3VMMA

Crystal structure of bacd, an l-amino acid dipeptide ligase from bacillus subtilis
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
471
structure length
471
Chain Sequence
ERKTVLVIADLGGCPPHMFYKSAAEKYNLVSFIPRPFAITASHAALIEKYSVAVIKDKDYFKSLADFEHPDSIYWAHEDHNKPEEEVVEQIVKVAEMFGADAITTNNELFIAPMAKACERLGLRGAGVQAAENARDKNKMRDAFNKAGVKSIKNKRVTTLEDFRAALEEIGTPLILKPTYLASSIGVTLITDTETAEDEFNRVNDYLKSINVPKAVTFEAPFIAEEFLQGEYGDWYQTEGYSDYISIEGIMADGEYFPIAIHDKTPQIGFTETSHITPSILDEEAKKKIVEAAKKANEGLGLQNCATHTEIKLMKNREPGLIESAARFAGWNMIPNIKKVFGLDMAQLLLDVLCFGKDADLPDGLLDQEPYYVADCHLYPQHFKQNGQIPETAEDLVIEAIDIPDGLLKGDTEIVSFSAAAPGTSVDLTLFEAFNSIAAFELKGSNSQDVAESIRQIQQHAKLTAKYVLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanine-anticapsin ligase BacD
publication title Structural and enzymatic characterization of BacD, an l-amino acid dipeptide ligase from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Ligase
total genus 140
structure length 471
sequence length 471
ec nomenclature ec 6.3.2.49: L-alanine--L-anticapsin ligase.
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13535 ATP-grasp_4 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3vmmA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3vmmA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3vmmA01
3.90.1170.60 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Aldehyde Oxidoreductase; domain 3 3vmmA04
2QK4A 3QFFA 1IOWA 3TIIA 2CQYA 5KKNB 2FPIB 1IOVA 4TUYF 1BNCA 2R85A 2YZMA 3WO1A 5CB4F 4FFMA 4C5CA 1DIKA 1PX2A 4EG0A 1Z2OX 4MAMA 2DIKA 3DF7A 4I50F 4O86A 3KAKA 4ZQIA 5KX5F 3HO8A 2R7NA 4M9UA 1B6RA 4HR7A 2YYAA 4O7RA 3BFPA 2OLSA 3BSSA 3HB9A 3BG5A 4Y8VB 4ZOLF 1JKJB 3U9SA 3E5NA 2FB9A 2DZDA 4MV3A 3MJFA 1PK8A 4O4JF 2FP4B 5D8DA 5JH7F 2DWCA 2IP4A 5JVDF 3G8DA 2GQSA 1BXRA 3Q1KA 1OBGA 5IYZF 1GSAA 4O81A 3VOTA 5JQGF 1EUDB 1AUXA 5K2MA 4MA5A 5HBRB 1I7LA 2FPGB 3R23A 5LYJF 3VA7A 4YBZB 5JVLA 4YB8B 1Z2NX 4NYEA 4WBNF 1M0WA 3VPDA 2Z04A 1KJ8A 5EZYF 2VHEA 3ORQA 4O4LF 3R9RA 2GPWA 4J6EA 4RZQA 2R7LA 2Z02A 1KBLA 2YS7A 3GLKA 2W6MA 4FU0A 4ME6A 5J2TF 2FPPB 2W6NA 2YWVA 4MV8A 5CAEB 1C3OA 1M0TA 2P0AA 1ULZA 4MV1A 2V59A 2R7KA 3TQTA 5I47A 1WR2A 2PBZA 4YJ2F 1OBDA 3JZIA 3R5HA 2ZDHA 4I55F 2VR1A 2SCUB 4MA0A 4C5BA 5BPHA 4EAAA 3WNZA 3G8CA 1VBGA 3TINA 5HV6A 2R86A 1KJIA 2W6OA 2CNUA 1GSHA 2I8CA 1CE8A 2YRXA 2R6FA 1JDBB 4O7YA 4O83A 1DV1A 5C1PA 4EABA 1SCUB 2R87A 2VQDA 2YZLA 2W6PA 3I12A 4QSHA 1A48A 4XYLB 1KEEA 4E4TA 4YJ3F 1KJQA 4O2AF 1DV2A 2J9GA 2PN1A 2PVPA 1E4EB 1KUTA 2YZNA 1JDEA 3RFCA 2NU7B 4O7VA 3K3PA 1VBHA 4FGRA 3BSWA 3U55A 4L1KA 4EA9A 4MV6A 2YL2A 3VMMA 4FFPA 1AUVA 2V5AA 4M98A 5BPFA 1CS0A 4MV7A 3RV3A 1VKZA 3LWBA 4TV9F 4O7NA 4FFLA 4FFRA 3UFXB 1GLVA 3N8DA 5C8YF 1A9XA 5DMXA 4IIJF 1M6VA 2YRWA 4O4HF 2GQRA 3K5IA 2XD4A 2ZDQA 3LP8A 4IHJF 4O84A 1KJJA 4ZHQF 3RV4A 4DLKA 3K5HA 3U9TA 1T36A 5CA1F 4MV9A 1B6SA 4XYMB 5LA6F 3V4ZA 2DLNA 5C1OA 4XX0B 3KREA 5JQWA 1GGOA 1W93A 4IWYA 5LXTF 3ETJA 2QF7A 1E4EA 1KJ9A 5GONF 1EZ1A 3AX6A 2I80A 3R5FA 2W6ZA 2R82A 4EA8A 1I7NA 4O7TA 1GSOA 1CQJB 2I87A 4O7ZA 2YZGA 3RUPA 2C00A 2W6QA 2R7MA 3ETHA 4IWXA 1EHIA 1KC7A 5H80A 3MWEA 3VPCA 4YAKB 2HJWA 2NUAB 4HNVA 2YW2A 3OUUA 2HGSA 3TIGA 4O4IF 3JRWA 2XCLA 3OUZA 5FNVF 2NPOA 3JRXA 4C5AA 4HNTA 4HQ6A 2CNQA 4FFOA 4DIMA 1JLLB 4XZ3B 2W70A 2X0SA 2GPSA 3SE7A 2NU6B 3GIDA 5LOVF 2GLTA 4EGJA 4O7LA 5LP6F 1UC8A 3AW8A 1UC9A 4HNUA 1C30A 4TV8F 4O7SA 5BMVF 2ZDGA 4EGQA 4ZI7F 4O2BF 4FFNA 2W71A 3JZFA 1Z2PX 2WYOA 3KAJA 5J2UF 4EA7A 4I4TF 3WO0A 2R84A 3KALA 2CNVA 2V58A 3N6RA 2CZGA 4M99A 4O7WA 5CA0F 3V4SA 3TW6A 3R5XA 1EYZA 4GGMX 3HBLA 3NUAA 4WD3A 3Q2OA 4IZOA 4FE2A 3MWDA 1EUCB 2NU9B 2NU8B 3VPBA 3BSYA 4MV4A 2YS6A 4YAJB 1CQIB 3ORRA 3U54A 2VPQA 4O82A 4M9CA 1W96A
chains in the Genus database with same CATH superfamily
1ECCA 3QU4A 2ZYAA 3UV7A 2V4UA 3VOSA 1QTIA 2NV2B 3VNBA 3W5CA 1Q14A 3OFVA 3RWMB 1T91A 4JC5A 4GW3A 1A7AA 4BWSC 5IVHA 4I2NA 2H8GA 4KN6A 3JY6A 1B8UA 2WP0A 1C3OB 1T9AA 4DLPA 2I1LA 1K8QA 3BWMA 1FA9A 7MDHA 5GIPE 4BPBA 2HDNB 1Q7CA 1JWAB 5T8KA 3GHYA 3HKEA 3OPQA 1DFGA 1EGQA 3K0AB 1CQIA 1MAAA 1VHDA 4JT9A 3OPVA 2C99A 1B16A 4TTSA 1QV6A 1O9GA 1O4VA 5DX8A 4M7OA 2VVTA 2W0SA 1KDOA 3P20A 3H20A 2IPLA 1TO2E 5JMOA 3HYCA 4YC7A 3THOA 4CU5A 4C2UA 2QROA 5GINE 3N5CA 3FBTA 5L4SA 5FPTA 1YZUA 3VPXA 4C01A 3T1NA 3HABA 1VI6A 2HHHB 1ULZA 1ADJA 2AN1A 2Q3HA 2QN6A 5IVPA 5F23A 5HR5A 4EY5A 3EPJA 3AM1A 1P2FA 5A5EA 3FFAA 1Q11A 2QUBA 5EXEA 1ZN9A 2DFNA 4UTXA 4UCFA 2P2SA 1P0FA 5IG2A 1NQTA 4P4SA 2BGTA 2OEPA 2QLTA 5EQFA 5DYGA 3G2LA 821PA 2QTGA 2HM7A 3AP1A 4IFTA 7REQA 2NZWA 1OI7A 2R68A 5FWYB 2QW1A 1O97C 4EBCA 4U3JA 2E5FA 5FLXW 3KPVA 4KOEC 3NT2A 4F06A 4L8YA 2YU9A 4ENQA 2M6RA 4QICA 3MS2A 3GV0A 3VO8A 2DUNA 1KMQA 4JI6B 4IDBA 1TM3E 2G28A 4LZNA 4HFRA 3OA0A 4BNDB 3DXFA 3KSAC 1N2SA 1H8ED 5F52A 2ZSHA 4BNVA 5ELLA 3N2IA 2E48A 4DUZB 3D8NA 1NSFA 1A9XA 1T2NA 2V7EA 2UYGA 1Y7PA 4QBKA 3RV4A 1OQAA 4WFKA 1PJBA 4BY9E 3CNBA 4B2PA 3FMPB 3UJBA 1E1QA 3N3AC 1NDUA 2I8AA 1V39A 3ECAA 4UDOA 4LMYA 4MR7A 4KCGA 1X1EA 3ICPA 4LN1A 4RAQA 1UP7A 4QUEA 2JJYA 3PQDA 3A6LA 2ZRNA 3UHFA 4W1RA 4DMHA 1GSOA 3SR0A 1NYTA 1WLSA 4F4UA 4FOTA 1SUBA 2E3JA 4DEYA 3A9VA 2AZ4A 1SQ6A 2DTEA 4PZ6A 4X6UA 3NOQA 1JECA 1KYVA 4FB5A 4HNVA 2UVQA 3ENZA 5CM0A 3WHKA 4LF9H 2VJLA 3C8DA 1SA0B 1WNTA 5B12A 3ZOKA 2GTIA 4RIGA 4YCDA 3TTTA 5J63A 3VKFA 4Q34A 3N2ZB 4KFSA 1L4HA 2FR8A 1WV0A 2B4YA 1ORTA 1NT4A 1ZM2A 4C43A 4JENA 3OKPA 1L5ZA 5KTRA 3PW7A 1XELA 2R8EA 4JXUA 3C6YA 3W8EA 4UQOA 2XUPA 3FVQA 2H1CA 2V58A 1KEPA 2J67A 4BUZA 5T3YA 2E0IA 4M76B 1V5FA 4D9JA 3UQ8A 1OLSA 5KSOA 1Z56C 1UM9A 3GEGA 3MYRA 5BQXA 3A9WA 3JD4A 5U1PA 3NH9A 3CUUA 5TMEA 3PDIB 4R9SA 3G0IA 1ZMXA 1U3WA 2TMYA 4S24A 3ES9A 3AESB 2QEXH 2HCFA 1E5LA 3RRBA 1KE2A 3MMZA 1C8BA 3D3EA 5FUBA 5AXCA 4MWBA 1WMDA 1Q7GA 2VN8A 4J3NA 3ZWNA 2WVGA 2Y1KA 2AKYA 5BXYA 2VP9A 4EZBA 1JP7A 2ZXEA 2G36A 1H2YA 3PRHA 5DRYA 1KH1A 1ZHHA 4AX4A 4H7EA 3IOYA 3OFNA 4EYQA 2AV6A 1KEZA 4S2EA 5LWHA 4MR8B 1NE7A 1QNFA 4UZEA 1YRHA 1P9OA 4ODIA 2R4QA 4NMHA 1GO2A 4CM4B 4O33A 4I3HA 2JGAA 1EQAA 2P2GA 4ND1A 4WGGA 5EXPA 5EKUA 5B2ZA 3LUBA 3TIXB 1J4AA 3BQ0A 2WKRA 1S2OA 4NQZA 3Q8XB 2XHEA 3R3SA 3ICCA 4J9UE 1P17A 2CK3A 3HCPA 2BFCA 4PWQA 2XMSA 4DLLA 1U2QA 3VVLA 5LJLA 1SURA 3CWZA 1FMFA 4Q7EA 1AKWA 4HQLA 2H17A 2PH1A 5FYDA 1WXQA 2GN4A 4W82A 5KTTA 4ZO6A 4MHOA 3LMKA 1XJ0A 3A6GA 5FJ8G 1OXSC 2AMJA 4CG2A 4FTWA 3GFGA 1NW3A 1W2HA 4YJFA 3ECCA 3HGTA 1AK2A 3WTBA 4R1UA 1PD1A 3GUYA 2VNJA 1WNFA 3LUGA 1Z8NA 3SC4A 3F3SA 5KQGA 3T4XA 2DSNA 2AEJA 2JBAB 4YMLA 5CK4A 4W6ZA 2WIAA 3TF5A 3FNBA 2PE5A 1KQGA 2Y0SA 3HBMA 1R0WA 1WUJS 3DOEA 4JU8A 3DLBA 4JV2A 4OJQA 3R0ZA 4TVKA 4NK5A 3BFKA 1Z5UA 4NG4A 5JSUA 1ILWA 3BJRA 2RDJA 3V4VB 4HX5A 1VKNA 221PA 1PZNA 1PNOA 4Q19A 1TPZA 5KYWB 3EYWA 4QPNA 4RKFA 4XUCA 4EP1A 3GQCA 3AHDA 1H4QA 5F98A 2HO4A 3OPMA 4AW9A 4ZVRA 1P7VA 3F6BX 4KVFA 5AYXA 2W2KB 4CIVA 1S3FA 3ELDA 4DAAA 2X3FA 1JI0A 4HQKA 1YR6A 1R50A 5B7PA 3AIOA 1Z4NA 4JNCA 3QVTA 2PT9A 4M0FA 3OX4A 5TGTA 1HC7A 2PUTA 3CC8A 1HI9A 2CJFA 3VYVA 1GQRA 2GDJA 3J7TA 4ED3A 3F0TA 3ZN2A 3P1JA 3LAWA 2CJWB 3KJZA 3PGKA 4NENB 2CW7A 3I6IA 1ZOPA 4NIMA 4IJWA 4WFBJ 5ALDA 3WOHA 2OHXA 5ADHA 4O4IB 2AF3C 2VC2B 3LF2A 5T6MA 4FGZA 5IK2D 2Z3VA 3LLMA 1S7CA 4COOA 3QSGA 3IX7A 5LQKA 3VNNA 3JQAB 3E6AA 4A73A 4MKZA 4HGOA 4ZMBA 1M8FA 3DTVA 1ATIA 3IUQA 3KTAB 3IHTA 1G2OA 3NUQA 4BE7B 1OC2A 1J2JA 2CUZA 4IUBS 4DL2A 1I1QB 3IAS1 2EEZA 1L5SA 3RAFC 1S8OA 3H4MA 3JSLA 3A4IA 2NU8A 3Q11A 1FNBA 3ND8A 2Q50A 3HBNA 2ZJBA 1SIUA 1JVBA 1P3Y1 2ZUVA 1OPRA 1XMPA 2TRSB 4OQDA 3NHWA 4UHFA 5JCOA 1OXTA 4EYOA 4ZTZB 4C21A 2ANBA 1FX0A 1P0QA 4PYJA 4B4VA 1GNSA 2VTVA 4POOA 3VSAA 1M8PA 4PYMA 2IOYA 4WNAB 1R9NA 4FYXA 4M86A 4EHIA 3VPSA 4NV1A 4BBAA 3D3NA 1OY1A 4X1KB 1A95A 4U67J 1RW4A 5BYBA 1NVMB 1E4GT 3TY5A 1MQAA 2RC6A 3O7WA 1NRJB 4KXXA 4Q0YA 2EKDA 3WYEA 3EY9A 5DCLA 1JHDA 2CWWA 3K1ZA 2G6TA 2W8KA 4UBMA 4EO4A 5JW6A 5B1HA 3SX2A 3DYVA 3L8YA 4E5VA 3I8SA 1PS0A 2QNRA 1ZUIA 2ODPA 4PVDA 3GNSA 3QELA 2I29A 4MHTA 5FOWA 1FMJA 1QO0A 1T8SA 4YH1A 2CMDA 4PSUA 3PW4A 3C5WP 2Q0XA 4X64H 2H4YA 1L6IA 2C92A 2R6CA 1EUDB 4KVZA 2C77A 1B8VA 3HOVG 1VMAA 4GL2A 1NWCA 4K9OA 3LUPA 1TVKA 3CLRC 1S2GA 2KMLA 4FLMA 4R69A 5HZGA 5KT2A 1XC7A 2KHZA 2PZGA 4DN6A 4W9NC 2YY5A 5HJEA 4KUHA 5DM60 3NBZC 2PJZA 1NBIA 4RWZA 4R1NA 1L8LA 3VQTA 3NXKA 4XWWA 5E6SB 4UFOA 3QEKA 1KY2A 2X7XA 1N34H 2DHDA 1ID1A 1C9MA 1D2HA 1DDGA 3IJEB 2GHIA 3PVSA 2PX4A 3ZWQA 2FMIA 2RK4A 3SXJA 4Y2QA 1P6XA 4I5DA 3BL5A 1RI4A 2ZULA 3BJEA 3FGZA 4TQRA 3K4PA 1NVTA 4H27A 4PGHA 2AI3A 1BEEA 2Z9BA 2ZUUA 4NL4H 1ZW1A 4Y7CA 2VWQA 4JVMA 4BEBA 3EOZA 2C5FA 3T94A 2PQ6A 3T9CA 1DX9A 1ZMTA 3EOAI 1HDYA 3O8BA 3PWKA 4J8PA 1P31A 5TV2A 2ZSUA 4LZLA 2QZJA 4GRDA 5DEOA 3N76A 5F9MA 4Y3UA 3CE9A 1QGUA 1M7GA 1YD7A 4H60A 2F1KA 4MJ3A 3GGCA 5CVJA 4TTIA 1VG8A 1DO2A 2YRWA 2JD1A 3T5TA 3KB6A 4EEZA 4AY2A 6GPBA 3H2KA 1CFJA 5EXTA 1Y5RA 3AJAA 4LPSA 1Z7GA 5ES3A 4GX0A 3K6JA 5G4LA 4LVUA 5JE8A 4XYLA 2RBKA 5KVQA 3FWHA 4Y9TA 3ZWAA 1Y3DE 1C1DA 3Q7RA 3NATA 4GZ6A 4XZ3A 1KJNA 3A4TA 2ZSDA 2XNHA 2H00A 2RE8A 3UAYA 2CFCA 3EEIA 4B3MB 2IF2A 4ENPA 4C87A 2V7QD 5LB2A 4PG7A 5I6DA 4H17A 5JYCA 1AB5A 4NE7A 3SICE 2ZAIA 3CKKA 4QBTA 2Y9PB 1L5VA 3T1HB 3JRXA 4M0JA 2F59A 1PLKA 3RC2A 4U4AA 4J9QA 2V4QA 3G0BA 4RVCA 3DMFA 5H81A 1AVTA 4V0ME 3AVUA 4AZSA 1JMYA 4KGVA 4DV2H 1C0KA 5J5CA 2PVCA 3T9FA 2YV2A 2UU9H 3SLRA 5DM6J 1TYDE 1NW4A 2UUCB 3OUTA 1YXMA 4EA6A 1OBHA 5DB4A 1SXIA 3CH5A 3F46A 2ZROA 2HIGA 3KSZO 2PUJA 2OZLA 3EISA 4P7BA 3AHGA 1C2YA 1VGRA 1XF9A 3KV1A 2HSDA 4FIDA 2EOAA 1W5AA 4QGHA 3IDSA 1WPRA 2GK7A 3JZMA 1SR8A 3PLRA 2AGPA 2AJBA 4PV7A 1AMNA 3CB2A 4EYHB 2HJVA 3SCZA 3NNDA 1G21A 2RSLA 5E9JA 4BBSG 2PUVA 4QYSA 1A8QA 2Y1FA 3R5JA 1OFHA 3IT3A 5BUQA 2GHQA 2ZI6A 1KERA 2A57A 2Y68A 4L5JA 3LT1A 1W8IA 1QFSA 2V6GA 3OLZA 1YTLA 1JI3A 4K8OA 4DWOA 1U8CB 2YR0A 3UAOA 3FTQA 1TUBB 3LX8A 4NCAA 4Y1GA 2E49A 2L42A 2OV6A 3I01M 4Q4AB 2W9CB 3LRTA 2IOHA 2XUJA 4E5NA 4RA9B 1IHOA 2WG2A 4FEYA 4IO9J 2ZWAA 3FJYA 1WY7A 1PF7E 3EAGA 3HDQA 4F4WA 5I4KA 3ZIDA 1GN9A 3G5UA 4RAZA 4JLDA 3UY4A 3SVTA 4EUNA 1XNQB 2D6FA 3AUUA 1KVQA 4A1OA 1E79D 3WOVA 1FYFA 3ZZTA 4M8SA 1RM4A 3VDMA 4ALMA 3IV9A 4QW9A 2D8AA 4QW8A 3N0TA 5JBIA 3WMWA 2AOTB 3VJRA 3ELYA 2ZJTA 2SKCA 3O9VA 4RD0A 6AT1A 1I1KA 5CR5A 4URUR 1U0GA 4F84A 5FF9A 4PN3A 3REQA 2BEWB 2WA2A 3HU5A 4YBRA 3BIXA 3WNQA 3AL3A 1DKMA 1RIIA 1WSBA 2LNDA 2LD4A 2PYDA 5TVGA 1ZH6A 2XCUA 4RQTA 2J9ZB 4C29A 1HDOA 4QWWA 3H16A 5BV1A 4EIWA 2O8BB 2VHZA 4C7VA 3MILA 2ERCA 1UFOA 3DONA 4FS2A 4LAFA 3NEJA 2ZSAA 4YRNA 2GBFA 1RQLA 1PVDA 1RK6A 5K0LA 3DEYX 2P6NA 3MR6A 1BW9A 1TKCA 4NDZA 3GG9A 2NZ2A 4Q0MA 5LL6b 2O2HA 2B9VA 2XWQA 4K40A 4UPDA 5JBQA 1BGWA 3KELA 4CM5A 2BM0A 4RPJA 1NXOA 3L2OB 4XD2A 3VTZA 1VJ0A 3HCCA 1DPGA 5F12A 3H6GA 1N8RJ 5KNCA 1XXLA 3TW7A 4W5OA 4FD3A 6ADHA 4IF6A 5LIRA 3HDYA 1WCXA 1U4OA 3AQ4A 4FWTA 3R40A 1FVXA 4UMFA 5CUQA 3EB9A 1U3GA 2QU8A 1U7DA 2JLCA 4FILA 4NYIR 4BRUA 4GR4A 2XNDA 2QZSA 4ZU1X 3SQNA 2PANA 3I9KA 2OKCA 5LMCA 3IODA 2F8SA 3AEUA 2XB4A 2WQ6A 2DPLA 4M0KA 1H66A 1FYXA 5L1LA 4N5MA 1F6DA 1GZHB 1T2FA 3FTDA 1PFKA 5AVWA 1WQ3A 2O3QA 1I13A 2EFDB 4F5YA 3UQZA 4M0UA 2MINA 2GZDA 3TIGA 3RJZA 1N7HA 3DVQX 4AY6A 1ESZA 3DDWA 2R6R1 2WTFA 1JLLB 4BEVA 3QSYA 4IL5A 2ZBFA 2XYVA 2XWBF 1HNXH 3KSUA 5ALXA 3BMQA 1ZFNA 1FTGA 2GCGA 4LY6A 4B33A 2AD1A 3IE0A 3DEIA 3FYHA 3QBTA 1FNMA 4F5ZA 2R5FA 3HTXA 5KOIA 4K86A 4G8BA 3I9V1 5FD8A 5G3YA 1M8KA 3HGQA 2P68A 1RPTA 3T3OA 5IMBA 1XFAA 4TT3A 3IQEA 3D4IA 1K88A 1UKAA 3CPWH 2PMCA 2C7RA 1S97A 1UK6A 4I5FA 1I4WA 2B7NA 3HBLA 4D3XA 1VQ7H 1IQUA 4N4AA 1LZLA 4L3VA 2J48A 3FWKA 4DR2H 2NWQA 1K5GA 4OMCA 1E2NA 2L2QA 2I9PA 1H4TA 3VU9A 3IFSA 5AUQA 5CB4B 2I4NA 4ZAVA 4PHTA 5BW4A 5CFMA 4OXYA 1T4DA 4CDRA 5KOYA 3HGMA 2PXCA 4CYMA 4K2HA 3DOUA 3L4KA 3QX3A 3K8YA 3PE3A 3OFKA 3HFSA 1A9PA 2GWHA 4GMFA 4BMXA 1RJDA 1E7YA 3V3KA 1WXEA 2IYWA 2EWVA 1RWBA 1BKSB 3FAKA 3U39A 2EW2A 2C5BA 4ILKA 1G3QA 4OA5A 4TLDA 5C81A 4I1UA 4WT7A 4OVKA 3HKDA 3TAHA 1VBFA 1X1OA 3L49A 3RJ5A 1V3UA 5HX7A 1EUCA 2VZ0A 3MTJA 3OLCX 2DWQA 1KI8A 4DIEA 2NYUA 4L85A 2RKOA 4HDNA 2H63A 1IUOA 4O02B 4FMDF 4BVLA 2J30A 4BV3A 5B1YA 3RSFA 4M1YA 4XJXA 4BGIA 1PSWA 1U0HC 3DBIA 3QZUA 5L1IA 2O06A 4PR0A 2P67A 1YE3A 5DTJA 2PZMA 2ZRMA 5CXSA 3BWEA 2YBDA 4FGWA 5J2TF 4X20A 1TO6A 4WJKB 1WMEA 1M8JA 3SEAA 2XPCA 4HGPA 4LKOA 4YO8A 4FEAA 1WCMG 3QKWA 4KHPH 1DT3A 5BW6B 3ABZA 3LQYA 2PS3A 4AWXA 1NFQA 2EZ9A 5HDQA 4YIHA 5F73A 1ILEA 4ENVA 1R0RE 3AV0B 4RGYA 2FLNA 3MTGA 3WIDA 1YR1A 2WIKA 1SUIA 5GIOE 3ETLA 3BH7A 4JT2A 1Z47A 4LFCB 4RTLA 3ASZA 4G0VA 2QTMA 1UBFA 1BRTA 4DCNA 4C22A 1NX6A 1U6IA 2JEZA 4QIWA 2Z9CA 2PS1A 4EQ5A 5HNKA 1CR1A 3GC6A 1LJ8A 5C3EG 1XVLA 4ZEVA 1A9QA 1J21A 4J4TA 1SB9A 5A4JA 3R6GA 3Q72A 2GXUA 3QQMA 2O8DA 1NMSA 3N2GB 4B6GA 2Z6AA 3THYB 5BPFA 1I3CA 4TGLA 4DMMA 4O7NA 3WWIA 4HYYA 3AKZA 5HE9A 3NHRA 2DLCX 4JFAA 5BXQC 4XCXA 5C46F 1QR2A 4BKRA 2FOIA 3ANYB 4OG2A 4M38A 1U7UA 1V2GA 9GPBA 1GZ4A 5COAA 2VKQA 2AN3A 1FFDA 3EXIA 4AD8A 5JARA 4UBLA 1PWZA 3HOZG 2HBQA 1SFRA 1U02A 1AZWA 3BGWA 2TMDA 4N41A 3D2AA 1ZX1A 4NMLA 1QH8A 4OLFA 2V6MA 1M6VB 4PFQA 3UJAA 1OX5A 4H7JA 3PGXA 4H0FA 1W59A 2DTXA 4LKRA 3AETA 3LT0A 5TE9A 3RVKA 4ESHA 4LZZA 4EO7A 1ZJYA 2HXGA 5H59A 3OEHA 4YCAA 4X1IA 2HGWA 1ZBDA 3IBFA 1N62B 1ZYUA 3MFQA 3V9PA 1E3LA 3CZ4A 3H17A 1RP1A 4E5SA 3B1ZA 4KSYA 2YNMC 1Y1LA 1W1IA 1HL7A 4DR4H 5CLQA 3D8HA 4ZIRB 2OG1A 2FE1A 1C29B 1NAIA 4F3RA 4O29A 1PT9A 3RIYA 4HP8A 5DLPA 3ULKA 4B3RH 4L7VA 2A86A 4RMHA 2B8TA 2FETA 3JQBA 2ADOA 3UEOA 3RTBA 4Q5IA 3KTOA 1AHPA 2EBFX 3HUTA 1T2EA 3G9QA 5IAEA 4OM7A 3BIWA 3GEDA 1Q0RA 5A9TA 3NH6A 4KXLA 3JD0A 4CMEC 2W8LA 2C5EA 1KYWA 4MQ4A 4RTQA 3L05A 2C5SA 4XB6B 5J5AA 3S2EA 2JCYA 1YFJA 3U3ZA 5KSWB 2QE7D 2NT3A 1BNCA 2Q2WA 1VL5A 5AM0A 4MRNA 2KBEA 1HZZA 2YWDA 4N7MA 1Q91A 2C7GA 1H5QA 5G1NA 2FRDC 3LRPA 1Y34E 4TMYA 1A2KC 1LJUA 2P3QA 2DBZA 3VR6A 3FBGA 1EM8B 1G1MA 2DLDA 2WHRA 3OCXA 1NLUA 1YJNH 1ZH4A 3HB9A 1J07A 3LQKA 3MR2A 3CWQA 3DO6A 2HWKA 3NV9A 4CKCA 5IARA 1NPTO 1FQOA 4OH7A 4J0CA 4M4SA 2BJVA 3E0XA 1GRQA 2X2OA 1BXRA 3OF5A 4NZMA 3E3MA 4A8JC 1KKUA 3L0SA 3AJDA 1NP3A 1GP2A 5FBVB 4LFAB 4GOND 1W47A 2QD2A 3M1AA 2PUWA 4CJXA 1DKUA 3H4IA 2WIDA 1JPUA 4ZK2A 4W5RA 5JS2A 2QD5A 2D7DA 4N5DA 3JWJA 2CXXA 3KLPX 2VJQA 3I6ZA 4JJGA 4FE3A 3AJ9A 1ODKA 3AJRA 3LBIA 3GNTA 1JQ5A 2D00A 4EB6B 3GVCA 2QVGA 1X2BA 1P74A 3FPGA 3WG9A 3M6FA 1POWA 4O5OA 3F6EX 1I2KA 2HMSA 2IDJA 3V7YA 4W8GA 2JGMA 5AJWA 1YCFA 2HIAA 3IMEA 2XYGA 3MJ4A 4IJVA 3ZV7A 1BOFA 4ED7A 3V6MA 3UWPA 4GXRA 3O5AA 2DFVA 2P11A 1P1KA 3T0FA 2J6UA 2R1VA 5C1PA 1HYHA 1T6ZA 1FQWA 4CG3A 2CSXA 6REQA 1WVGA 4DQUA 4CKYA 4QG3A 5FWXB 1NHWA 2W2QA 2C9DA 1G38A 1FW6A 4JLWA 3A3KA 4O3SA 3IBCA 3QENA 4JYAH 4WW0A 2X8JA 1RQ2A 4MMYB 3M83A 4L4UA 3WSVA 4EJMA 2Z5VA 1TW3A 1LB1B 1TLLA 2JI6A 2F8LA 3HN6A 4EJSC 4KDEA 1PRYA 2JKYA 1F2TA 1L5FA 4FW8A 1SXHA 2D7CA 5H82A 3DEFA 2HLDA 2FSVA 1KPIA 3T7CA 5K8CA 1U0BB 4CIAA 1LNQA 1L7OA 4GP9A 3RIHA 2ORIA 4CCYA 1MX3A 2CN1A 3G2PA 4J0JA 4XD7A 1GFZA 1HR0B 5L4LA 5JQWA 4Q12A 4Z0NA 4G0WA 4HNAA 1NG1A 3BULA 3HCNA 2PWYA 2GJAA 4N65A 4N47A 5K4HA 1TWFA 2I87A 4QYIA 2ZWOA 1TM5E 2OO7A 4EFNA 1KC7A 2XA9A 1IJBA 5H80A 2QAGC 4A6DA 5FLKA 1MJHA 2BHLA 5KMGB 4LYHA 2EC5A 2YC4C 4RYDA 3KHGA 4NZZA 3MMXA 1H6AA 4CV3A 2V5VA 3IQXA 4DV4B 4Z4CA 3GVHA 4UY8M 2JIRA 4DADA 4HFNA 1YVUA 2P6UA 3DL2A 2HVRA 3RS9A 2ZTSA 3G7SA 5CT4A 1G20A 3Q3HA 1E8MA 3TBKA 3KTMA 4C05A 3O75A 4RJ2A 4J2HA 3TE6A 1E69A 3LRXA 3OFJA 5HZMA 1FTSA 2YHIB 4A2CA 4JV5H 4PC2A 1YRQA 1RC1A 5JHGB 4Q3AA 3WLPA 4C30A 1R4MA 1C0PA 2LCIA 3L4BC 3WADA 2XD9A 3PUXA 2C0PA 2O5RA 3PG5A 4WXRA 4ML3A 1OE0A 4XB2A 4PWYA 2E4UA 3IUJA 5K8VA 2YN4A 4RF4A 3RRYA 3I0ZA 3GLIA 3HRIA 2H5EA 3VDQA 1CIVA 5KYXB 3HV2A 3GRPA 5ITZB 1JEDA 2WU1A 1KD1J 1QKIA 3WLHA 2C94A 3T3GA 3KRTA 4PQEA 3M89A 1YE8A 2PZ8A 3MD0A 3HO6A 1CZOA 3KTDA 4YT5A 1WXDA 5ARBA 1CEXA 2W2OA 3UK1A 3JQEA 4X62B 3USES 1YVRA 4NXNH 3F6YA 2NPIA 3EEFA 3MCZA 1N2CB 1OBVA 2CFOA 2FMAA 2AQ4A 1E7MA 1ZK1A 2R8RA 4K3UA 3SZMA 2ZRPA 4Y8VB 1OWNA 1QHEA 4N6OA 1ZAKA 4DMRA 4LV5B 1L0BA 2NYAA 3BYZA 4XWAA 3KOUA 1DCFA 1DBQA 2Q41A 4K9SA 1RYBA 2PFSA 5ALYA 3LC1O 3KUDA 1MHTA 3WYNA 2R5NA 2PEYA 4Q16A 1OI2A 2Z1NA 3ZVKA 4EJ0A 2ZUCA 1YITH 1G7SA 2O0LA 3F78A 4WN3A 1NOJA 1B1AA 1BHO1 4J03A 4IFIA 1SC4A 4QE3A 1GARA 1XSEA 3AEXA 4FOPA 3ETGA 1NLFA 4GSYA 4H1UA 3T52A 3TM5A 3U60B 1TCVA 3DHEA 1UODA 3A6EA 4DY4A 3PZPA 2B5WA 1EEXB 3DV2A 1QPNA 2QPAA 4G5HA 3ZHRA 1RYMA 4YT4A 1L5GB 4URYR 1CS4C 5FTWA 4OYRA 1N2JA 2JHGA 2YWJA 1RHUA 3EZGA 4QLAA 2CBXA 2H51A 2W7PA 1U2EA 2YVAA 4E03A 2HHAA 3GB9A 1B1CA 3ESDA 1KBZA 2ZBDA 5JJLA 3H40A 4H4CA 4JBYA 1LXCA 5KOHA 1V1MB 4OSPA 1P1CA 2JAQA 3ETEA 4GC9A 3K3PA 2I4IA 4R9UC 3DZKA 1CW2B 1QFZA 4LW8A 5FBZA 4HHEA 1FYDA 4MMZB 5C9ZA 3TOXA 1NLZA 3RYIA 4A0SA 1O9BA 2GEKA 1Q12A 4LFBB 4XUDA 2WB1E 3ZJYA 3A4NA 3ZHQA 1XMXA 1NYLA 3RSCA 1KIFA 2AD5A 1FFVB 1RABA 5JJ5A 2ORYA 3FPBA 4USAA 3VAYA 4BMZA 2M9MA 4NDNE 5LLDA 1IYDA 4UCSA 5HTKA 2JZOA 3V4ZA 3WX0A 3I2IA 4K28A 4XR9A 4KQFA 3PJRA 4KQHA 4GS5A 1IAVA 1PL0A 5LXTF 5IKMA 3V46A 4BQOA 2VPXA 3HDTA 1LU9A 2JGIA 4G97A 3H5VA 3QVWA 1G3IA 3ZHOA 4ARZA 5A02A 4LG1A 3EUWA 5FULA 4MW6A 2OZVA 2NQTA 1HE5A 3O2QB 1YBHA 4IDAA 5JD3A 3TSOA 1L3BA 1AHNA 1OVMA 1PFWA 1ZD5A 3DZJA 4DG8A 1OU4A 2QUZA 4DLXA 4WAUA 4TRNA 2PO7A 3GEPA 4PYOA 3MBKA 3RU7A 3QPAA 5L45A 1UBJS 5E4JA 4NBNA 2DQ4A 4O2BB 4WSOA 4BASA 2Y92A 4ZKEA 4NEQA 1NATA 3JATA 5IT4A 1BCSA 2WIFA 3SPXA 1USKA 4X65H 5FEUA 5EJ2A 2ZI7A 1U7TA 4KIGA 4G5SA 3DTTA 1DBPA 2JGLA 1S0UA 5D5PA 4R8KA 1K27A 1KORA 1F2UB 3B6MA 1GV0A 1X1BA 3KYCB 4OFWA 3DLCA 1TZ2A 3S7ZA 1H3EA 4NP6A 1JEQA 2CNLA 4EBFA 3U7EB 1BRMA 2X6QA 3NR2A 2P75A 4RK7A 3DE7X 2YVLA 2VDWB 2CLHB 1W5BA 4DV6B 1MR3F 2CJXA 4GD3Q 3SEZA 1FCJA 3WJ7A 4P9NA 5IAOA 2A0YA 1EG2A 2QVLA 2YV4A 4PINA 3QOYA 3O1IC 4DSTA 2VCYA 4R8UA 4CM9D 2P6PA 3E0QA 5CD9A 4WFNJ 2D4HA 2QYZA 1U2GA 1OA0A 1U9IC 3QFRA 3UT0A 4MVYA 3THWB 3PC2A 4HWSA 4Z0TA 1EK5A 1ONNA 4EI8A 1OV6A 5JJIA 5FBHA 1O0SA 5AW7A 4LTMA 3U5TA 4AZVA 5IYZB 2PCLA 2ODAA 4MV3A 1IQ0A 3EXHB 3BB3A 3GN1A 5LZ8A 3VNAA 3K0CC 3UKOA 4PIVA 2IE0A 2J6HA 4XQ9A 3HBJA 4D4JA 1SVIA 1N2ZA 1RBYA 2QVCA 5CPFA 4QOJA 4YBZB 3K71B 4ZREA 5DO9A 2Z8YM 3VDRA 3H9JA 2R9VA 5I5YA 4WN9B 1S5PA 2D1QA 4DQXA 4MVJP 4Z2AA 5JNTA 3OT1B 4ZYUA 3TGLA 4J6EA 5FHQA 2VSQA 2NLOA 2HF8A 5DN6A 2IQ5A 3D2BA 1CZUA 2VZ8A 4YEKA 2Q5JA 2QMQA 1EXVA 1YIOA 3GCZA 5AM5A 5KFIA 2P5YA 3OU6A 5JU6A 3ZZ1A 3KSMA 1X1AA 1F51E 4I55B 4BECA 1BHJA 3ZLJA 1SZCA 1TWCA 4KPEC 1TVMA 4FSXA 3D0QA 1VPEA 1MJFA 3T6KA 2WW8A 1ZKDA 1GT6A 2CNUA 5E1MA 1FXUA 2WYUA 1VSVA 4KH0A 1V96A 3O94A 3RUEA 1BWRA 2R1TB 4OQQA 1YQGA 4C7BA 4UUOA 3QVXA 2Q1XA 5ALSA 1J25A 4L8WB 1QZXA 2BEJA 3FFXA 5I60A 2I6TA 3LOUA 5KBYA 2BTEA 3U55A 5LXTA 4BNIA 3OOWA 2YWFA 1V45E 1R8YA 4M98A 3FCEA 1T26A 3H0EA 3N8GA 2PBRA 4F56A 3GA5A 4CMJA 3O3OB 3NIWA 4RF5A 2FLLA 2AQHA 5DLDA 1OROA 5DKFA 4PWZA 1BMFD 1WPXA 1GQOA 2FW9A 3NALA 5HKKD 1A76A 4W9NA 2YWGA 3VBEA 3Q8MA 3P2JA 3ROTA 3UYYA 1KEVA 4CMIA 4A23A 1UDBA 1MC5A 4PBRA 2A1TR 4BWGA 2JA1A 1AHHA 3IIIA 3WK5A 1WD7A 1ZW6A 5EHIA 4RZ3A 4Q47A 3CZMA 2B6HA 4DT1B 1T36B 1EHIA 3AKDA 4RSRA 1L9XA 1HYGA 5FP0A 2OZKA 4IHJA 4H15A 1PDOA 2F43B 5M7EA 1V8OA 2ZBGA 2D5AA 3PTLA 2VP2A 5CVVA 2XADA 2X9LA 1DAGA 1KE1A 4UW9A 3Q0TA 3BXGA 4C5AA 4FQ7A 1D04A 3C2OA 1DQZA 5LA6A 2AHOA 3MW8A 2XODA 3KKEA 2WU3A 2VHQA 2HF2A 3QGMA 5B7NA 2A7XA 3FMVA 2FZGA 5F64A 5JCJD 1CETA 3T7AA 2NTEA 1WJGA 1ZIXA 2Q9BA 3U62A 3TFQA 3B9QA 3ITKA 2ZYDA 3OO1A 1HRDA 3KT6A 3Q8KA 2E2WA 1JMVA 1YTEA 3CC7H 4OU4A 3O3MB 4TMXA 1X8JA 4DC1A 4XJVA 5CGZA 2W2MA 3C3CA 1J6UA 4U8GA 3HRHA 3IEIA 4FHGA 2FSSA 4E14A 1S02A 4YGXB 1YDGA 4RCVA 3FWPA 3LYAA 1FFHA 1JBKA 2GERA 4QNMA 3U4MA 3M9LA 2IV7A 1KOLA 1FLNA 2Q5FA 3S3TA 4R83A 3IMCA 4LYGA 1KRXA 2IEDA 4DLUA 1V8PA 5C5DA 1TGYA 4FYPA 2WYHA 5EI5A 3WE7A 3DHYA 2A78A 2C2BA 2BH9A 1LS6A 1G64A 2XE7A 3HVHA 1HE4A 3GRCA 4FGJA 1ISMA 1PR4A 1KI3A 5FBKA 4ER0A 1OX4B 2WMOB 2Z30A 1K6EA 2GAJA 2SKEA 5K3FB 3VR5A 2VQEH 3GLHA 2N1BA 3PEFA 1LVGA 5KFYA 4E46A 4MUJA 3FOEC 2H59A 3H2YA 1N2BA 2X9QA 5DPMA 3VSCA 1FFSA 2BN4A 1OTPA 1Z9BA 1TUEA 3N53A 2PKWA 4KQMA 2E4YA 1B0ZA 1PG2A 5B53A 2Q21A 5DFAA 1ELOA 1BD3A 3DMNA 5K2OA 2WFLB 3Q9NA 2PA3A 3KE8A 2OHHA 2VPPA 3PD7A 3UPTA 3ZCPA 4YB8B 4YQEA 1DTSA 1E2KA 4RLHA 3LX5A 3NVMB 1I7DA 1O4UA 1EDOA 4FBGA 4JUAA 3A1DA 1J5PA 2WWTA 1FP1D 3GUZA 2P62A 1IJKA 1YQXA 3T5BA 3DV0B 1Y8RB 1UP4A 2IOFK 1X80B 4PX2A 1RWMA 3MEQA 4JYCA 2FQQA 1SD1A 1Z7YA 4XX1A 1VIVA 4KPFC 1XUOA 1EK1A 1OD6A 2OBFA 4HQNA 4G0OA 2V1XA 1EKXA 2RCNA 3KZVA 4MWZA 4S0XA 2VR1A 2JCVA 4Q8FA 1U3TA 2A30A 1SUPA 3MLBA 5BPHA 4JDUA 4EAAA 1IEQA 3WNZA 3NCTA 2QRKA 1Y63A 4D6XA 4RHCA 3RRMA 1OFIA 4QYXA 3GH1A 3SBDA 1SCUB 2D0PB 3EF3A 2OHIA 4IRKA 2IVFA 1GNLA 2QM8A 1EHYA 3ESAA 3P2YA 1MB2A 2R97A 4HF7A 4L08A 4IIEA 3FPAA 4C0HA 1BS2A 3H9GA 4R2KA 2YZNA 1RYHA 3BMXA 5AI6A 3KVYA 3CNOA 1USVA 1D2RA 4I46A 1M5TA 1KZ4A 2AOXA 3ZC3A 4KN5A 2F1OA 3C98A 3O8QA 3KHRA 2PLWA 4PG8A 4PIMA 3PNYA 1JIJA 4Q6WA 1R5BA 2AYZA 5DIFA 4EB3A 4O84A 3G02A 3KC2A 1JZSA 3U9TA 1X77A 5AKYA 1XRJA 3DFFA 2PM8A 3NWJA 3ICVA 3VZSA 5E7QA 3PTAA 1XZJA 3WWZA 1D0VA 1DX6A 4BYMA 2A8YA 3LD9A 1SG9A 1Q2UA 1BAPA 3GJ6A 3OCWA 3P9CA 2HJSA 1P72A 3QVMA 4YJGA 4YALA 3ZHSA 1HQKA 2NW6A 3A6KA 2O4UX 2ZJ8A 2CNWA 3I2YX 2RBGA 3JW8A 3KHKA 4UHBA 5FFMA 5ALTA 1QP0A 3I56H 4G67A 5EWMA 2WINI 4JKYA 4IRCA 2Z5LA 3Q7EA 4NX2A 3FNHA 1RZUA 5E7IA 4PLWA 2OBYA 1OZ0A 1CJUC 3H6HA 3PXCX 3S2UA 2CXUA 3MWGA 1Q7BA 2OCPA 1WCIA 1GA6A 3Q5EA 3UZBA 4CDGA 1UIRA 5EZQA 2CDNA 5EIXA 4G65A 1JDJA 3CZRA 4A03A 4B84A 3CCFA 1YUNA 2P4UA 2IK8A 1OJ7A 4WOKA 2W71A 5KJCA 5AIAA 4MRMB 2HG8A 3JZFA 2R00C 4ZAYA 1KVRA 4RWEA 1SOUA 2M6KA 1F8XA 1T8UA 1IBKH 1MMFB 5AD1A 1ZGAA 2IA5A 2WSSA 4RDIA 3IEVA 4DL3A 3K09C 4E5UA 4F3KA 4Y1RA 4TPKA 2G63A 2RH9B 5SY4A 4YAKA 1GTSA 4CE6A 4K6NA 1XZDA 2QTTA 1X7YA 3E53A 2YDYA 5ALJA 2PRKA 3G0DA 2E7ZA 2PKCA 4D4IA 3H4TA 5EJ6A 1JA9A 2GRJA 3VYRB 2FUNB 3FSGA 4HWGA 3BRWA 1PIWA 4O82A 3T12A 3OJLA 1FZQA 4E5YA 3TNYA 1M67A 2X1MA 4LRWA 5CG1A 3MTIA 1Y6FA 3P96A 5LMNH 4G0MA 4BJ1A 2B3DA 3D3JA 4ZVSA 4F4CA 3GJSA 1W4ZA 3GBPA 1S2DA 1K7CA 1SCBA 4O86A 4G0PA 4UNPA 2AUMA 2E89A 4Z8XA 3GJYA 4QECA 1H0RA 4EKDA 4CLRA 4XA8A 5HCUA 3B38A 1WZNA 4P83A 3DB1A 4XGNA 1DOAA 1RRMA 1ENZA 2ANCA 3PPYA 4AQYB 5JSYA 4BPRA 2HHFB 2VDMB 1NP6A 4HVLA 1P4AA 1G2WA 2FWBA 4EECA 4PTLA 4CNQA 1P5FA 2ZYGA 1SK9A 1QUEA 4DLAA 3T5LA 1I94H 1XEWX 2Z83A 2EJWA 4KO3S 3KQKA 1U2ZA 5EMJA 1VCMA 4C3OB 4IICA 4KHZA 2A1UA 1LZKA 1PVOA 1D09A 4HDMA 5FR2A 2Q1TA 1RJ9A 1F3OA 1NW9B 3W6NA 1RR6A 1O8CA 1PFGA 4P92A 3OKCA 4MW4A 4IIHA 2VDOB 4S04A 1Z6TA 2EX0A 1KDYA 4JJKA 1M74A 5DTEA 3ELWA 2JKZA 4DDMA 4RDHA 2ZRJA 2DAPA 2O2IA 4L6CA 2B5VA 3TNFA 3F96A 2A94A 2GVDC 2K2WA 4MGKR 2C42A 4ARAA 3LZ6A 2Z0MA 1ZXIB 4FFSA 3IQFA 3CEHA 2MMGA 2VRNA 4GLLA 2R7AA 1RLJA 2J3DA 3ANSA 2FEAA 5GQSA 4EPWA 3D3QA 3TLAA 1HFWA 3I0MA 1RRGA 2FK1A 1TXGA 4PC1A 4WLVA 1QP4A 4XYMA 3QIAA 4L78A 4P4SB 4OBWA 4DR3H 2R6ZA 5DXAA 4QPDA 4BN5A 1NMYA 4HX9A 4CT4B 3QWFA 2AN4A 2C9YA 4OHBA 3H83A 1T0PA 1M76A 4OYHA 4U3JB 1YQTA 4R8RA 2JAUA 4I3GA 4N39A 2BCJQ 3TNDA 4B47A 2XA2A 1V51A 1F6BA 1PP4A 2H3HA 4WI1A 1Y3IA 4JZKA 3TSWA 3PENA 2PTHA 3MYYA 3SGIA 4OBEA 1TC1A 1K92A 3LC2O 3JR7A 4S1NA 4XIIA 1MO2A 4PTZA 3EF1A 2JJ1A 1JW9B 1E62A 4R1OA 2YICA 4QQKA 1RCFA 3NHLA 3GAZA 5TGDA 1XMVA 3IQIX 1ZUWA 1P8JA 3OSUA 4JLKA 3COZA 5E2BA 4A5OA 4YNBA 4UKDA 3WKBA 1EQUA 3HEBA 1A8UA 3T9BA 1DC4A 2BFNA 4MMXB 4XM2A 3MRTA 5H4GA 3GJ8A 2D2EA 3QYJA 3MRXA 4GKBA 4G4SO 4KAFA 3KKNA 1HE8B 1Y1VG 4MR7B 2R4TA 1D1SA 1FDOA 4F11A 3SE0A 3OF3A 5ESRA 5EIHA 2BM9A 5HTOA 2FWPA 3ABOB 3DZFA 3I01A 3OETA 3RUAA 3GDOA 1XMSA 1ISHA 4RFLA 4Q3NA 3CW9A 3EG5A 1RVDA 4LYDA 2IBMA 3DFZA 1DBIA 2ZIGA 1Y5IA 1QMPA 2E4WA 2UVPA 2WJHA 4D9FA 5IBRA 1WYGA 1N36H 2EKQA 2CY0A 1D6JA 3LUKA 1G98A 3DDCA 2C4KA 3UANA 1GFSA 2WUDA 3Q9SA 5F77A 3GXBA 1PT7A 3UN1A 4RFVA 3U2QA 3V7WA 2Q9AA 1KYYA 1V97A 4JQCA 5BRNA 1ORWA 4KR7A 4HRAA 4A8TA 4U2FA 3BQ1A 3M8KA 2G67A 3MWDA 4X8LA 5KYUB 4HL6A 1P77A 3GQBA 5EHZA 1V1JA 2ZJZA 5DNEA 3QLTA 3BA8A 4PLVA 4ECWA 1M2EA 2PTGA 4OEHA 4PPNA 1EX7A 3CN7A 1VLVA 3T0GA 1LSUA 4CL2A 1WMBA 3PO2G 1IXRC 1VLJA 5C5JA 3ISJA 2PGLA 5LMUH 2I7XA 4DIBA 1UM9B 1G63A 4YCMA 2ZYUX 3SVZA 1WKBA 1OV4A 3EZYA 2ZSJA 3THRA 2RBEA 2ILVA 1AKYA 4B82A 1NYRA 3INNA 2WM2A 3SC2B 3T5MA 3UPDA 2ATLA 4D80A 4UCXA 2WOOA 2IH2A 1SEVA 4YQZA 2J3JA 1ML3A 4G1UC 3ORHA 2W9XA 2QIPA 4XWGA 2QD4A 2GM4A 3AOEC 2HA6A 2FPPA 1WW8A 1K3FA 4LMPA 4M1QA 1XCBA 2YNMA 1P7PA 1I01A 2VAVA 3OI7A 4BWYA 2BEUB 2C2GA 2JA5A 3L7NA 4JB3A 1IBSA 4GOMD 2HMVA 4H1TA 2JNWA 5CT9A 3KBOA 4KZKA 3R3JA 4NAHA 2YMLA 4OUDA 4KGDA 1II8B 1RAAA 3SZRA 3DSRA 1CUJA 3BE5A 5ALPA 5G41A 3L7DA 3KYHC 2AMVA 1D2GA 1SBQA 4YYYA 3B3JA 3NAQA 2BCGY 3LHFA 1P2SA 4YR2A 2GYUA 1Y9DA 5I7FA 1A82A 2IPAB 4CMEA 2BFBA 2BFCB 3ZGXA 2G5TA 1AGYA 1HYQA 5IJWA 1HYBA 2JIBA 2R2GA 4B85A 4QJ5A 1WU8A 1PBTA 3OU2A 2LGJA 2FRDA 4J75A 3VZDA 5DMHA 5L8VA 1U04A 1PR0A 3V2IA 3COWA 5G0VA 4GP6A 4B3BA 4LF6H 2J5QA 1ZDMA 3VJKA 2HQBA 4CIDA 1A4IA 3QY9A 4UUBA 2UZ1B 3H5IA 5I8PA 1NJSA 3GEEA 4K26A 2QMHA 1ZZEA 2D3TA 1QF6A 3E4CA 1G7TA 4BFUA 1KR5A 4A8JA 4K6FA 3RK4A 1VKOA 2WJWA 3K5IA 4OP3A 2PYIA 1U6KA 2W0MA 2VAMA 1QZTA 3T5DA 3SSOA 2VHXA 3WFIA 4A0RA 4QDKA 4YQYA 1TL7C 5EERA 1KR2A 4JI4B 1N3YA 2H18A 5CW1A 3Q3VA 2Q5IA 2ACWA 2ZYRA 2QJFA 3KAPA 1MZPA 5BWWA 2EXXA 2VXBA 3GEBA 1Z73A 3H5RA 1LWNA 4M53A 3ZV5A 2LE0A 3CUKA 3NIDB 1LBEA 2E4XA 3NM4A 5HK9A 3LP6A 3C5VA 3QFTA 4O4HA 3OZAA 1IJEA 3Q3IA 3MOIA 1S01A 3ICQB 1WWKA 1ST2A 1KO4A 1U5BA 4BC1A 4K6OA 4AQ7A 1C7IA 4TMZA 1VMDA 3SJCA 3QI2A 3EPRA 4OP1A 3I2JA 3MGKA 5FA5A 1WP4A 3A58B 2R65A 5CPBA 4IJKA 2AXQA 3IGFA 1ZM4A 3AZOA 3OJCA 4G0XA 3IKJA 4N0DA 4D9EA 1FEZA 2PL9A 3U7IA 2IYLD 2ODBA 4RO0A 4MWSA 2R84A 1DG9A 2I4TA 1K63A 2ZRBA 2SECE 1UH5A 5EOVA 1RHQA 2FU5C 1CBUA 3OHMA 1ZL2A 4MULA 2LPMA 4ECZA 3NP9A 1RQXA 1UC5B 3I0NA 4IFBA 4LH6A 5FUXA 2DHQA 2H1RA 2NU8B 1QOPB 4P0TA 1G9XA 721PA 5ALVA 2QMZA 2Q49A 1VHWA 2XUHA 1QIDA 4RE6A 2PUGA 3UJCA 4X7MA 3TIIA 4YRDA 2BZ0A 4D9KA 1OGJA 2FP4A 2I6QA 1MC8A 1DC5A 5J2UA 3QEOA 4PZUA 1DDIA 3W5BA 1QJ4A 4OK5A 3SR6C 3W6OA 1K2WA 3OLVA 4KFRA 4MUNA 3DZIA 5FL7D 1RYRA 1WX1A 2ZANA 3GVPA 4OAQA 2QAGA 3KEQA 4NFYA 2COUA 4FCTA 3U7QA 1V26A 3BTVA 3HNRA 3M2PA 1D8AA 3TQ1A 3JVVA 3WA7A 1T6BY 2DTDA 4EGSA 4ZEXA 3HVJA 2R1ZA 5B3JC 1JR2A 2GDZA 1QTRA 3L1UA 3DMRA 3SHTA 3SOZA 5B3AA 1CYEA 1AUPA 3M81A 3NHZA 5DNVA 2GPNA 3OC0A 3W5OA 3PW5A 3I61A 4XDGA 2EFGA 2OCXA 4ZVVA 4FYKA 3K6KA 2PZEA 2QG9A 3KWMA 4LK3A 3L4BA 4AY5A 4E11A 1HM5A 1SPXA 2VNAA 2J7PD 4Q39A 3TVYA 4R7RA 2I62A 4XIJA 4P33A 1JBQA 4XJSA 1V9SA 1VG1A 2JAPA 4V0KA 1V5IA 1XQXA 2FEXA 3T7SA 5F7XA 3O83A 4CL0A 2WJGA 3TY9A 5ECWA 3I83A 2FVYA 2F3QA 1WZIA 4RTPA 1ZSVA 4DWJA 1CD5A 1VGQA 2JCXA 2C2KA 3A4LA 2CLSA 3QWBA 4D9CA 1N2CE 2XH8A 3N8NA 4RSHA 1L6RA 3B6ZA 4KR2A 4G63A 3FYDA 1Y4UA 2GCNA 4Z4FA 3EWNA 5K0TA 2MSNA 1MPXA 1U90A 4P81A 5T64A 4R9VA 4FKZA 3GOQA 2HNBA 3ZIAD 4FMBB 1W73A 1AQJA 1DBRA 3W4IA 1LPPA 1W94A 3EYAA 1Y8AA 3I8OA 2GA9A 1PJ4A 2JBMA 4GLJA 1KAEA 2NO1A 1S72H 4LBVA 1Y9ZA 4JLUA 1UXKA 4DKXA 5C4XG 4Y9DA 3H5WA 3IALA 4WERA 1Y5MA 5EHNA 3UFXB 4KV9A 3V4PB 5J4LA 4P34A 1QBKC 1TYCA 2RHTA 3CH7A 2DPMA 3CR7A 2PLRA 4HN2A 3M5WA 4H4DA 3PXGA 1E66A 4C0BA 3LO5A 4DGQA 2JZNA 3IA7A 3M4ZA 4G24A 2ZYIA 1TEVA 3U7JA 3GZJA 4QWDA 4Y2SA 1R64A 4IWYA 4DLZA 3E81A 1E2EA 3B1YA 4TZ6A 1EXNA 3U4QB 2P4HX 3IQDB 2NU7A 3E4DA 3CPHA 4YLEA 2GEUA 1RCTE 1Y6RA 4JI1H 4PQYA 2MCTA 4YR7A 1Z74A 4RKEA 1UXGA 4TYMA 1UWCA 4G4IA 5C8YA 4G84A 3WNCA 3KVOA 3DXXA 1EE1A 4B6OA 4CT5A 2YW2A 5FDFA 1BVHA 4KEAA 1EGHA 1IVYA 1N75A 3WLJA 2X1VA 2IJGX 1C1DB 3ZK9A 5HIMA 4XZ3B 3NOOA 2W4QA 2PZFA 4U2BA 2EJ3A 4RZSA 1B3BA 2GSWA 1HV8A 2NSDA 1FX1A 3IXLA 3FNQA 4RD4A 2GF2A 4D0NA 3CZ9A 4ALNA 4YJKA 1A9TA 3AFHA 3F8NA 3ND9A 2DABA 4C7YA 3I1YA 3DEKA 3VR0A 4CETA 5FOXA 4ED8A 1CHNA 1Y7TA 5JY1A 1W9HA 1RK5A 1H1DA 3R0VA 5KFGA 4OI0A 4DYVA 3A1CA 4I0WB 3LCRA 2AS0A 3I92A 3TRHA 1YHZA 3DLAA 4IUCS 4EYGA 1L7EA 2WKWA 5I9IA 2K7ZA 3B8EA 4G01B 1XKQA 5TARA 4KAXA 3GA0A 2OZLB 1FSSA 5ED0A 4J0QA 2FCAA 1H9CA 3EIWA 4JXKA 3TDMA 3NKLA 3PXBA 3JQ7A 3B36A 4NBRA 3RTAA 1YKSA 2C35B 1ZL0A 2CLLB 4DXAA 1J24A 3IBGA 5T57A 5K3SA 1N5LA 2IUFA 4EMSA 4BNTA 4WY8A 5IVDA 2Q6VA 1GPKA 4PLPA 3RB3A 4NJMB 4O25A 3NONA 1E7SA 5CLFA 2OVBA 4TVSA 3OTOH 1P44A 3X1XA 4XGIA 2PZKA 2OORC 4GG1A 1Z8FA 3Q1KA 3CR3C 5A62A 1Z6XA 4ZPXA 2XUAA 2BP7A 1X7WA 2J31A 3AVQA 4F9EA 4JP5A 4DMLA 3TKLA 1DB3A 4HMPA 1T1IA 3PNBA 2HWUA 1KU6A 1I0IA 3PEYA 4FSHA 3ZNNA 1QFJA 5IK2A 2SCUA 3I9JA 4GOKA 2ZM6H 4HYQA 1N8NA 1JHUA 5B37A 4EB0A 2XA1A 4CFYA 1RJEA 1VMEA 3NNSA 4MICA 4KWEA 1Z6GA 2W6NA 3ESYA 3FYCA 1G8FA 3TTUA 1N60B 1R8XA 4GGPA 1NONA 5IT9A 3BMOB 2RB4A 4BBPA 1CY4A 4JIMA 5HBGA 5EJ5A 3LQSA 1T0UA 1CZNA 2YZ2A 3HJBA 3EBOA 5JZOA 2KSQA 2XXAA 1A71A 1Y8ZA 1GL6A 1PZXA 3N2EA 2E6UX 3PUKA 2AR7A 1HRKA 4Q9AA 2C3YA 1PV2A 3A3OA 1OPXA 1CY8A 4ND6A 2J5RA 4HH4A 5AJZA 2W3SB 1CUIA 4IWNA 1U9IA 1DAPA 3DV9A 1A4UA 1VQNH 4ZCSA 3REQB 1CERA 3RGGA 2A35A 1JALA 3N07A 2XRMA 4JGBA 4AUNA 4RTKA 5I7EA 3B8HA 4L8GA 5DISC 2COKA 2BGLA 3JSXA 3MMSA 4E21A 3D6UA 3INYA 3MJSA 1QANA 3ZDRA 1NUUA 5K3BA 1AQUA 4A26A 5CT5A 4AYXA 2I7TA 1KYXA 1YE5A 5IWAH 1DJNA 2NADA 1HQCA 4B7CA 2X5JO 4L5CA 2RHMA 2MSDB 5DHUA 2WAAA 4V0LA 4KDRA 4RIFA 1H9AA 3PE6A 2GXSA 3RSSA 1FS5A 1PJ3A 3F2VA 1P29A 3N59A 3LFHA 4BVJA 4RD2A 3IQGX 2XKJE 3FMIA 1PO7A 1RJPA 4V24A 3GIIA 2AFRA 1TJ5A 5EP1A 3U0VA 4JYBA 3WNDA 2UAGA 1CUWA 5DHFA 1Q3TA 1RFGE 5EKDA 1TZMA 2QNIA 4WLUA 2ZT8A 1L9KA 3HN2A 2OBNA 3PJFA 1I1LA 2WSYB 1LDEA 4DJJA 4DCCA 1Z2AA 1LVHA 2D1FA 3FYUC 2ENUA 2FPMA 5ALZA 5IYCG 2OP0A 2GJ4A 4J7UA 1ODJA 3NQ41 1X87A 3CG0A 1ODFA 2PUBA 4UTNA 4YRSA 1TK3A 1SB3A 4EVSA 4XVQA 3DDSA 3ICEA 3Q5DA 3Q8WA 2MINB 2Q07A 2QR3A 1V4YA 1XWIA 3PNSA 3MERA 4JKIA 2D2VA 2C4TA 3GRAA 2C54A 4OYLA 1XG5A 3G7UA 3Q2IA 1U94A 4NWIA 4D9GA 1UJ4A 1JLSA 4EG7A 3BA6A 2AFVA 1Z82A 2QMEA 4K6GA 4RMGA 3HR4A 4PNHA 1RQNA 2XTMA 1ZVJA 4ND8A 1OZFA 4DOMA 3BMQB 4HN9A 5B30A 2GPAA 1H5NA 4QXRA 3LXUX 4GEGA 3TBFA 3HJHA 4R0MA 5IRCD 2O8EA 1OZGA 4E88A 5BMVA 2VL7A 2H4XA 3BOSA 4IOAJ 5KTOA 4M9CA 2UXDB 5KYGA 5AHWA 4RX1A 1QQ6A 4Y6PA 2C2RA 2YYSA 1XRPA 4INAA 1UKVY 2O8FB 2O2YA 2HQSA 4LX0A 3V8RA 4OKIA 3C2VA 4N3GA 4G4SP 1GPAA 2Q5EA 3SLKA 4MGZR 1XDDA 1ZHSA 2H1HA 2WMDA 3AR2A 2PGAA 1DO0A 3GJZA 4MI3A 4X91A 5CDFE 3IV7A 3IP9A 4RHFA 4KR6A 3VU9B 1E2MA 5TPZD 1EDZA 1JR3E 5ICSA 1VM6A 5EIEA 4PO9A 4D0SA 1P2DA 2ZUWA 2LTAA 3G4SH 4CKEA 3CLUD 1ARZA 3SK0A 2EATA 1DIOB 4BVEA 4ERNA 2PRIA 1ZD1A 3SIPA 2D5LA 3FD8A 4GC5A 1OFTA 4AN0A 3VSDA 3G2QA 5CVCA 3WLIA 1WCV1 3B1FA 4JLBA 1WSDA 4FS8A 4AMUA 1G9SA 1MAHA 1HURA 2DKNA 3HKDB 2R7LA 1Y9EA 4X66B 3WJAA 2IYOA 3V80A 3QOFA 1W4CA 3L0PA 5TMPA 1PW7A 1IZ9A 4F8YA 5JHHB 2C84A 2P0AA 3C8MA 1E98A 2GH1A 4HDNB 1RFLA 3S6JA 1JFRA 4Q37A 5CH5A 4L4ZA 3DMHA 1DE0A 3IV6A 1KZYC 1NC1A 3MIIA 3HBFA 4L28A 3ZHBA 4J9OA 1NW7A 2XRYA 1RC8A 2PR2A 4E2ZA 5A4KA 1MW8X 2BF4A 2MCFA 2Q7DA 1K83A 2H1IA 1N0IA 4QPJC 4MV5A 5HSGA 2YRXA 2EL7A 4S0ZA 5EWGA 1WUTA 3CVJA 3KJGA 2H7CA 2VF7A 5AJYA 3CCQH 4QM7A 2UVVA 3IIEA 4F5EA 2BIFA 3MHTA 4G3IA 4JQYA 4DCUA 2E82A 3CU5A 2ZVDA 4CV0A 3CKYA 2OFFA 4LJ9A 2C88A 3UUWA 4R8LA 1VZ2A 4DEXA 1XVAA 2VYCA 4FZ3A 3BWVA 3PRKE 3OZVA 4BMYA 3D6JA 2E5WA 4NESA 1M9NA 4IM7A 4CKBB 3MFYA 5A06A 3SKYA 1L1FA 4IHJF 1CKEA 3N39C 1W4RA 1TRKA 3TWOA 3EWIA 4MDHA 2QU7A 2WHXA 1EHCA 5LA6F 1CHDA 3MUNA 2V45A 4RH1A 1ZETA 5EMLA 3SFTA 1UT5A 1EP9A 3GTLA 1AGNA 2FF5A 4H4EA 3F3MA 3O8RA 5CB6A 1IATA 1P2VA 1LV7A 1Z4OA 5BV7A 1W2WB 2YXNA 3GLGB 5GMOA 4BO1A 3MT7A 1RLOA 1E79A 4Y2UA 1TM7E 2X4GA 1IZ0A 1DO8A 2A6PA 2EVWX 3TQQA 4UJ5A 5KFQA 3IBYA 1QH8B 5TQ2A 4HNQA 4XLZA 1CUAA 2QSZA 2VNHA 2ZIFA 5JBNA 2EU8A 2F9MA 2NAFA 3ZDBA 3AETB 1M6WA 4UE3S 4HN4B 5A5DA 2H2DA 3ED1A 2CVZA 4AF8A 4BLUA 1H69A 3UT5A 2Z8YA 4Q9HA 3ZU2A 2PIDA 1VA5A 2WYOA 4X1IB 5B4UA 3SDZA 1PLLA 3L7AA 3RJ9A 4MLPA 5FUVA 5FI5A 2CYCA 3K16A 2I6XA 1GL3A 4PG5A 2E5LB 1WZ2A 3DO5A 3QKIA 3RR2A 1AQ6A 2X13A 4Z7OB 2GN6A 3FWNA 4FE2A 4UHDA 1KWKA 1N5KA 4XCVA 1CRLA 2DPXA 1MLDA 2IYQA 4E31A 3PFGA 1VB3A 1FXWA 3FNEA 2FKAA 4PE5B 4GPAA 5IUKC 1NT2A 2ASDA 4NE9A 3SYRA 4BB9A 1G8JA 2CQYA 4ENRA 5HIAA 4YUWA 4DCPA 5AM3A 1K3TA 2RI1A 3AFNA 3TRIA 3F7OA 3BCUA 1H1LA 1PX0A 1KJZA 3T8YA 2FPGA 2BGJA 1B6RA 5A1JA 2JK1A 2P3SA 3GFFA 4IJ6A 3IRVA 1Z17A 2O2CA 1UKYA 4Y6LA 5B7QA 3KPUA 5HZHA 1KO8A 1JHPA 3ZXYA 1L7AA 3JVIA 4YP0A 3VNVA 2XMZA 4UAJA 1Y7HA 2FV8A 2VS1A 3OHAA 2AJ8A 3HY4A 5KU7A 4FMDB 2ORWA 4X92A 4KXQA 1WDTA 3FDSA 2YIVX 5CX1A 1NBME 4JJ8A 2DWUA 4ANFA 1FP6A 2WV9A 4CWAA 1SXJD 1ZU5A 2QTFA 3CZAA 1D2MA 5J2TB 2OYRA 5KFSA 2CVOA 3QI7A 1U0EA 1CP3A 5JMWA 4MTLA 4D9MA 3OSZA 4NJEB 3K09A 5IT9W 1SKUA 1BXRB 4RZHA 2ECFA 5E6UA 4G07A 1GZ5A 5FPSA 1GLGA 2GBGA 3SAJA 2IU4A 3OA2A 1Y82A 4ED6A 1OXMA 3TR5A 3SSMA 3ZDQA 4JAVC 3RBVA 5DG7A 1U99A 4L5YA 1B93A 3RVNA 1W5SA 2FG5A 3ET4A 3GCXA 4G36A 2OT3B 3C2EA 4DMCA 1LQTA 4TSFD 2XTZA 4AXBA 3UGTA 4OLJA 1Y6ZA 4QJ4A 4BLWA 1JJBA 3VR4H 2Q7OE 4HLDA 2GTPA 3I2GA 3EW9A 4Z0PA 1CNMA 1FSZA 2AFIB 3PJEA 2V97A 1X3SA 2ETXA 1NVBA 1WHSA 4R01A 3UXYA 1ZCFA 2PSDA 2V9ZA 1XNQH 2B34A 4QO8A 3MT8A 1T8TA 3CS3A 5DOVA 1ZGHA 3VH3A 5CAEA 1P8AA 1WB4A 3NTOA 2EYUA 1DAFA 4IH4A 1ABEA 3I23A 4G81A 3V1LA 1FP2A 2VYVA 1UJ2A 6REQB 4KH1A 3DAHA 3BQ2A 3QK7A 1L7RA 5HFNA 1IXKA 1TAEA 5I9MA 3OHBA 3OTWA 4R40A 1Y48E 2G09A 4IVRA 1YCDA 2HNKA 1LTKA 2X2PA 3L41A 1XL1A 4BQRA 4LDPA 3Q7TA 3AF4A 1PJZA 5BV2P 2R6JA 3RPFA 4BQIA 5BW8A 2W6QA 3O8CA 4Q9NA 1Z5VA 3TMKA 3JQ8B 1U8UA 3OIFA 4KBFA 3GTGA 3CKLA 3OQHA 1RS0A 4CCYB 5H1SO 1U1CA 2Y1WA 2X41A 2VP5A 1O89A 3DLHA 3AR4A 3TVDA 4HNAB 1M6YA 3HA5A 3ENQA 3ILYA 1Y1PA 3GXOA 3R7FA 4B83A 5FQOA 2EV9A 4I1SA 5K0GA 2PH5A 4OQNA 3TAXA 1US8A 3KYIB 1ANKA 1ZG3A 4MYRA 4RLQA 4JBWA 1XMOB 4BV2A 1F3LA 1MA0A 4EEYA 3BWXA 4D25A 2WAQA 3LBHA 4MWDA 2L19A 3MSXA 5J3JA 3NVWC 1WB5A 3GFOA 3SEQA 2FPIA 1BIFA 3EEYA 1F5NA 2NO6A 4F04A 1OHHD 2A9OA 3O4JA 1AMUA 1T3LA 3V6KA 1G20B 4NAVA 3LO8A 1R0LA 2VYFA 2YHAA 3QMPA 1XHLA 3EPGA 3OEYA 4A82A 1SOWA 5JCZA 2IU0A 3I5MA 3OEED 2GVZC 3OP1A 5JCPA 3RIMA 7YASA 1QR6A 3R3XA 1OILA 1ACMA 2DC1A 4GMKA 4YP6A 4MUEA 4E2WA 2CMHA 3H9EO 3NCHA 5B5SA 4DWWA 5D3KA 3GLIB 4L8LA 4OAPA 2FGJA 4DLWA 1VE1A 3AU9A 4YT2A 3H6KA 4G4GA 1X7GA 2B4RO 5CX4A 2XUIA 4BO7A 3F5FA 4LBYA 4DTIA 4PC3A 1RWOA 2I7CA 2WV7A 1T0BA 3TSYA 3V6HA 4NBVA 2Y2VA 2W43A 1K8YB 5BNWA 4DR5B 1MB3A 4PNEA 1NBAA 3U49A 1K5HA 1T34A 4ZJUA 3U3KA 1NVIE 3EDCA 3OIWA 4AICA 3IEXA 3ZXXA 4D43A 4JI5H 4BQEA 3A11A 2FUG6 1LS1A 2VPWA 5CCXA 5CRIA 1QIMA 1YB4A 2BKVA 4U7HA 2Z04A 3QPUA 1BS9A 1PWXA 2QXUA 4BKUA 5B57C 2VQ3A 3BCRA 1ZXXA 3VJMA 3ZGZA 3DOOA 3IRUA 1HDEA 4RB2C 4IO1A 4U8HA 2O1XA 3JALB 4LRYA 2Q9CA 2W2NA 1QUFA 2CXNA 4HUQB 3STTA 2GAFA 3T5GA 4ZRDA 2WHPA 2D8MA 3R6WA 3ITEA 4QWBA 3E7WA 2CV0A 4QUJA 1ZRSA 2J9FB 5HUJA 2ZITA 1BSVA 1I3QA 3ORYA 3CJRA 2QX8A 5DXFA 4PBCA 2V6IA 3OZEA 5EESA 5DQGA 1HDGO 1WAMA 5E8RA 2QQ0A 3UH0A 2AUNA 3DYBA 1XZHA 3FN4A 3W3AD 4IINA 3LJKA 3PRJA 2ZZNA 4BO4A 4N40A 1T3GA 4JLMA 4II3A 5TSDA 1OFVA 3H7IA 1CJCA 1UK7A 2WD7B 1A5TA 5JSZA 4X63A 1ENPA 2CYAA 5BWXA 2QE7A 1XAJA 2X23A 3GEMA 4WHXA 4IYJA 1PHPA 3U48A 1VKRA 2P9ZA 1UJCA 1W88B 1R16A 2OP1A 4UNNA 2JVKA 4X6XA 3PUYA 3E61A 3ZD7A 5KOHB 2KWIA 4GXQA 3OQVA 3E35A 4FR0A 4PR3A 4YMIA 4MP8A 1T13A 3FDFA 2FEOA 4Y6RA 4FX5A 3C6KA 1T2CA 3V4FA 4MROA 3P5SA 4EUFA 2XGMA 5AOBA 5C8VA 2MHCA 4RKQA 4REOA 2FFJA 5EVCA 5JIBA 2B2NA 3L7MA 4YR0A 4H7DA 3ZWOA 2B8NA 3SHOA 4GX5A 4PRYA 1KAOA 2Q3MA 3NJRA 2GETA 3DTFA 1Z33A 1ZK0A 4OBXA 4PAMA 5I4IA 2GYVA 1GGJA 2QM0A 1UP6A 2JHAA 3T5JA 5KG7A 3CYFA 1LF0A 1X3LA 2HMYB 4RCNA 3CO0S 3G8YA 2B92A 1R0XA 5K6AC 1PWYE 5D1HA 2CE2X 3IG0A 5KOJB 1D5CA 2XR1A 3AMZA 1O94C 4ARZB 2EJ2A 4UCQA 4IHKA 5M04A 2H0RA 2BBOA 4NZ9A 4EBDA 3EA5A 1COZA 1YZTA 2WM9B 4RVDA 2BFDA 3FBWA 4CBVA 2FPWA 2LCQA 3L6UA 1HLFA 2E2HA 1LPOA 1DMSA 3DD5A 2V7WA 3P9SA 4R1TA 4ECSA 1Y9AA 3FMOB 4TRMA 4BGUA 4ZZ2A 1U80A 4R5HA 4X3CA 3NM6B 4JCCA 1MBZA 4OREX 1Z7BA 2FW7A 5HW0A 1W4AA 2JLZA 4PCLA 5CLIA 3JATB 1XU7A 2QD3A 1BCSB 4JI2B 5JNWA 3FGNA 3HKEB 3CSDA 2WQZA 1MUUA 3FZNA 4RV4A 4ZYXA 3FYTA 1CQIB 1IN4A 4MUBA 1L5MA 3PHGA 3SJ7A 4HDKA 2DCMA 1J5EB 2VDPB 1N8SA 1JYSA 1Q0QA 2Y0DA 1HT2E 3P9IA 4ECXA 3COJA 5TJHA 4AO8A 2B7LA 1U1FA 5HF9A 1B76A 2BEVA 1Z7WA 1OI3A 2EKLA 3Q3CA 1FE8A 1G3UA 1JEQB 2FW0A 5BWMA 4LOAA 1USUA 1IHPA 3OFSA 4ZOLF 3U31A 3BRCA 1QVGH 4RB0A 3RSHA 4A36A 3K9CA 3R0QA 2XT0A 5KFLA 3L01A 1GSAA 4XW2A 4R8UB 4GI1A 3CF6R 1YDMA 1AUXA 4D57A 5ENVA 4LVOA 3VAZA 1IXYA 4UATA 5BQOA 4WMLA 4DBVO 7REQB 3WWHA 4KE9A 1GVNB 2A88A 1TAHA 4AS1A 3E58A 2FXVA 2HRBA 3GLVA 1BZYA 3OT5A 3WGYA 4H3KB 3ABSB 1ZNXA 3GFRA 3BFXA 1LBQA 4H3HB 4HEJA 4W7HA 1B41A 4CT0A 5KNBD 5DLEA 5I7SA 2BM8A 2TECE 2X0EA 1U3VA 3UV3A 5THXA 3JQ6A 3ZWXA 4CLXA 4MPJA 5C7LO 1E63A 2WFAA 3IP6A 1LDNA 4RANA 4OGKA 3ZCQA 3CA8A 1F0NA 4JVOA 5D3QA 1FDSA 4BHTA 5GV8A 1CUVA 1A9XB 4JI7B 5JZ9A 2P9GA 4OGFA 2GNPA 3MGBA 1QVZA 4IR9A 3VKWA 3CQ9A 3U6KA 2DFPA 3BN3A 3JYLA 1FVIA 3BIJA 1XAGA 3LXXA 1GGVA 1PEKE 3OQNA 4KQIA 4UHHA 5KQLA 2UVUA 2JW5A 2PL3A 4WDRA 3SM3A 1D7AA 5AW5A 3PFKA 3P52A 2C2YA 3PGJA 2OTLH 4HQRA 4EWLA 1VBHA 4DLTA 5B6IA 3FMGA 5BYJA 2MYTA 2JI9A 3GGJA 2B1GA 3TTVA 4GQIA 5B3JA 2H2GA 1TNDA 1MHPA 1FYVA 3S27A 1FMLA 2X4LA 3VNQA 4Q00A 3N8DA 2VDVE 2AZMA 1ECFA 2YINC 4O4HF 4UAVA 2ZDQA 3TI7A 1KFJB 5KHAA 4M0EA 3TB4A 5EMNA 5E2AA 1LDBA 3GUUA 5LXTB 1B0PA 4NZOA 2EJCA 1Q16A 3ZLTA 5AW1A 3DH0A 3WAGA 2FX5A 4YFYA 4H1HA 2ZS7A 4UAUA 3OPYA 1QP7A 3TTSA 5ECGC 1DC6A 1LTQA 2H57A 1DPFA 4FI3F 4XRGA 2KPOA 3SD7A 1NPDA 3AKCA 4UM9B 1GUBA 3TGPA 2CKZB 4QREA 3S8YA 1KVTA 4ITVA 1Y1WA 1IOZA 1ESCA 4JHLA 1I6UA 4KQWA 3MWEA 4DCSA 1OLSB 1TVEA 4FHCA 4KQJA 3A70A 1D0SA 1GTZA 4K03A 3ACCA 4FD2A 1V16A 1P4RA 3STUA 3VHXA 4F9GA 3VZCA 1IBRA 2G6BA 4N5NA 2G9ZA 3NBZB 1KL7A 2QNBA 5U4XA 3R9WA 1P7CA 4TS9A 3ZKWA 2ZCJA 2G1PA 2QOEA 2B2CA 4AY3A 4EQ6A 7GPBA 4IHJB 4C0QC 1RJRA 2B63A 1TWGA 2RHHA 3VM6A 3UMBA 4DC0A 5J2UF 4D74A 3TGWA 5DG9A 1G19A 3WO0A 1L4UA 2WUEA 5LA6B 2IKSA 3AWIA 4QU0A 4MCHA 5D84A 1I0LA 4WOCA 4BVHA 5FNVA 2EFEB 3S2ZA 3OLWA 1XU4A 2AHRA 4F8EA 3L43A 1E4FT 4XDYA 1EX1A 4DL4A 3OU7A 4LNAA 5JDIC 5SV2A 4ZOLA 1TADA 1R74A 1BMQA 1K0FA 1J9EA 1Z4JA 2WTMA 4RD1A 1G6OA 2GEBA 1ZK3A 1JDZA 5KKNB 1NDQA 5FLMG 4IBOA 2ZRAA 5DSXA 3TAUA 3JASA 4ECQA 1Z2OX 4J1TC 2PS9A 5IH3A 4U0KA 5B1EA 1YNOA 5ALKA 4JL8A 1XPRA 5DJ5A 5IKXA 1QAPA 4NPAA 3FPKA 3PITA 4TWRA 3VYUB 3COPA 2Q5CA 1RYZA 1TX4B 3DDHA 3KZOA 3O9MA 1YL6A 4YJFB 5IC5A 2CE7A 4FPXA 3KJQA 4NHEA 2PQ0A 2JFBA 4F3NA 2XMRA 1WOYA 2X5RA 2NVXA 1VGVA 2FJZA 3W7AA 1GUZA 1ZI9A 3RHZA 1VB5A 1ZA1A 5AVTA 3KR9A 4REQA 3GTJA 4Y6GB 4TKUA 2R48A 1QBGA 2PSSA 3PPIA 2ZREA 1FFAA 4W5JA 2UZ0A 5FUWA 1JLKA 2CUKA 2IEAA 2V7PA 4EMUA 1U4NA 1IWPB 5E8JA 1NXSA 1WXWA 2OECA 5I4CA 2D5BA 2F1RA 4KB5A 1DCTA 3DB2A 2IXGA 3U1VA 1NULA 3HUEA 1JKXA 4LQDA 4MB0A 1O94D 2UXCB 4RHTA 4J2TA 1V9CA 3Q85A 5F5XA 1IPFA 3ZY6A 4FNMA 2EX1A 4KV7A 2B2XA 3LWZA 2Q5HA 3OCJA 4PN7A 3D3KA 4WBSA 2PLNA 2DHRA 4DA4A 3GIKA 3ITNA 5C8DA 3GZNA 1AD2A 1CEQA 4W5HA 3ROEA 5BVHA 5DBEX 5BWNA 5C0OE 2ZXFA 4TZKA 3W5UA 1K75A 1QCZA 1RXIA 4RDCA 5CBKA 1UIMA 3DO8A 1CF2O 2Z2KA 1WMAA 2OORA 3AY0A 4KR0A 3QKTA 1YB1A 3STHA 4KO2S 1UXOA 1T15A 1JA1A 3VYSB 4I1IA 2PYZA 3R24A 5C8YF 4XGKA 4CM9A 1KMIY 2ZJ7A 4EJSA 4OYYA 4LSXA 1XD2A 3NI2A 3TKYA 2RH5A 2J0EA 4K0KH 4M22A 3DTVB 4QUIA 4B6QA 3CX3A 3HWRA 2NVUA 4JFRA 4NF2A 3LCMA 3O8QB 5HMLA 3NAMA 5AKZA 4GLWA 4KBGA 3RU3A 3U9LA 1I51A 1NOIA 3NBKA 4W6QA 5HOQA 1TYBE 4ECVA 3UKJA 5AW6A 1U9ZA 4KU4A 3TS1A 2VHYA 1H8EA 1A50B 1FX0B 4ZHQA 4GH5A 4A3EG 2G72A 4DKJA 2K5UA 2P8JA 5JFOA 1UWLA 2YWEA 4FFOA 1E8DA 2AK3A 1P2BA 1P39A 3CNLA 3GUHA 1HDCA 3WLAA 5D6NA 3ASYA 4P7FA 1G8MA 4GPTA 4NBWA 2GAOA 2I2FA 1XZCA 2FUCA 2VNKA 5M29A 1DGJA 4J0DA 1U1EA 4ZC8A 1N1GA 1GYFA 3AR3A 4BMSA 4NU8X 2C9MA 3RYTC 2G04A 2VUUA 2VF8A 3NDPA 1WCIB 3W2EA 3G1TA 1X7XA 3QELB 5BWRA 2R8HA 2RGCA 2B9EA 2JLYA 3TW6A 4RCYA 3NUAA 1DIGA 2WYWA 4H59A 3EQZA 4P5DA 1HT0A 1YWGO 3HVIA 1TVKB 4Z4IA 1U8TA 3WVNA 1Z0SA 1QP8A 4AQDA 4INPA 4K88A 1LPAB 4EUKA 2DGDA 1R0CA 3E9QA 1HWYA 5CLGA 3IL2A 2CW8A 3AFGA 4JB8A 4BMDA 3BKWA 4WXHA 3D59A 3BFPA 1V2HE 4MVCA 2P3OA 1QX3A 3FSRA 3P9RA 1BMFA 3ZGOA 4I1YA 3AYHB 3MJHA 3RK1A 1ZIOA 5HKKA 1Z35A 3FYUA 2SHKA 1MZVA 1CR2A 4UTZA 1CCWA 1ZHQA 3WLEA 3X1WA 1K9VF 4YMUA 5BQ3A 1PQ4A 1EE9A 3UUGA 3NORA 1N7IA 5LC1A 2Z4TA 3HEMA 4CMAA 1ZMRA 2WKSA 1Z0JA 1ND6A 2XDQA 5JSFA 4ZVMA 3AILA 5A4DA 2HHHH 1UUFA 4CLRB 3ORQA 4I1PA 4RF2A 2Q2NA 1X39A 2CVPA 1QOZA 1J97A 2JGRA 1GTMA 1E1RD 3DA8A 3COYA 4DA6A 4NCKA 4TVBA 1W25A 3CLUC 5KDLA 4IMRA 1QTNA 3WTCA 1TJ3A 1AUQA 5KC8A 1QGUB 1NR5A 2IDZA 4DSUA 1WKCA 3EDQA 2NZVG 3P9PA 1BS1A 4HYTA 1T3HA 2PV0A 3DAYA 2JA6A 3SZOA 3OQJA 4WHMA 2A1UB 4FLEA 1GKKA 2X5OA 3BTOA 1DIBA 1CDDA 2V54A 4FOSA 4JI6H 4GE0A 1EFKA 1L5QA 4XYLB 3TRDA 3CH4B 2ZSFA 5ALLA 3M33A 3MMNA 5FRDA 3H9CA 4EUSA 5KFDA 4DUZH 4INOA 5CLHA 1YRYE 2XBUA 3CVVA 4IUDS 2QX7A 3W5AA 5JRZA 3MHPA 4DZTA 1XKTA 1AUVA 3RC9A 2PRZA 2F62A 2QY9A 1PEYA 4RMNA 2W8ZA 3HI6A 3KOZA 3NPAA 2JLXA 4WGFA 3I4MG 2JAWA 2WU0A 3AVYA 4KBYA 1YVEI 1N6IA 5AHOA 1KC8J 3GAAA 4MV9A 3GIPA 2BZSA 4XYMB 2W22A 5ARDA 2ZE6A 2FNAA 1N5MA 1SQ0A 5HRAA 3U4HA 2YHBA 3D4NA 1HK7A 3EVGA 4KO4S 3G0HA 4X94A 1GZ7A 4JMPA 2VPTA 4EA8A 4QWEA 2GEJA 1GHTA 3GAMA 4M9ZA 2YH2A 1P4JA 3JRNA 5BNZA 1MH9A 4UTRA 1P2UA 2VBGA 2I0FA 2GN9A 1VLBA 4QOHA 3N9IA 2D1YA 1CY7A 4F3CA 3SQWA 3HDJA 4U6QA 4OXKA 2I6UA 1KJWA 3SWWA 4HPXB 5YASA 4RHXA 5J40A 3IAS6 3AI1A 1G21B 2ROQA 3FOBA 2W11A 2HLHA 3VAAA 5D86A 1NF8A 1VG0B 3KLOA 4AP5A 3ZVRA 3L8DA 4FE7A 3KL4A 4OK3A 3MWKA 5BMVF 3W2GA 1M1KJ 4TQUS 1QYRA 2VAWA 4K5QA 2WJ3A 2ID8A 1F14A 4TL9A 2FLPA 2A3NA 1HTBA 5BSGA 3OPYI 4W63A 4Q7QA 4AAYA 1PV4A 4L9WA 5E1DA 3EPPA 2IHJA 5DTRA 1A5AB 2ATVA 2HO5A 1W2BH 3WL6A 5G1OA 3F8WA 4AKSA 2HDOA 4MHSA 2UVPB 2XEDA 2FKLA 4OATA 3C8HA 1NVXQ 1F38A 1XMQB 4QAJA 4OX9B 1E1NA 1O6ZA 1SZDA 3WRXC 4MDYA 1LNSA 4IIXA 4HD8A 3MBOA 4RAYA 3GLGE 2FF7A 4ZK6A 4DPKA 5AW4A 1RXCA 2M6LA 2WF5A 1MRSA 4D1YA 4FHFA 4D56A 1UADA 1NN1A 2I99A 5AKKA 5B4VA 6YASA 1VDVA 4LI0A 3OSNA 4QRDA 3ZE8A 2I2AA 2B1JA 1OI4A 2YYYA