 5B3AA 3MD0A 3TB6A 4YAUA 5FLMG 3WL8A 1ZM2A 2FTKE 5AI0A 4V1CB 1GTRA 5LCXA 3UGKA 1DINA 1YZQA 3FI9A 1OXSC 2CVQA 1PR6A 1A4RA 3STVA 3SZMA 2QYSA 2P1ZA 3PFWO 1MVLA 3DVRX 4N0PA 5EERA 2XTMA 2XOEA 4WKGA 2J1LA 4D99A 1TD1A 3H0GA 3M34A 1OFGA 1SCJA 5BSUA 2ZB8A 2G36A 1VQ5H 5G0VA 1ZYUA 4AVYA 1IM2A 2FP4B 1V9SA 4YO8A 5I4KA 1DKNA 3AUKA 1OYWA 2Q49A 2FPSA 3CVJA 3HOYG 3UF0A 1BOOA 2V55B 3W6PA 2FUG6 3IOYA 1YB6A 1Y7LA 2FR8C 1KU6A 3VH4A 5DBGA 3RIEA 4GSKA 3K0SA 2JIQA 5AQ1A 3GTMA 1WDLA 4EJMA 1WCMA 1AXRA 5CYGA 3K94A 5F9NA 4I4LA 1YZVA 4DRFA 2O2YA 4DDHA 3OZDA 4JC8A 2X58A 1HLDA 5DGDA 3ETEA 1NJ8A 3FSGA 4MVJP 4MW2A 4KBYA 3JSNA 3IEIA 2LCQA 5B3JC 2ZLBA 2BEUA 2WIGA 1UM8A 4C0WA 3V2UA 3LO5A 3NDIA 2D4AA 3M6VA 3KTDA 1DV1A 4RVUA 2UXCB 1R4MB 3CJQA 1CF2O 1ZK0A 4JP5A 2BMWA 4OGGA 1VHWA 4W5NA 3BH0A 4NS1A 2XE8A 1E2FA 1VLMA 3GJXC 2W9XA 4FOLA 3G1UA 1VJ5A 1R50A 3NETA 3PE3A 1MOZA 1MO6A 5CLLA 2ZUCA 4G24A 5IC6A 4I9GA 1D1PA 4MRNA 1SXHA 2ZWAA 3BFXA 3E7PA 3DBIA 4DA9A 3CJTA 1P2UA 1WW2A 1SZCA 1YDFA 4IX9A 2ZRCA 2LNDA 2BHTA 4ZYUA 3DBOB 4YO7A 3AILA 3D1LA 3VHRA 4S0XA 4D57A 3ZJVA 1K83A 1PLJA 3VVLA 2C5AA 1DCKA 2QG6A 5IAGA 4GP9A 5EZ6B 4O6VA 4FC7A 4KX3A 2LE0A 3GG2A 1H3FA 1R00A 3UWMA 4I2NA 2CFIA 1QKIA 4AP6A 3BAFA 1JHYA 2GEVA 2F8SA 4OREX 3ZTTA 4DR3H 2OMEA 3ONVA 1UANA 1IOLA 1WO8A 3AXSA 2XH8A 4EGJA 1TM3E 2I3ZA 2REBA 3TFWA 3GRZA 4U5QA 1Z5OA 3FJYA 2CHUA 4G6ZA 5ALDA 4KV7A 1Y42X 1UPBA 4TT8A 4ISBA 1JYEA 2WVGA 1P8AA 4IRUB 4A2CA 1E61A 5E38A 5KCMA 3SDZA 5DN6D 1WZCA 3W79A 3G6KA 4O3MA 1XUOA 1KS2A 4CMEC 3KJQA 1C0EA 2CEAA 3UIEA 4LDQA 3ZX5A 3CEPB 4DJJA 3L4PA 3F5FA 4ROSA 2IITA 3SYTA 1XRRA 3R4VA 5PGMA 3OSZA 4PU0A 1WL8A 2VHZA 5FFFA 4C2TA 3AY6A 2JAPA 3RR2A 4ZHQF 3S2UA 1DS6A 1RM4A 4Z4QA 4K5QA 4DV2H 3LA6A 4GPBA 4AF7A 2I29A 1PL0A 5AM0A 3PGMA 2GJAA 4LHYA 1ONNA 3UXHA 5AXAA 4GQAA 5KWIA 1Y8QA 3H1FA 4OLJA 2P2LA 1P60A 4NABA 1N1MA 3U60B 4I9UA 4GNKA 3MHPA 4NJEB 3KB2A 3RS8A 2H16A 3SSAA 3AEYA 2PUGA 1CUWA 2X40A 4DGQA 1FMAE 1N8TA 4F8JA 3L7CA 3OD1A 4Y9UA 4D3XA 2L17A 3SSOA 2ZXFA 3NUGA 1IJEA 3PVZA 5T14A 4YCMA 2VF5X 2GR9A 1FU8A 4FGLA 5AW9A 5CK5A 3I4FA 1T10A 4COKA 1N2XA 2XNHA 3DLCA 4X1KA 1LLCA 3A3OA 3INTA 1C14A 3ORQA 3E03A 4CQNA 3I01M 3C1OA 1ZRSA 3KSZO 1TVKA 2VJOA 4PPQA 1W5EA 4ZT3A 4YQWA 1T2UA 2OOSA 4JUCA 1Z74A 3ZBQA 3T5BA 1FO4A 3W8EA 3KKLA 3HOZG 2FE4A 3GIPA 2XUFA 1JP7A 2GJSA 2Y0PA 2JEGA 3JARA 3L79A 3GJSA 3GCXA 5KSZA 5AYXA 2A6PA 4Q44A 1DUVG 3PITA 2I2AA 2BGLA 2PIDA 5LU9A 3RJMA 1N56A 1T5LA 4XXHA 1G21A 4DLTA 2W2QA 1E7QA 1MQ9A 4KPYA 4Q43A 2B1JA 1QAMA 2IP1A 2MCTA 3WHLA 4Y9DA 3B6ZA 4KQKA 1FFHA 1GGNA 4HX9A 5MFZA 1DRUA 1DT5A 3RVDA 3QEBZ 2QUJA 6Q21A 2GYUA 4JB8A 2IH5A 1VYHA 2ZB3A 3E9CA 5LWHA 2O9JA 4CUJA 3PNYA 4REQB 1LK5A 2IZ5A 1IZ9A 2P9ZA 1DP4A 5AM4A 4P3KA 3BXXA 3N74A 4IAJA 3FWKA 3NDBB 2BRUA 4BTVA 5JNLA 4X66B 1I3NA 3UJBA 3OZTA 4UDOA 3UMCA 4B0PA 4LVCA 2O2IA 3N8DA 3IBTA 2ALJA 1W4RA 4N40A 3IB3A 3VJMA 1EKXA 1FU7A 3OG9A 4XWYA 4LVOA 3OKCA 1PV4A 3DBHA 4CYMA 2WM2A 4YRRA 2I4MA 3HYLA 3QVWA 1YOBA 1CY1A 1TZMA 3VHQA 4AULA 1YONA 5J4LA 2NADA 1TQHA 2H9YA 5IFKA 1WQ1R 1DUSA 2VP0A 2OEPA 5EE3A 5B36A 2X8JB 3DAYA 1SB8A 2CLFB 1D1TA 2C2DA 1HFKA 1PT9A 1RFLA 4RB2C 2FXIA 2BM9A 1GUZA 2NMVA 2EGGA 2YJ5A 2Y1DA 2IUSA 4HDAA 1TUIA 4BFLA 5KI6A 4XTCS 3K0FB 1KZ6A 3VKWA 4EB3A 1WU8A 2QOEA 4YUWA 3UH1A 4ESEA 4QXMA 1WOYA 2V03A 5JO0A 4CW7A 5L3SB 5GY7A 4O7YA 1JROB 3FH0A 1KA9H 4MAFA 2WOJA 1X7YB 2Z30A 4C1NA 3OCCA 1NU6A 3AERB 5LMUH 3DE3X 4MKRA 5FLYA 3BRCA 2WFZA 2P75A 3RSZA 2BFDA 1ZI8A 5GGXA 1ISPA 5HR5A 4HZIA 3L7KA 1AK9A 2B35A 4IMRA 2KE5A 4MGZR 4RS4A 4M7PA 2EX0A 4ZXFA 3UWDA 4S2EA 3UJPA 3K96A 4YK7A 4BFSA 5ANRB 2CDCA 2O3SA 4L7VA 2XVMA 5T3YA 4RABA 1QPGA 4P31A 1OC2A 1E5VA 2GEJA 1RCFA 1E6KA 5CVTA 2X86A 3P1JA 4GMDA 2P35A 1CE8B 3W9YA 3CIFA 2HJWA 4X71A 2RBKA 2FKAA 3QTLA 5AVUA 3FFWA 3VTAA 5BVGA 4FN4A 3UKOA 4QOGA 3Q5EA 2H18A 1ESZA 5I7OA 2GN1A 3SNOA 1P19A 2IIQA 3A1SA 4KSYA 5FEMA 1ZN7A 4YV0A 5AKEA 5K3FA 2FMTA 5TPWA 3LMKA 3QMVA 4LFAH 5FUMA 3SFVA 4GC6A 1NNI1 3I9LA 1UQRA 1MJHA 1FDWA 2PFKA 4GEGA 3W8RA 1B1AA 4KWEA 4WESA 4M1WA 4KKXB 4MUBA 4H0NA 3WMRA 1M8KA 5C5JA 1QPOA 2JI6A 2IYWA 1E8NA 5SYNA 1V5FA 5AKHA 4X8OA 1Z73A 4E08A 1OBVA 1S8OA 1ZQ9A 3ZCQA 1TOAA 1Z0IA 4MEJA 4XDHA 1LDEA 3OH8A 2HVRA 1Z8NA 3WV4A 4OQNA 1T9CA 5HCIA 1IJKA 2VWGA 1RZ3A 4KTVE 5EKUA 1OVGA 4RA6B 3TZ6A 1ATIA 4OGLA 3F5MA 3BMOB 3V6HA 1S0OA 2I8AA 1BCSB 1JLRA 1GVNB 5BUQA 3TZCA 4QWWA 4K26A 2H1CA 2FGKA 2VAVA 4D98A 3LL7A 3TAHA 3LPDA 4UD2A 3NHJA 1QYWA 4B1FA 5BN4B 2C4TA 1AMOA 2JA7G 5ERYA 2A2ZA 4G4IA 3VO1A 5DHFA 1F2TB 1NF2A 1HEIA 5JFOA 2AIRA 1JLMA 1DBIA 4YJDA 5EQTA 5KJ6A 2D0DA 1C3XA 3CZ5A 4NG4A 2QTVB 4RFSB 2HJ9A 1QIIA 4HYTA 1K5PA 4QQKA 4E5UA 5GOZA 2G67A 4MR9B 4I4TB 3LUAA 3N2GB 4DLVA 3A6LA 1EVJA 1JAZA 1XQ6A 1SM4A 4KGZA 1SVNA 4LK3A 4RKWA 4E2YA 2DIKA 2D1FA 4CE6A 2FFRA 2AKAB 5DCWA 4NNOA 1UFRA 2WK1A 1PJBA 3KM0A 4B83A 3OSUA 5CDGA 1N5JA 3PZPA 4Q0MA 4UCQA 1YDHA 3WGGA 3TK1A 2RK6A 3U61B 2C61A 3DC2A 3EMVA 3AR7A 4HDNB 4CM8A 2IOFK 4ZRMA 1AK2A 1RYYA 3DV0B 1T6XA 4ESOA 3VPAA 4M0LA 1WF3A 3C3JA 3PO3G 1J8FA 4RD3A 2H2AA 2X4GA 3BDIA 4I6JA 1SIWA 3FG9A 1X2EA 3MJSA 3S24A 4E3WA 1OXBB 1S4MA 1KI8A 1BYUA 4D9JA 3FB4A 1WXDA 5KVSA 1BE8A 4EQ6A 5K0SA 4UU0A 3FHJA 3CNHA 3NYQA 3RIHA 1U31A 2P79A 3KZMA 4M1SA 1PJAA 1SUEA 1HE2A 1K4KA 2VHTA 1M2EA 1TW2A 2EG9A 2Z6VA 4G5OA 1A2KC 1N3BA 1XCOA 1UBFA 1SURA 4B79A 5K2MA 2A35A 4AG3A 3W34A 3L82B 3SBXA 2ZIXB 1QH1A 2YFKA 2Q2OA 3QLVA 1JEQB 1TRKA 3RHTA 5B2FA 3PQ6A 2VYVD 1UMCA 1XO1A 1XTIA 2R4UA 1H8ED 2X76A 3Q15C 1T8WA 2IS2A 2PNJA 2Q62A 4B9AA 3OLZA 1FFYA 1XC7A 1QAPA 2PH5A 2B6HA 1FX0B 4QHTA 4I7HA 3PKJA 5AW2A 4HEA6 4BLOA 1YL6A 3SM9A 4C4ZA 3R3ZA 3GLIE 4Q4HA 1SU6A 3D6AA 3SX0A 2QMEA 1PFVA 1AH2A 2QSUA 4I1UA 4CLRA 1L7MA 1XNRB 4I1VA 2Q2WA 1LX6A 4TMKA 5JCJD 3IHTA 4DRZA 3T7EA 3G13A 4WCFA 4PG8A 3BFKA 5LVAA 1YXMA 3CH6A 4A5SA 4WCDA 1BRTA 4UBKA 1WB5A 1U9YA 4BB0A 1Y1SA 5I7SA 2H1LA 4KFUA 4DLZA 5HIKA 1RZRD 3A26A 4NHOA 1RWWA 3HB7A 3PJRA 2EJVA 2FMFA 1HK7A 4D9KA 1J97A 1IRXA 3RRMA 1Y37A 5LD2C 3OZVA 1S03G 5IRCD 5JS8A 4UEQA 2EF0A 1GTJ1 3WGVA 1I3MA 1M90J 3CRZA 3HB0A 3AVOA 2WYOA 4DV1H 1ETUA 2AVDA 2WLSA 1S3SA 2D7CA 1PUXA 3K6SB 3D59A 1QPQA 1E3WA 3U5TA 3DMTA 1KJ8A 1I30A 1VBGA 2R3SA 1CIJA 1L5WA 5JYDA 2PANA 4L6CA 1Y5LA 4KVFA 4OBEA 2CXQA 2GS9A 2H08A 2WWVD 3PWTA 2P8SA 4JLSA 4X6YA 2L42A 4AJLA 1NQXA 3T9EA 2BUAA 1FVXA 4O02B 5CA0F 4L8FA 5FO0A 3RJ5A 4DPLA 3ETNA 4KDEA 3ZU3A 2II6A 2DB3A 4O1IA 2RGNC 3HWX1 4URXR 4JC0A 5FA8A 2UZ4A 1DFGA 3R7SA 3MRTA 2CMFA 2VK2A 1P0IA 4TLLB 3UWKA 4AB1A 4V2IA 3U9TA 1JIKA 3BQ9A 3AVUA 2BP7A 3C3AA 3TIGA 2FZWA 1N48A 1IBMB 3IT0A 3C24A 1UZMA 1DAMA 2AXQA 2WT4A 2GXQA 3IN5A 2R8JA 1VOTA 1KZHA 3RRZA 5AJHA 5JANA 4ITUA 4WLNA 3VOTA 3IV6A 4LJ4A 4QYWA 4I3GA 3DZKA 3K16A 1MC5A 4HRXA 2V5AA 3OT1B 2XQIA 1QP7A 4KRGA 1JFLA 4MO9A 5B1IA 3GPCA 3FVWA 1O87A 4TWAA 1YFLA 4UAVA 1ZA2A 3RVRA 1F51E 2D5LA 3O8OB 2FXVA 2XUPA 4L8LA 4OB6A 3L1KA 2AI2A 5FTKA 4KB5A 2ACVA 2ZAIA 1W1UA 2IX3A 4EMSA 3PAJA 2CV2A 3ZLUA 4J9KA 4KIFA 3M4IA 2XCIA 3FNRA 4L08A 3CH5A 3QXCA 3LPLA 1MBZA 2ZRDA 5DOVA 3LTNC 4Y2JA 3N75A 3QLUA 3WRYA 3EF1A 2FEXA 1U0JA 1INLA 4RL6A 3RLIA 2YJ4A 2ZUTA 3GDWA 2YY6A 1K89A 5JMPA 4ZAYA 4I8DA 4KKVA 2H4ZA 1MFPA 3Q8QB 3KVNA 3TUZC 1GCIA 4NCBA 3QX3A 1AZYA 4B8WA 5T4HA 1XMQH 5DXJA 3CSWA 1V6CA 4RHFA 2CLOB 3F3KA 3CNNA 2JFUA 5BPFA 3H9GA 2H6EA 3UXYA 4N7RA 1DIOB 5KTNA 1OGYA 4C2UA 1P7YA 3AIKA 2ZUEA 1XTUA 5HUJA 3ZEAA 3REGA 1UKBA 5COAA 2FMXA 4IQ0A 1Z2CA 4OGWA 1E2HA 4Y8VA 2WINI 2JLBA 3Q72A 3PENA 1CUSA 3ETDA 4M9UA 1K7CA 2A0UA 2A8YA 5LOVA 5F9LA 3B70A 2ORWA 5DHAA 5KFYA 1DJLA 2N9UA 5TMEA 1H5QA 4UBIA 1WH2A 2ALZA 3O3NB 3QP9A 1VMEA 4OJTA 1G5FA 4N5MA 1G7SA 4IVPA 4FILA 5CAEA 5HUHA 2GHRA 4DJFC 5BW8A 1R6AA 1PT7A 3QUAA 4YP9A 1LUAA 5ARDA 3LBYA 3PSHA 3N6RA 3GBSA 3MG9A 2V9PA 2AA3A 3GYBA 4EZBA 4DA6A 1YBFA 4G1FA 4WUTA 4WKPA 1HNXB 3E1SA 2C9YA 3TTTA 5LKAA 1VL8A 5C3MA 1RBYA 4WXEA 1NV9A 2QMHA 2VCYA 2ZRQA 4URFA 2I8CA 4LGCA 2JKVA 4FMBB 4TWZA 3UENA 1QDUA 3ZU5A 1SU8A 2XPCA 4DLUA 4RK4A 4J1NA 4GX1A 3JATB 1JJVA 4P22A 1LJUA 1P5HA 1YAJA 2WU0A 2EZ9A 1TGYA 5FA6A 3ZE6A 1E2MA 4MP6A 4Q37A 2AZDA 5KTOA 3QVKA 2QMZA 3C6BA 4LWZA 1A8QA 2QXTA 3AY3A 2W37A 3IO5A 1CW2B 3DDNA 3JW8A 1SBNE 1WXFA 2ATLA 1TCUA 4IEFB 5JNSA 3HJBA 2I33A 1PGPA 4YRIA 2R8EA 4EDHA 3BFJA 4MV1A 4A3MG 1M83A 4YECA 3TEFA 2VT6A 2PR2A 2V4RA 1L5GB 2PT6A 2BPOA 1FDIA 4E2ZA 4PYIA 5B57C 3QYAA 2M32A 1C7ZA 1XCMA 2BT4A 3MUEA 2AYYA 2B78A 4R9RA 4NIMA 1CS0A 4HBGA 4IV5A 1T43A 1TLLA 5TPZD 4IIJA 4GLJA 4D56A 2HUNA 3T9CA 3FPAA 1JWLA 3ZHSA 4PGAA 3U44B 2B34A 3LSTA 3FBTA 2B5WA 3BD8A 2WMOB 3BL6A 2NO5A 3PEEA 2C4HA 4Z4IA 4HBZA 3QF4B 5F9FA 1CWUA 3DE4X 3KFLA 2BFBB 4RGVA 4YUYA 3GV5B 4ZU1X 1JIVA 2I34A 3TY9A 3DF7A 5DRYA 4G0MA 4PANA 5KT3A 4RMJA 1J5EH 3ZHCA 5KFPA 3IBFA 4JGBA 4NE7A 4P38A 3PFFA 1VL6A 3O2JA 3PX2A 4ALLA 3IUSA 4DF3A 4F5WA 2V65A 1OMOA 4ZT4A 4O7RA 4O59O 1J1ZA 1T0UA 2VTEA 2P30A 4KLZA 4YRAA 5KX5B 4UVHA 1U1FA 3ZHRA 3OMLA 1SKAA 4KP7A 5EP2A 4G5FA 2GUWA 1E4EB 2FPGB 1KT8A 1VKRA 3VR5D 2L19A 4OI2A 1X7XA 3ZE7A 1EXDA 2WM8A 3KHUA 3PW5A 5BVHB 1FYVA 1YRHA 2OBYA 3FR7A 1GADO 4BFVA 2VNHA 4TYWA 1SCNE 3FZNA 1NXPA 4L6IA 3NQ41 4LC1A 5LYJA 4XGNA 1IK4A 2ONJA 1XTBA 4ZO6A 2E21A 1G5IA 3GRCA 4R31A 1CF9A 5T6BA 4IWXA 2RJOA 4KGVA 3HUEA 3ZZMA 1M9NA 4QWAA 2AKEA 2A1TR 3GJ8A 1IH8A 4BAUA 2BGRA 5IJ0B 3ORYA 4X1IB 1QG2A 4H7DA 3AZPA 5G4KB 1PX0A 3C5WP 2I4TA 1VLJA 4DC1A 4N6NA 1HYGA 4TYPA 3NC1C 1FMCA 2R5NA 3THWB 2QE7D 4FR2A 1E6CA 3R1IA 4KXYA 3EUEA 3GMSA 2FLKA 3N8NA 4EYKA 4ND6A 4RH0A 1PT6A 4ZFNA 2APJA 3HO8A 4CMGA 2CUTA 1DJNA 1SD5A 3QKRA 1BTOA 2Y67A 4FIDA 3O47A 2C2XA 3T5CA 5FBVB 3FLBA 4AP8A 5DG8A 1E8MA 2F9LA 3URMA 1HEYA 3CWQA 1QGDA 2G9QA 1E3TA 1JHVA 3KJZA 5IG2A 4GXTA 4QGFA 3U3KA 1NHGA 4MHTA 1SAYA 4BO7A 1TPZA 4BVKA 1BW9A 1TC1A 4IJQA 2W7PA 1EVEA 5I7VA 1I50A 2RGVA 1BFUA 3S81A 3ZY4A 1O96A 3NIGB 1SUBA 3OECA 3DMRA 1WB4A 4K1LA 3NT4A 1JTFA 3K9LA 1CR0A 1D2NA 4P3YA 1JHDA 2NYAA 1AN9A 5DPMA 4E13A 1RXCA 2A5YB 3ZCSA 2XV1A 3AL3A 4FDAA 4IJ6A 4XGIA 5CFRA 4NCKA 3KEQA 5AW1A 4ENVA 3W5CA 3R6TA 3UC9A 5F78A 2CJFA 4R41A 3U56A 3AM1A 3O0DA 4YLYA 1R9GA 3AR4A 1EVKA 4EHAA 5KFIA 1K88A 4OO3A 1UBUS 2WJ6A 4FHEA 3W8DA 5IAAA 3RJ9A 3OUUA 1C9NA 3KYIB 1Q82J 3B2QA 5LOVF 2WIAA 3KK0A 3EXHC 4MGYR 3PXDA 5CLJA 1OWNA 4FMDB 5LM3A 3OKAA 3G23A 4YMTA 1Z68A 2FOLA 1XRNA 3IXQA 4ZI2A 2O54A 3DE2X 1MV5A 5CHEA 5AYZA 2GAIA 4J9VA 4M0PA 3EA4A 4QBTA 2VHXA 3WHIA 4J0HA 3L7DA 4ND1A 4EEXA 4TS9A 3S7TA 2KYRA 2CMGA 4P0PB 1M6NA 4BGVA 1A8IA 3CSUA 5ALKA 3EASA 3FTFA 1O8CA 3W9BA 2V7XA 2J45A 2H52A 5A6VA 2NGRA 3QEMB 5DNDA 2PGAA 4HDMB 5AM3A 2HOQA 2GXSA 1NM5A 4RS3A 2R47A 1BDBA 4OQYA 3LUHA 4KLRA 3DNMA 2WUFA 4RVOA 1R64A 5KVAA 2HB6A 2NVOA 2B1IA 1DL5A 1WF6A 2HQOA 2QAGC 4G25A 3TF5A 2DHEA 1P17A 4J3FA 1NPYA 3TKLA 5FPQA 1CFJA 2FPWA 3G7NA 3X1XA 2QA4H 3X2EA 1U1DA 3WGOA 4OOFA 4UEWA 2Q6TA 4JLWA 2GNPA 3R44A 4BE4A 3UFBA 1CJUC 4IH4A 3FDZB 4M7RA 3MCVA 1JVNA 2Y2VA 2VEDA 2BCEA 3GUVA 3HKEB 1GAWA 1E4YA 2P7HA 1WSCA 3E18A 2X3YA 1ULUA 4OI1A 1AURA 5EWLA 4JBWA 4C7VA 2EHJA 4UE6A 1AG9A 2IT1A 4AW9A 1E99A 5C53B 4YHHH 5HYVA 5B12A 2IPNA 3BK2A 2AR9A 1TQ2A 1W46A 2H48A 3QUCA 3ZXXA 5CB4A 4JODA 1PHPA 4IIJF 4LHEA 3PUXA 1EUQA 3LGAA 5REQA 5BWCA 4GMFA 1TLFA 1ZS9A 3IR6A 1YE3A 3KETA 2X0JA 4F5DA 5KFDA 1JX6A 1JTEA 3M6IA 4UUPA 2ZREA 4OHKA 3PYMA 2HPHA 2GZDA 3BCSA 3KAJA 5KFHA 1D7AA 4KQ9A 5IKMA 4LJ5A 2C88A 1NBME 4YRJA 4BLRA 1DJQA 4LFCH 3C3MA 5BNFA 4EG5A 3VR4H 1ZN9A 3ED5A 16PKA 4LXYA 2P8JA 4HNTA 4B3JA 1KZGB 3JYLA 2GO1A 1Z4MA 1VGVA 3HGMA 1F0NA 5JD4A 3KYDA 4RSGA 1R0LA 5SZKB 1VM6A 2ZG6A 4D0RA 4RTNA 3FWYA 4HNGA 4I46A 1IG3A 4I1PA 3L02A 1PJZA 1YI0A 5FPHA 3LUPA 2A14A 4IDGA 4MB0A 4DSNA 5JXHA 3AF1A 2WMDA 3H1PA 4PCUA 5AVVA 2BMFA 4O7LA 2FX5A 2QVYX 3IE2A 2RARA 1KPHA 4ON9A 1KJJA 2R6HA 2FZ4A 1FTQA 5HUOA 4EA9A 3DCJA 4HGPA 1A9ZA 2QW1A 4MV6A 4MW4A 3RRFA 4CEHB 3W4KA 2XYRA 3OX1A 3VV2A 4WECA 2PWYA 3GLFE 2RKWA 3TUIC 4MLPA 5FH9A 1THGA 2ZPTX 2BGKA 1S7GA 1I3CA 2M6SA 3AXTA 2XRFA 1MIHA 3ZNOA 4HFMA 3CUYA 1UMDA 4DQXA 1HQCA 1TWHA 3AJ8A 1M1YB 1RRVA 5GAHN 1P9RA 5CR9A 1OLXB 3LNTA 3NM4A 4I6EA 2E5LH 2L82A 1F9EA 3J80W 4ZTBA 1Z0FA 4UDNA 3ZHBA 3EY4A 2PFSA 3ZHZA 1ISHA 4GVPA 3D7NA 4C7MA 2OCDA 2XODA 3UMMA 4GC7A 4UHCA 3GH3A 4NFSA 5JD3A 3EEQA 3EPLA 3X2SA 1J24A 5IBCA 1YSCA 1RYNA 3OUTA 3VOBA 4WXPA 4LI3X 3R09A 4WHXA 2G4VA 3AEUB 3JWHA 2RDJA 4QGGA 1AN7A 2VJBA 2WMYA 1H2AS 2IOHA 1KYZA 1GXSA 3E2IA 2VHJA 4EW6A 3DKIA 5FHQA 1G5QA 5L9XA 1KSGA 4DCTA 1GUFA 2BR0A 2O2XA 3T7AA 1I5OA 1KZ7B 3PW0A 4C76A 4EL5A 3BCUA 3J81W 5F12A 3NP9A 3BD6A 5H9WA 4JLUA 3WBJA 2G7ZA 1YI1A 2EYUA 1WS6A 2J9XB 4DTIA 3L84A 3QYFA 2W6OA 2XQVA 1W36D 2ISSD 1P1CA 5DQGA 5CEFA 4GF5A 2JCXA 1KQGA 2C2BA 4ILEA 4UOQA 3WAJA 1GLVA 4V03A 1UDBA 3CZ9A 5DEOA 4MW1A 4XRRA 3RREA 4BX0A 2BYTA 4IDNA 4W1SA 1AO3A 3MJEA 3Q3JB 2YU9A 2GBCA 1E18A 4IFTA 2Q3HA 4B4DA 3ABIA 2JFPA 3FMGA 3OPYI 4EI7A 3HI4A 4RE6A 4I4IA 2NXWA 4WNIA 3OCUA 2YKGA 2VF2A 5IAOA 4B3CA 1WPRA 5JJKA 7ABPA 4QGHA 5LQMA 1UL1X 2PTGA 2VPTA 2P69A 2IOQA 3CLVA 4D9BA 5A5EA 4JH0A 2BR4A 3A4NA 3BS4A 4ZOHA 1O95C 1Q7EA 3VPBA 1G6Q1 1OUMA 1HBJA 1N2ZA 3X1DA 5AESA 4PG5A 4UHHA 4HH1A 4L5JA 4WW0A 4LV6A 4GGOA 1YIOA 2O8VA 4HQ6A 4XLTA 3CF0A 2J5BA 5ECWA 4DL3A 3VR4A 3G02A 3FW1A 4JB3A 4O3SA 2R6FA 3ZQKA 1KAHA 4QFCA 2JBAB 3HSSA 1I4DD 2CLCX 3HKCA 3E2PA 3TZBA 4TUYF 2FK1A 1SQ0A 2HRRA 3Q2KA 2FEKA 4ED9A 1EP3B 2WG0A 4NATA 4JVOA 3HKBA 1XTSA 2CW5A 3IPAA 3AM5A 1YOVA 4YMGA 2ZTVA 1GG2A 4IOAJ 3CT4A 2BC9A 1H9AA 4CM5A 1PT8A 4FDLA 4DBVO 2JATA 2YWBA 3U48A 4EKDA 1P5ZB 1H6BA 5A4JA 3SQWA 1J7JA 1QZXA 4TS3A 4G26A 1JQAA 4NZMA 1V37A 4U02A 5J4HA 1HKHA 3HKZE 5I45A 4N9WA 2R1ZA 3C3DA 4JI2H 4C3ZA 3DE0X 2AU0A 3CQ9A 3ZU6A 5JDCA 5CB4F 3MWDB 4IINA 3OTOH 1US8A 2WY2D 4DM4A 4PHTA 4MVJM 4DV0B 3QE9Y 3H8WA 1B00A 3GI1A 1GNTA 2W4MA 3K70B 3HWWA 3HZOA 3HJAA 5JBIA 2W6JA 4FIZA 2A5JA 1DX4A 4U6NA 2IUFA 5EWMA 1XVUA 1RSZA 1LZKA 3C3BA 1VPEA 4JYPA 1F2UB 2VC2B 3SJUA 4M7WA 2X9LA 1YB2A 3W3AD 4JQSA 4C7BA 1VA5A 4KODA 2C3YA 1C2TA 3QX9A 3U3XA 5ICEA 1GL9B 4J0KA 1HV8A 1TMYA 4DKJA 3DMNA 4UC0A 5IF9A 2WWRA 2CD7A 3QZUA 1DELA 2ZBVA 1JFFA 5E1MA 4FVTA 4YT8A 3O3OB 4RENA 3K1ZA 1UBHS 3WLSA 3ILYA 5KQRA 5CM2Z 2AGPA 3RGXA 1XK7A 1PKXA 2QUKA 1BE1A 1RZVA 1N6OA 4CKBA 2PU7A 3GEPA 4ZCTA 4CF5A 3TZLA 2BH9A 3WNBA 3FKSD 4GUDA 5KG2A 1U0SY 1R4ZA 1NSFA 1QRUA 3I9KA 3KWFA 4M53A 1CKNB 3V1NA 1NYQA 2RGBA 1RJGA 1ZM4A 3NP7A 4X20B 4E94A 4KO8A 5G1OA 4Y0AA 2IVZA 2EARA 3ZJ4A 1T4BA 2RGWA 1ISIA 1Y8CA 5HNKA 1IULA 1GA1A 1KI6A 3GRVA 1U81A 1HFJA 2HIVA 4IXDA 1A7KA 3P9XA 4O3PA 2O7SA 1EDZA 4W6ZA 4WZBE 1VSTA 2HWYA 2C5BA 3G0HA 4FB4A 2E2IA 5K0TA 1ZISA 4R2KA 3ILHA 1RS0A 1SIOA 2FHSA 5BWUA 1JVBA 3UT5A 4PYMA 2VL7A 2WJGA 3OZXA 1DADA 4PN3A 4QPPA 1DSSG 1XTJA 3JXEA 1ECFA 3A31A 1TM5E 1Y4AE 1FNCA 2ZRHA 3SFTA 4QELA 4GG1A 3V42A 2I62A 4P5PA 3N8KA 1YS6A 4MR7A 4YR9A 1YRAA 1WKCA 2OCLA 4ZD6A 1REQB 1CETA 2V1UA 4ID9A 2XECA 3FPLA 3GPIA 4LE2A 4DV3B 4CG2A 4P92A 1A04A 1X92A 3RAFC 3MBIA 3J81k 1C3EA 4KH0A 1M67A 1X7ZB 5DIFA 3QK7A 4P5EA 1CUUA 4UM7A 3TTUA 4TKVA 5AW5A 4PYKA 3STUA 3P5BA 3LWNA 2IOYA 3V7NA 5L1IA 2PYDA 4RC9A 1P18A 1ZUD1 2O48X 3AFMA 1VZ3A 3NDJA 3WKCA 1EE9A 2QQ0A 3H5LA 4BAGA 4LI0A 4BX3A 4HWRA 4LHMA 5C51B 3AIIA 4WWHA 1FE8A 5EXEA 3BK1A 3J7ZM 5ETJA 1JLHA 4KMOA 4LOLA 2C57A 1XZNA 3HYNA 1M2HA 3M4ZA 4WE3A 3N8IA 3O1HB 3U37A 5T5QA 4JSTA 1G7RA 3EGXA 5IAJA 1U0LA 3CX6A 3EF0A 4UVEA 3GJQA 3NUAA 4BV2A 3VOSA 4GQIA 5ALHA 3VNNA 4JL5A 2CNBA 3D6VA 2BMAA 4DUZH 2RCYA 4YC7A 3L7OA 1W4LA 3V1UA 1L7BA 4QGBA 4D8WA 2VR1A 4OU4A 2XWQA 4O7VA 3LECA 4XAQA 3NPMA 2JL1A 2P2CA 2YWHA 1NW7A 3TBKA 4X63A 2XTJA 4GWGA 4OHZA 3A2MA 4LYGA 3P9CA 5BWVA 2HIMA 4P2GA 5HDBB 2C42A 1UOQA 1UBNA 3TWOA 4FKBA 4UATA 5JNUA 3EVZA 1IEWA 2BEWB 5EJ6A 4Q66C 1CNMA 3M5WA 1LPPA 4D41A 3NTLA 3ET5A 1RYRA 2HMSA 4XM0A 1IUNA 3L4BA 2DQZA 3UG6A 3MOIA 3MXOA 3L8FA 2PSFA 3O92A 5LMZA 1QHXA 5GGYA 1I2BA 3HXOA 5J5VA 3RT9A 4ZKEA 4A2AA 3BJZA 3JQGA 1I36A 2V8OA 3MUFA 5KMGA 4L3OA 4BC1A 2VPSA 4OJKA 4B85A 2JHAA 1TNDA 3U4AA 3EFEA 3EPJA 1X74A 3IKMB 3PDCA 1GKIA 1ANKA 3BWYA 3MILA 4YCBA 1PK7A 2PUHA 4Q9NA 4I2VA 3TMAA 3W3ZB 1I6KA 1WB9A 3G5UA 4LY9A 2VF7A 2ASJA 2D1YA 2HHFB 4UVDA 1U4NA 2I3DA 2HDOA 2XTNA 4NK5A 4Q9IA 4TMZA 3TNDA 1RLMA 3U4QA 1WMAA 4AX8A 2FPIA 4PC6A 1JI0A 2Q6KA 2OB1A 3VBCA 3V1KA 2AS0A 3IEKA 1VLLA 5GONB 2X2FA 1N0VC 4AJHA 3H97A 4MUGA 3BKWA 4OHYA 3I55H 3U17A 2ZAYA 4ZMSA 4AFNA 4G07A 2ROQA 3O3MB 3R0XA 4PAWA 4UAUA 3WKEA 1XNQB 5F33A 4LUCA 5B30A 2FEMA 4XARA 3ENVA 3G6WA 2ZBEA 3MWJA 2J6BA 1NN3A 4JA2A 2O0LA 3ORSA 4A26A 2VPYA 4GM4A 4UUAA 1DAFA 3FYUC 1LSSA 2PNFA 3DZDA 2XUQA 2FCAA 3WYEA 2QP4A 3DYVA 2EW8A 4BFXA 3INNA 1KS9A 5FQOA 5FUVA 2CKZB 2A94A 4B4KA 4DMKA 2E87A 2OECA 1W2HA 1W581 1OKKD 3HVKA 4IDDA 5K8UA 2RIPA 1B2LA 4YAKA 1Y69K 4ARSA 2GEBA 1QWSA 4ARCA 1H93A 4I0WB 3DQZA 4RFLA 3UAXA 3FPSA 2C9BA 3DBRB 1HTTA 3MLAA 2XXAA 2XHZA 4LTMA 3I2JA 1J1IA 1XDBA 1D3AA 2BEJA 3J7TA 4J16C 1OI2A 2J7KA 5AM2A 4RADA 3EXFA 1U5CA 4RDIA 5KYYA 1I10A 3BSWA 3LUGA 3ICQB 1XMPA 1YK0A 2Q28A 3ZLBA 4LHVA 1E4GT 2QRPA 2HADA 3QY9A 1L9XA 3GV7B 4ND5A 5HBRA 1FFUB 2AQKA 1NY5A 4I1SA 4UFOA 4HB0A 1JEDA 2IHJA 4XZ3A 3DPIA 1IBSA 2CB0A 1HX7A 2H57A 1P1FA 2P9BA 3B6MA 4JC5A 1XDUA 5BV8A 2Z2XA 1WETA 1N32H 4LV5B 3TSOA 3EZNA 2B0JA 1Y3CE 4NENB 5SYAA 3KLMX 2UUOA 4A0QA 2D1RA 3B9BA 1AGYA 1V96A 2PRYA 1ZW6A 1CY6A 1JMVA 4LF4H 3BGVA 2FEOA 4YB8B 1FSZA 3JR3A 5KDDA 3AHHA 3KL4A 1R16A 5KFCA 4ARZA 1GNVA 1FRFS 2WJYA 5U1PA 3FHCB 1SULA 1QFYA 3TIVA 4JYAH 3W0LB 3IE0A 4X3CA 4P0QB 1DGJA 4XD7A 5CVEA 1MF7A 3R0ZA 1WQ3A 2H7CA 4D25A 1OAOC 2JGJA 1EDEA 2FW8A 4F9GA 2REQB 3RVNA 1HZZC 3B9JC 5IAKA 2EV9A 3OTIA 2BM0A 4KG7A 5CA0A 1D9XA 1RLTA 4GM0A 2HCTA 4YMVA 3FZEA 4ALNA 2O0JA 1QNFA 4ZVQA 2BZ0A 4U0KA 4AT1A 1GCAA 3PEVA 1LZLA 1W0KD 1SHJA 3L8YA 4CM4A 4F60A 2BKAA 1YHQH 1Y81A 2VJMB 1MNAA 3NI2A 4PGGA 4FUQA 4FFBA 2WYVA 13PKA 4PLWA 3FOFC 4AF8A 4GRAA 3BTSA 2OTCA 3UN1A 1Z4KA 4EAFA 3TQCA 4DL7A 2DSNA 2J6IA 1KE2A 2QUBA 5K0LA 4GYYA 1M1UA 5FR9A 2WDPA 3ZHYA 4HDRA 2F4VB 2DUJA 1KWGA 3D3KA 2RC6A 1TF5A 1P0MA 2QRVB 3PLNA 3GEBA 1TZ2A 5F3WB 2ZBFA 3HSKA 5HRUA 1ZIYA 2VHYA 5GZ1A 4MV4A 3CLUC 3TLMA 1R27A 4FFMA 3DO5A 2H5EA 3C2RA 1CUYA 5J2TA 4C43A 3MR5A 2PUDA 2ZW9A 1NW3A 1QO9A 3A04A 2JEOA 2YJTD 1W9HA 1ID8A 2OD7A 3FUXA 4QJ3A 5LP6A 2BSQA 2K7FA 2J31A 1M2GA 2O8DB 3JYNA 5DTIA 4N0DA 2JGKA 4EABA 3QBJA 1PJTA 3TMKA 3VH2A 1GZ6A 3H83A 1O9GA 2Q5WE 4X65H 2JGMA 2WSSA 4AWXA 3C1TA 3REFA 1QDEA 5LKRA 2X8WA 1ORVA 4QJ4A 3HUDA 5MFPA 2XQJA 3HZZA 4NYEA 1O5IA 3WYCA 1DO8A 1E79A 3D7LA 3CUVA 4ROTA 3OM1A 2ZJ8A 1T9GS 2DLDA 4FYVA 1HMYA 2I87A 2HD4A 4YGYA 3PGA1 4L9SA 1GZ5A 4MEBA 4OHVA 3VZSA 3A1FA 1C0LA 1AUQA 1TQ8A 4B43A 4EGCB 2AUMA 4LYEA 5KYKA 1VIYA 2DHCA 2OLSA 4A23A 2W0MA 1D07A 5FR1A 3AJDA 2BELA 4BVBA 5BR1A 3ODPA 2DT5A 2KBFA 2RAVA 4N3CA 1G3UA 5JLJA 1ECJA 2K2QB 2EBUA 1EWVA 2WWTA 2JJQA 4AJKA 1UXHA 2Q46A 4BU0A 3UVEA 3C85A 2Y9PB 1WXEA 4G56A 1XCLA 2K2WA 5KOIA 2BDTA 4FSDA 1KZ4A 1QO7A 1X38A 1RQPA 3SFZA 3HGQA 4D4LA 3K5PA 4EO9A 2RH9B 1KORA 5BT8A 1CC1S 2A0FA 3HWSA 1GCOA 4HGNA 4NBWA 5KINB 3T5PA 2C3OA 2GYVA 3IKJA 4QUAA 1JI3A 1U2DA 2W54B 4IOKA 3PRYA 2FNAA 4GXRA 4UXHA 4DB2A 1E94E 1NVWQ 4HDQB 2Z8YM 3S3TA 3B3FA 3SZGA 4B73A 4QIWA 1Y5RA 3PFGA 4FTWA 1MAWA 2HVSA 4DCJA 2EQBA 5BQ3A 2AFIE 2QRQA 2OGUA 3F2IA 4FHZA 3CLSD 4K87A 5GM2A 1Z6QA 4HUJA 2FJZA 1JDEA 1ZVJA 2C5LA 3A70A 4PC7A 4WD3A 2EVWX 1RM0A 3U54A 2W8BA 3TZQA 1RMQA 4LNUB 4HJXA 4XASA 5JRZA 4Q12A 5KYWA 1UZAA 6GPBA 1K92A 4UNSA 3CEJA 3Q1LA 3KELA 3HACA 2P6NA 1GKYA 4MDEA 1KTAA 4LYAA 3GFVA 3SZOA 1S1CA 2O7NA 2PSJA 2B92A 3IAS6 4YBZA 1OBHA 5L4LA 3A1CA 2A9RA 4Q16A 3RRYA 2NO6A 2DZDA 5FO1A 3SNKA 1LK0A 5HNEA 2ZCJA 3FZGA 1W36B 1D2HA 3QMMA 1BRMA 3KJIA 2ON6A 2BMVA 3S8MA 3EEBA 4J7XA 2JCYA 3O8QA 4UUOA 2HXYA 4G5QA 1RJQA 1R8QA 5LQDA 3U6KA 3WL4A 1FFGA 4TV8A 5CVVA 1MZPA 2SNIE 2Z3WA 1USUA 3H3FA 2NUTB 1ZETA 2COIA 2YN0A 4WOKA 2DQ4A 3GWZA 4TRMA 1Z0JA 2C9OA 1YVUA 3RB0A 2XCTB 3HBJA 1JEYB 4AZ0A 4D7AA 2J3KA 2GNAA 4TV9B 4BRSA 4WTOA 1SUIA 1Q17A 5TEVA 1O0SA 1S9DA 2WTBA 5FUXA 5FTJA 1K4YA 4YDRA 1A27A 1G3RA 1TJYA 4OGFA 1GAQA 2VH2A 1KQFA 2Y93A 5K6TA 3THXB 3E3MA 3SHTA 1D7OA 5KPDA 3QBTA 2AC4A 1OPXA 5HFJA 2FE1A 3HDVA 1X15A 4DUYB 1U8CB 1YQDA 3TXAA 1CK4A 4DA4A 4Q5IA 3SXUB 2TMKA 3N7UA 3FHOA 4JVNA 4MTDA 1DTWA 1K06A 4XCVA 2ZUWA 5EQDA 3FOCA 4KU4A 3QBDA 1OZFA 3ROPA 3RPFA 5ABPA 3GLTA 4AMUA 5FD5A 2W55B 2BM1A 2PGXA 1SU4A 3FY4A 1OPRA 9LDBA 3OZSA 3MOSA 4FEEA 5SV2A 1UPFA 4RUCA 1EEHA 3FGNA 3IFSA 2ZANA 2B7BA 4Y2GA 1P8LA 4LHXA 2BTQB 3NPAA 4UBJA 1P39A 4BNGA 1QIEA 2J85A 5J4KA 1YJ5A 3GUCA 2LZ0A 1SXJA 2GB4A 2FDXA 3NS1C 4EY4A 5I9LA 4MJXA 1MXFA 4DV6H 1GZVA 4ZZ1A 3EDOA 2WP8J 2AG1A 4QDOA 5AK3A 2JLXA 1ML3A 2O4CA 3B82A 2OCIA 4XGKA 2O8EA 3PDIB 5JWHA 1OTYA 4J9LA 4HDKA 3C8UA 3GFQA 2C5HA 5L7WA 3GGOA 4RX1A 4MRMA 1Z6YA 3QEKA 4PPYA 2QR3A 1E9EA 2W3SB 4L2IB 3MTGA 2OHIA 1I6WA 3PNVA 3ND5A 1EGHA 2O8BA 1PNTA 1N60B 3FZQA 4ABTA 1DDIA 3G5MA 3K70D 2G40A 4YRMA 4V02A 4Q1DA 1XP5A 1WLYA 3P9IA 3V9PA 1A48A 3KAQA 2HDHA 2HZ7A 2QQGA 3LY9A 3C41J 4P3PA 5J2TF 2UU9B 2XUOA 1N36H 2WUGA 3DSRA 3OEYA 1QLHA 4KC0A 4N0MA 3HU2A 1U1EA 1U7TA 1NXWA 1N5IA 5LP6F 2FQXA 4KWCA 4HXEB 3L92A 1I6LA 4RVCA 1RJ9B 3MWLA 2J6UA 2QQFA 3TRFA 2DJIA 4MYCA 4FSHA 3K2IA 5CXSA 1XAGA 1TE2A 1R8XA 4K9PA 1KWKA 1VIAA 2EZUA 2D0OB 3QELB 3F2VA 4IDEA 1UBSB 3EPIA 3DEYX 3HCOA 3L1VA 2GQSA 1DNPA 3OLQA 2JLUA 1VSUA 3TG8A 1NW5A 3C7CB 1WCIA 3LVRE 4I3FA 1KYXA 3RU9A 3WY9A 4TTIA 3PFCA 2WQ6A 2B7NA 4YMHA 4WK2B 1YR7A 1Z3IX 2DAAA 2A0XA 3LTEA 1K2WA 4BATA 2A3NA 5THXA 3CBQA 2AYZA 3I4MG 4RD2A 4G3IA 3WL6A 1M6YA 4B48A 1XDNA 3KAKA 1O5TA 4P98A 1Y6GA 2YINC 4G37A 2FRDA 1XCGB 1OFTA 3NWJA 2EYQA 1UODA 4MQLA 1LWOA 2A58A 4KZPA 4MLCA 4DSZA 1KK0A 3O4JA 3U4IA 3W1GA 2QSZA 4J4BA 3D7MA 1IFXA 2YNMA 2FZVA 2ID9A 4ZAWA 1QQBA 1XEXB 2A92A 5TX7A 3LKBA 1PS9A 4FYKA 2CL6X 4LYYA 1I94H 2W9BB 1M6VB 5DP1A 4PX5A 3A3KA 3AWDA 3MTEA 1FX1A 4HNUA 4V0SA 1AQLA 1FNNA 1BFDA 1ZZGA 3COVA 3D8BA 1W6RA 1SUFA 4O4HB 5HHTA 4NVRA 1UWLA 1U2EA 5E4TA 1U8FO 3VTZA 2AZ4A 2FU5C 3PUIA 4R7RA 1C9EA 2JGDA 3WIOA 4DNOA 3EPRA 4BPRA 5CD9A 2WTXA 4XX1A 2AOUB 2QXUA 4LZNA 1ZH0A 2DPYA 2UZ0A 3PUKA 3JZIA 3HFRA 5AFSA 3H1BA 3FPBA 2VCHA 4B35A 5IH7A 4FGJA 2UUBH 4CC5A 5JY6A 3DTGA 4RKFA 2VPWA 5CT8A 4Q19A 5ER9A 3L0IB 3DTVA 3B8HA 1AZTA 1NYRA 4EFKA 3OJWA 1I13A 1EFDN 4MYSA 4KREA 4ZAFA 1KKUA 2HQRA 2IEGA 1X9IA 3WB0A 2CXOA 4BTLA 4TV8F 3JVIA 1ZGCA 4Y2UA 5IXYA 4MR8B 4L15A 4NMMA 4AXXA 5T67A 3BIOA 4RHCA 3I6ZA 1B6RA 1HDCA 1QPZA 2AT1A 4BL5A 3E22A 3RIZA 2PH3A 3SEAA 2HG8A 1Z15A 5DTJA 1ZD3A 2QU7A 1IYEA 5ENDA 1XWWA 2JGLA 4DMMA 1H0SA 1ZBDA 3AMVA 2GJKA 2CCKA 1W47A 3E61A 2JFVA 4XB1A 5JADA 3DZHA 3G82C 4TYNA 2MYTA 3L7LA 2WJIA 4INZA 3AVQA 4FZJA 3ZWQA 4DL2A 1B1CA 4GU5A 2BEKA 1B6GA 2YRFA 3RSQA 2I8LA 4XFKA 2EKQA 2Q2VA 1IHDA 4FE7A 4I4CA 4WLVA 3AEKB 3NVMB 2QJWA 3WXMA 2UVRA 5M7EA 3EVDA 2EWVA 3VH1A 3ZZUA 2SICE 3FWPA 2CMDA 5CTAA 3QHAA 1BAPA 1WCYA 3H11A 4UVGA 1QC5A 2JA2A 2FCRA 3UA4A 4GW3A 1YB7A 4EB6B 3A2NA 2XVXA 4KXXA 1ISGA 3E48A 1FP4B 2NTNA 2GO7A 4C2MA 1OWOA 3OTGA 4IV0A 1HF3A 2VHVA 5A3VA 1G42A 2IPAB 3P0HA 4LN1A 1UBLS 1Z7EA 5FULA 1SOWA 4LZAA 1YO6A 1G6KA 1NPTO 4HNQA 1VQ4H 3RTXA 4NBNA 4YBRA 4ZT7A 1E8DA 4M83A 4KDRA 3VJLA 3KOXA 1T1SA 2O50A 4JX8A 1A5ZA 3AIOA 3OZFA 3VV3A 4Q4DA 3I6BA 1D8AA 2FI1A 2F43A 4BBRG 4BCDA 1N8RJ 1HE5A 5K8CA 4TZTA 2R85A 1WE2A 3LBHA 2ZPAA 4BV9A 2CNDA 2Z2KA 5EWGA 4OB8A 4O7ZA 3VI4B 1TT5B 5LC1A 4MTLA 2OWOA 4E0BA 1GL6A 3HEBA 2EQ5A 4M7EA 4PCLA 2BKEA 1G55A 3ZWYA 1X7GA 4OP2A 1NDQA 4IHAA 2X4DA 3DMHA 1Y4SA 4FI3F 1V11A 3JQ7B 5EVJA 2IHNA 3T1TA 4IS2A 5HS6A 4GZ6A 4YIHA 4JSRA 4G4GA 3IAAA 3IDSA 3CW9A 3ROQA 3RYCB 1WZ2A 1BKYA 8MHTA 3CCMH 1VG0B 4E1VA 3RGWS 1QTNA 2ZROA 3IQEA 1TO6A 4RVFA 4EJSA 5ELLA 5CA1A 3ZDXB 3ETLA 1V3UA 5JS7A 1XFAA 1TKRA 2B0CA 2MIIA 2VDWA 4YDSA 2ZKLA 5DX8A 2Q7OE 4L50A 3B3AA 4BKPA 1DCMA 5JCZA 1SKMA 2HNAA 3C3WA 2BHLA 4MVYA 3W8FA 4E5NA 2FX3A 2VQEB 1VLQA 2PN1A 4RQBA 4Z0NA 4Z9XA 2XB9A 1CZNA 4HAWA 3CZMA 1MT0A 4QHSA 1CY0A 4NBLA 4QEDA 2AQ4A 2ZBGA 2H4FA 5E9JA 2NU7B 3F73A 2D62A 4LOAA 1H65A 2G76A 3RS7A 4W8OA 4QU5A 5G41A 2WD7B 3KSMA 3THYB 1CKEA 5TV2A 2J9RA 1HDEA 4CIAA 4LXGA 2ODBA 2FR0A 1QH9A 2Q1UA 4M1KA 4ZK6A 1NJFA 1SCUA 4WGGA 5A5GA 2H8GA 2OKCA 4R84A 1RQLA 4OQQA 1QYXA 5FL7D 4EYOA 1YFZA 1G60A 3NWPA 3O4VA 3Q0TA 1Z4NA 5BN3B 4PTLA 4KLCA 1WMFA 4DR6B 4H3HB 4H7PA 1OD6A 4KFRA 4ACAA 1JFVA 2XE6A 1TAQA 3F3YA 1QLWA 4TL9A 4TZKA 4MVJE 3BFPA 1FSGA 4IXTA 2AK2A 3KZKA 4J9NA 4B3GA 3PGKA 1JAIA 4PBCA 3LCJA 1GOTA 3H19A 4TUYA 4LYDA 5JMTA 3RAPR 4PLFA 1JE1A 1P0FA 3BGIA 4ETMA 1DKOA 4PONA 2PX8A 1V35A 5LQUA 3P4UA 2O2HA 2FEAA 3Q6NA 4CQLA 1KFCB 2HIAA 1D6SA 3WG9A 3OIWA 5G3ZA 2OUKA 2QM8A 4Q01A 2WDTA 2P5YA 4N49A 4AZSA 2VJYA 5J2UB 3VMFA 1TL7C 2VFAA 4YAEA 4BVGA 1Y1KE 5EUQB 2OYCA 2FW0A 1E1CB 1G18A 4GVLA 4O4IF 2D2VA 1CR2A 4A10A 5LR6A 4D82A 3D3WA 1CFZA 2YV4A 4MIOA 3RF7A 1YQ9A 2CJXA 5EJGA 2OHGA 4OXYA 2F9MA 2ZJQJ 3RJ0A 1I3OA 1D09A 2ZBQA 3GL9A 3LC1O 3GG9A 3EQ6A 1U7WA 4TMXA 2M6RA 3UCFA 2VATA 2E49A 4PQRA 5ALSA 2I1VB 1ADBA 2GBLC 3X1WA 3AHCA 3ZCRA 1II8A 1CDEA 4DUGD 2FMKA 4B81A 4P4UA 2E6UX 3ILSA 3CGGA 1N75A 4ED7A 1K5GA 2VDRB 3N05A 4PGMA 3F6EX 4EUEA 3LDUA 1IYZA 3QA9A 2GK3A 4X7RA 1QF6A 4MUNA 4OHWA 2E89A 2IZOA 1J0XO 3F4LA 1U0NA 2NSJA 4PSDA 4V24A 2JFGA 2H51A 3K31A 4HD8A 3PFNA 1GDTA 3HB1A 5HTKA 2FWAA 4AXBA 4Y30A 1F8UA 4EEKA 1RHUA 2P9FA 4TQUS 3GOQA 3AG5A 1EKVA 2FPUA 5TJHA 3AR9A 4CU5A 3W78A 4E31A 1CNEA 1M6WA 3M1IA 2B8WA 5D86A 1QIJA 2PL5A 1G98A 1D4AA 1I2DA 1O4WA 1QYRA 3CVWA 2JIRA 3A4YA 4N03A 1YQWA 4U6SA 1V1RB 1ECBA 1L7AA 4X46A 1U7ZA 2HHHH 4N5IX 3ZWCA 3U3MA 3VSBA 4LHWA 2B8TA 2PV7A 3I39X 1FA9A 3KU4A 4XUEA 4YCJA 1WBDA 3EGCA 3LXRA 1BEEA 4GZLA 3HWRA 2EDAA 4TGLA 4YAJA 1KK3A 4X62H 5KFZA 3QIAA 4HAXA 2EKLA 3HBMA 1OBDA 1OJLA 1OY1A 1JU3A 3DXFA 2ZRPA 1ZG3A 3UEOA 1Z56C 2WPNA 6REQA 3MUOA 3PFKA 4HYKA 1C7IA 1KMMA 2Y1KA 2R65A 1XMVA 1T13A 4I1YA 2X22A 3GVHA 3NW9A 4WKCA 4D4JA 1W76A 1QVGH 3UAOA 4ETNA 2O5VA 4JIGA 2QT1A 1I9GA 3DV2A 3K1AB 3UOGA 3D6UA 1XJCA 5AJUA 5LQRA 3AKZA 4P36A 2N0SA 3RJZA 5L1JA 2YWCA 5JCOC 4IVNA 3N0XA 1XKQA 2X0EA 4HYQA 1F7VA 3I4CA 4GKJB 2NTYC 3AF4A 1NKTA 2HLNA 2ZXEA 4I5DA 1UK9A 1DJOA 3NFYA 3ROFA 5KYXB 4RCZA 3UPDA 4F93B 5CA1F 3ZV7A 1JILA 4J7AA 2C5EA 2J0EA 4R1SA 3S1AB 6ABPA 1A7AA 3TL6A 4RNDB 4HY3A 3NVAA 2OYRA 4F71A 5EJFA 4DDMA 1S3FA 4D3ZA 3AWIA 3JX9A 3ZTWA 2CQYA 4YWJA 1JZTA 1EP9A 4QJFA 2R7LA 3VR6D 1NXVA 4JV0A 1HG1A 1OFUX 4V3BA 3ZGZA 1OU4A 4CG0A 1P1KA 2CJWA 3AUTA 3S99A 3KTFA 1Z07A 4DWVA 3GA7A 3OHAA 2EP8A 4EA8A 3VVMA 2IYLD 5TGTA 2CSUA 4AY6A 3KQTA 3TQQA 2Z83A 4J0JA 5DYYA 3CVXA 4AKSA 3FROA 4GWKA 5IP9G 2R7ZA 5C81A 5LXTB 3VU9A 3HFGA 3F8TA 1Z5NA 1SG9A 3FKJA 1DJPA 5LB2A 5HK8A 3ADDA 4H7HA 5HUPA 2C2OA 4A6EA 2BH2A 1PR1A 2IYVA 2W6MA 1SKYE 3H2HA 2CJYA 3IX7A 2FFBA 1P44A 1FM0E 3AGQA 1XD9A 3GLIB 3CUWA 1Y3IA 4DDVA 2V7PA 4W8GA 2YWJA 1KIAA 3RS3A 3RVLA 4DIUA 4PO8A 5LMCA 4QG3A 3HRIA 2OLJA 1DT3A 3OBIA 5AUNB 4MCIA 3K0EA 2GBIA 2TECE 3GTLA 3LQ4A 2IODA 1UC8A 5JG7A 1T4CB 5KTMA 2PX6A 3EC7A 4AJEA 1KJZA 1U8UA 3M9LA 2B5OA 5F98A 3CKKA 3W2GA 5LYYA 4W5OA 3AOEA 3ONEA 3I9FA 1XYYA 1G5HA 1JQBA 4YACA 4M9XA 4B4VA 3NEAA 3BB3A 4J9PA 5C5EA 4YAOA 3TGPA 3CEMA 1K5DA 4NQRA 2JGEA 2YMQA 2QZSA 4TM7A 3V4OA 4BBJA 1JR3D 1XXLA 2HYIC 5K0NA 3ZQ4A 4JGIA 4NXNB 1TF2A 1KAMA 1T9ZA 3ZQUA 5DM60 1CR6A 3DMFA 1IWPB 5G2OA 1V8PA 1QFZA 4RU9A 1T0BA 4Y9TA 3GLHE 2DKOA 3WOHA 1DQZA 3QKWA 1JDTA 4WCVA 1M1NB 3SWWA 4IILA 4NAVA 1OH6A 1N2CA 1OZ0A 3K4HA 1Z0UA 2BEVA 1PWXA 2WSMA 2DCMA 1N9ZA 1L4MA 4E5SA 1W0JD 3N87A 4H7FA 2KJQA 1I7PA 5JSUA 1U3WA 1Z7YA 2JFZA 4MW5A 4JI4H 2RJ3A 2O14A 3P45A 4LKOA 4C7ZA 3WI7A 4LDZA 7AT1A 1AHHA 1OCEA 3UV6A 4JVMA 2JGIA 5AWFC 4M88A 2PWPA 3PNKA 5E8JA 5FL3A 1N6KA 3IA7A 3F90A 5KNBH 2H3EA 1L5YA 3DKKA 3F8SA 3HOWG 1ZD5A 2AMYA 3SK0A 2QD3A 4F06A 4BO5A 2JHCA 2WNSA 2V4MA 2IW1A 1CUDA 2JW5A 4F4IA 3C2OA 4UPVA 1NKSA 2XDQA 4MYDA 4IJMA 2WAOA 4Q9KA 2VNKA 1GUAA 1JJBA 2WHPB 2OG2A 3COPA 4WBSA 1S97A 3DDSA 1RI3A 1DZIA 4B6FA 4ESVA 5HJ7A 5DHPA 4MQEA 3LT0A 1Z6ZA 3MD9A 1PE0A 1QF7A 4CMJA 2VJLA 1N5XA 4QWDA 3SKVA 4TT3D 3P32A 2J48A 4YMSA 3B6EA 1Y9JA 1JAYA 1D2CA 1U5AA 4ZDIA 1T6BY 5I5TA 1TPYA 1TADA 4O7NA 1VLVA 4BRWA 3SKYA 1FDVA 1SBHA 5ADVA 2UVQA 3A2KA 4BPBA 3KVRA 2YJ6A 3JZFA 1FBNA 3WKAA 3HBFA 2DPIA 4CWAA 1NJSA 2IYOA 2WTFA 1VGQA 3IAXA 3EFOB 4D81A 4PNHA 1TLTA 3W77A 4PYOA 2B7CA 4U67J 5DULA 1R0WA 1S0NA 2Y66A 5JEEA 4CQMA 3V7WA 2Q3LA 5JNTA 2FZLA 1PHRA 4B46A 3GD5A 3TZEA 2ZIGA 1ZAUA 3QPDA 1R5BA 1XXHE 3DVAB 3DLAA 4RORA 3P4YA 2WABA 4PLHA 3S68A 4N48A 2ZJ0A 5HFNA 2QF7A 1IBLH 1WXHA 2GHQA 2RC5A 2Y1GA 3MINA 3GTQA 2JJ1A 4MQ4A 3D3QA 3KKEA 4P7KA 4JYZA 4JL6A 1DLIA 4JXUA 5E1DA 3VNUA 2GBGA 3ZPXA 4Z3KA 1FB5A 4BO9A 5KQLA 4H31A 1GM5A 1DGQA 2IP2A 1FYFA 2JAUA 1QTQA 2UZ3A 5K8JB 1U8YA 4EG3A 1PJ8A 1GTG1 1AF7A 2CFMA 1IQPA 2ODEA 4ZV4A 3A6PC 4LAFA 1E0KA 4K9LA 2VLIA 3UV3A 3KTMA 2EFGA 2PT7A 4Q48A 2QI9C 2RKOA 5LBTA 1NQAO 1OB2A 1EVIA 1RWNA 5P21A 3G7UA 3RIGA 2BQRA 1V7QA 4TLMB 3ZWXA 2FPPA 1ZL0A 2BR5A 4QFDA 2XDAA 3T3OA 1UPAA 2VUMG 3R7BA 3H8JA 1QAOA 4XUCA 4JJGA 2EGUA 3R9XB 3L43A 4MWCA 4WJLA 1DPGA 4PE5B 3SF0A 4KQXA 3BXOA 3O8DA 2IRWA 4XOIA 1DRWA 3LLUA 1A3GA 4JZKA 3RK4A 3OF3A 2DQYA 2RFLA 4BE9A 1T24A 4BP8A 3UJNA 3FC4A 2BFEA 4ZVMA 4Q3OA 1JKFA 2WRZA 3DYBA 1L7RA 5IZ4A 1NRXA 4X95A 1P1HA 4AU1A 3VU0A 5LFAA 1DIAA 1ULSA 1QU3A 1ZMBA 2XNDA 3BEOA 2P6OA 1WD7A 3ZC3A 3DHNA 3PUHA 4KQ6A 2Q45A 3EG5A 4QEZA 3MOGA</