3VMMA

Crystal structure of bacd, an l-amino acid dipeptide ligase from bacillus subtilis
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
471
structure length
471
Chain Sequence
ERKTVLVIADLGGCPPHMFYKSAAEKYNLVSFIPRPFAITASHAALIEKYSVAVIKDKDYFKSLADFEHPDSIYWAHEDHNKPEEEVVEQIVKVAEMFGADAITTNNELFIAPMAKACERLGLRGAGVQAAENARDKNKMRDAFNKAGVKSIKNKRVTTLEDFRAALEEIGTPLILKPTYLASSIGVTLITDTETAEDEFNRVNDYLKSINVPKAVTFEAPFIAEEFLQGEYGDWYQTEGYSDYISIEGIMADGEYFPIAIHDKTPQIGFTETSHITPSILDEEAKKKIVEAAKKANEGLGLQNCATHTEIKLMKNREPGLIESAARFAGWNMIPNIKKVFGLDMAQLLLDVLCFGKDADLPDGLLDQEPYYVADCHLYPQHFKQNGQIPETAEDLVIEAIDIPDGLLKGDTEIVSFSAAAPGTSVDLTLFEAFNSIAAFELKGSNSQDVAESIRQIQQHAKLTAKYVLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanine-anticapsin ligase BacD
publication title Structural and enzymatic characterization of BacD, an l-amino acid dipeptide ligase from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Ligase
total genus 140
structure length 471
sequence length 471
ec nomenclature ec 6.3.2.49: L-alanine--L-anticapsin ligase.
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13535 ATP-grasp_4 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3vmmA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3vmmA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3vmmA01
3.90.1170.60 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Aldehyde Oxidoreductase; domain 3 3vmmA04
3GLKA 1M0WA 4IWYA 3U9SA 2P0AA 3HB9A 4O4HF 4MAMA 1OBGA 2FPPB 4MV7A 3QFFA 2FB9A 1W96A 4C5BA 1M6VA 2SCUB 2ZDGA 3K5IA 4FFMA 3JRXA 4EGQA 2X0SA 4EGJA 2IP4A 1B6SA 4FE2A 2GQRA 4YJ3F 2R6FA 2CNQA 1T36A 1KEEA 1C30A 5BMVF 4O4IF 4XYMB 1SCUB 4O7TA 4C5AA 4EA9A 1EHIA 4XX0B 2R87A 3E5NA 2ZDQA 3OUUA 1IOVA 2R7NA 1BXRA 5DMXA 4MV6A 3KAJA 4NYEA 3G8DA 4ZHQF 2V5AA 2PVPA 2OLSA 2R85A 1B6RA 3R5FA 1JDEA 2VQDA 4ME6A 5C1PA 2YRWA 5GONF 4ZI7F 5H80A 1AUXA 1JDBB 2CZGA 3RV4A 2R7LA 2CNUA 2NU8B 2VR1A 1EYZA 1EUDB 3N8DA 4O86A 2FPGB 1I7LA 1KJ8A 1KJIA 2CNVA 4E4TA 1I7NA 1E4EA 3TIGA 1ULZA 4EA7A 2R7KA 1PK8A 2HJWA 5FNVF 4C5CA 5KKNB 3V4SA 1EUCB 1GLVA 1DV1A 4J6EA 2C00A 3ORQA 4HNUA 4EAAA 5J2UF 3HBLA 3UFXB 2W6MA 1WR2A 3GIDA 4DLKA 2PBZA 2NPOA 1UC9A 5BPHA 1W93A 3R9RA 5LXTF 2WYOA 2W6NA 4M9UA 4Y8VB 5IYZF 4XZ3B 5HBRB 2I8CA 4WD3A 4YJ2F 3Q2OA 3NUAA 2YZNA 4FGRA 3WO1A 2HGSA 5C8YF 3ETHA 4O7WA 5EZYF 2XCLA 4HNTA 2GPSA 3RV3A 2YS6A 1EZ1A 3KREA 2W6QA 3LWBA 4RZQA 4YAKB 4FFNA 2W70A 2QK4A 3TQTA 4GGMX 2R82A 5CA0F 4O82A 3G8CA 3BSWA 4EG0A 4EABA 4I50F 5LYJF 4ZQIA 4O81A 3WNZA 3ORRA 3U54A 4O7VA 2R86A 4O84A 4HNVA 2I80A 1IOWA 3AX6A 2Z02A 2VHEA 3V4ZA 3HO8A 3TIIA 2R84A 3MJFA 1GSAA 4MV8A 2W6OA 2YW2A 4O83A 5JH7F 3OUZA 4O2BF 1GSHA 3JZFA 2DIKA 1AUVA 3VPCA 1DV2A 2J9GA 2GLTA 5KX5F 4O7LA 5HV6A 4MV9A 2YZLA 5K2MA 4DIMA 1CE8A 2CQYA 2V58A 1VKZA 4HR7A 2V59A 1JLLB 1M0TA 3KAKA 2DWCA 2YYAA 3I12A 1Z2NX 3VMMA 3RFCA 3ETJA 4YB8B 3R5XA 1Z2OX 2YWVA 2QF7A 4O7ZA 4M99A 4I55F 4EA8A 3WO0A 1UC8A 4MV1A 3K5HA 3N6RA 1JKJB 2DLNA 5LOVF 4O2AF 5JQGF 3MWEA 1Z2PX 1VBGA 5D8DA 4O7YA 4MA0A 4O7RA 4XYLB 3R5HA 4YAJB 5J2TF 5JVDF 4QSHA 2FPIB 1KUTA 1GGOA 4ZOLF 3JRWA 3VOTA 1KJ9A 2DZDA 2R7MA 2W6ZA 4L1KA 3U55A 2GQSA 2I87A 3BSYA 2NUAB 2GPWA 4I4TF 3KALA 4FU0A 3DF7A 2ZDHA 3Q1KA 3U9TA 2YL2A 3R23A 1CQIB 2YZMA 1DIKA 4IZOA 4M9CA 3BSSA 1CQJB 4IHJF 1KBLA 1CS0A 4MV3A 3MWDA 3JZIA 2NU9B 2YS7A 4TUYF 2XD4A 5C1OA 3TINA 2VPQA 3RUPA 1C3OA 4FFOA 4O4LF 1VBHA 3BG5A 2PN1A 2W6PA 4FFLA 3SE7A 4M98A 3VPBA 1BNCA 5JQWA 5CAEB 4TV8F 4IWXA 5CA1F 2YZGA 1KC7A 5CB4F 3LP8A 4O7SA 2Z04A 1OBDA 1KJJA 3VPDA 2NU7B 3K3PA 3TW6A 1A9XA 3BFPA 2W71A 5JVLA 4MA5A 5LP6F 4HQ6A 4TV9F 2FP4B 4O4JF 1PX2A 2YRXA 4FFPA 4YBZB 4WBNF 1KJQA 2NU6B 5I47A 4FFRA 3AW8A 3VA7A 1A48A 5BPFA 4O7NA 1E4EB 4IIJF 5LA6F 1GSOA 4MV4A
chains in the Genus database with same CATH superfamily
1IUPA 5IBPA 1QS0A 2YIDA 2JJ1D 1SEVA 2IYUA 2X0DA 1XNHA 4J16C 2EERA 3IV7A 4LOAA 5K8IA 3TE7A 1EVYA 4M4SA 1UKAA 2ZR9A 3CEHA 4JJZA 3G8BA 4YP6A 3W8NA 5AXBA 4BX0A 1DFIA 5IMBA 3FJOA 1H8HD 3G2NA 4HPJB 4K3VA 4UPDA 4DUPA 2NZYA 3TTUA 2O6LA 4JB3A 3MTAA 5KX5A 2DM6A 1NYLA 3RKUA 1LDEA 2XWJI 2HK6A 4DLAA 1RWKA 4XUGB 2PVPA 4GMDA 2X5XA 1GPWB 1TADA 4GKKB 3O73A 5BWRA 1R0RE 5E6RA 4DCMA 4ENVA 3ZHSA 1EYZA 3ME5A 2QTFA 4GH5A 1O1YA 2J0FA 4EVRA 2VDNB 5BOVA 1EVJA 1YRHA 1E6KA 3IMCA 1G6KA 1GGHA 2P9EA 4LFBH 2V9PA 4UJ3A 4BBPA 2OA0A 1QAOA 13PKA 2VTBA 3C5CA 2BY4A 2GDJA 1PVOA 2J9FA 4GXTA 2ATEA 4ZYYA 1Z8FA 3WX0A 1EQ2A 4FP9A 3W2EA 1PGQA 5KG6A 1TRKA 2AR9A 1CP3A 1KQFA 3QBEA 3I2HA 1JQAA 3V42A 1XVLA 4BMPB 1CDDA 1XN4A 2WFAA 5JCJA 4WECA 4P3XA 3RSGA 1VCOA 5D7NA 1U65A 3IDOA 3VDRA 1S3FA 4E33A 1U0RA 2B9EA 1T5BA 2XGSA 2WTEA 4HAVA 5DM70 3THYA 4WGGA 3R8CA 4PGHA 1ITZA 3COZA 2EXXA 3O03A 3KXIA 4J29A 1ZD1A 5CTJA 4GGMX 1DC5A 1MKYA 5CA0F 2IBMA 4QU9A 2JA8G 4RK5A 2QTAA 3JVUA 3EZXA 2ZCUA 1X8XA 4BGEA 4PXYA 4W5QA 2I6SA 1POXA 3NTOA 4RENA 3I0MA 3W4IA 5BQXA 1QXSA 3TAUA 3NGLA 2O2SA 3BQMB 3EEQA 3RYHA 1UDWA 1BA2A 3MWMA 3QQ5A 2FWBA 2GEVA 5K0NA 4H16A 5ALPA 1ZJ6A 1M2NA 2F3RA 5HQTA 1YS2X 5FPKA 2XCUA 5KG4A 4KXVA 3BH0A 3R5TA 1UBOS 4YHBA 2FSPA 3HJRA 1ZO8A 1H5UA 1QH0A 3GDWA 3PR2B 1OXSC 4EA8A 4LSZA 4K1XA 1TWHA 3U40A 1JQJC 2EV9A 2C9ZA 4D2IA 3KSAC 2HRZA 5CYPA 4ZVOA 2IGBA 1ESDA 4N5DA 3N70A 1OQAA 3RVDA 1CUYA 1GPMA 4PQEA 4JQYA 5KREA 4BPRA 2FUNB 5C0OE 1IN6A 3L8ZA 2EF1A 3TEKA 4F5WA 4YS6A 4KVAA 1WM1A 1IY1A 2P77A 1DAKA 4FD3A 4H6VA 1W34A 1JSXA 2QAGB 4REMA 3DEIA 1PE0A 3A6ZA 4LE2A 2FUG1 4F46A 1PR3A 2Z1NA 4EQZA 2WF7A 3RIZA 1YRAA 5J3JA 3PI6A 2XD4A 1MRZA 4FDMA 3ROXA 5BV7A 2XMQA 4QUKA 4J1TC 1FYEA 2AG5A 4BN5A 1YRBA 1XMOB 2E4AA 2HTFA 4NYIQ 2BEWA 1ISGA 3I83A 1UOQA 1VQNH 3BK1A 2A57A 1R9MA 3B1FA 4ZODA 2I14A 3ILVA 3RS2A 1YQ9A 2VDWA 5B36A 1RXUA 1GY8A 1VGVA 2IYEA 1FTNA 2R65A 2A35A 4X5OA 4OHFA 2ZUVA 2ODTX 3D4NA 4GGOA 1DT3A 1G8FA 5JO0A 1UM9A 4E2WA 2UVVA 4F3RA 1MQ9A 3D64A 3HPRA 4Q9HA 3UJHA 1QCZA 2DHEA 1YZLA 4FYWA 4UY8M 1JEYB 3JVIA 2Q4RA 2I3GA 3JWHA 4GM0A 4Y1EA 3DOCA 4U3JB 2CMGA 4Z49A 3V1TC 1TEZA 1WMEA 1QUEA 3OKFA 5EMMA 3G59A 2VA3A 3GPBA 1L5LA 5E2AA 4Y67A 1LPNA 2CW5A 4MQ5A 4B2PA 4N82A 5DX0A 5I9IA 5AICA 4O3FA 4KNWA 2NXJA 3WJ2A 1Y1RA 2WIJA 3GTLA 1I3MA 2QV7A 1T9AA 1HE5A 5LDDC 2WTMA 1PJZA 2X5NA 2VJNA 4IKPA 2AW5A 5ALKA 5TS3A 5KQMA 4A6EA 3UFBA 3TQCA 4KQ2A 1XTZA 1T0IA 3NO4A 4MHOA 1PFKA 4TKUA 3U4QB 1PKXA 3EUB4 2N42A 2PU5A 4FMBB 1V3QE 1ZGJA 3RYIB 1WO8A 1U0TA 5L1IA 4CKCB 3ESQA 4B3JA 2BF7A 2PUCA 3OTOH 4OI0A 2OBLA 2X7XA 2VQ6A 1YQQA 1SWVA 3F1KA 1D2RA 1Q83A 2KSQA 1JYEA 4BUCA 1XLTC 1DKRA 1JFLA 5IVDA 1G8HA 4GC5A 5JSZB 4LG1A 3TE6A 1T8YA 5C7OO 3CB2A 3NT2A 3EBLA 1AMOA 2C3YA 2RAFA 2FK8A 1MLDA 1GZ5A 1I1NA 3SYKA 4URVR 2QRKA 1ABBA 2FMIA 4AO7A 4G85A 4FFNA 4DIUA 1OBFO 4YASA 3ZHZA 4EG0A 4AXXA 4D26A 1DOHA 3C0KA 5LMZA 2R86A 1O57A 3K71B 1RI4A 1UEIA 1MH9A 5HJEA 3U81A 2XGGA 1C2TA 1YGYA 1FFSA 1XZPA 5KFYA 2PMWB 2PX4A 2V6IA 5ICMA 4ZI7B 2F8SA 2GM5A 1E8NA 2J0VA 3TW0A 4K8OA 4ND7A 3K0KA 4CIYA 4NI5A 1HQYE 1MNAA 1PZEA 3CCEH 3VO1A 2PA0A 4LF9B 4JB8A 3M6LA 2RB4A 1WF6A 5REQA 3TI7A 2B63A 1PR4A 2NSDA 1W9HA 4BBRG 1IN1A 4WXRA 1Z2NX 3VMMA 1Q2UA 3SBXA 2M2IA 2ET6A 3ZHQA 5AM2A 4CL3A 2RKOA 4F11A 2COUA 2JCSA 4J0IA 1NVFA 3DDUA 2NXNA 3NEAA 1BS1A 1PGNA 1VKHA 5JVDF 1OI2A 2J9YB 1YVEI 3GCGA 1VMAA 2ANBA 2H5IA 1XKLA 2W6ZA 1HSOA 2C7BA 1BH6A 4U7PB 5C80A 1SVMA 3PGVA 4PVDA 4TYYA 4LYYA 1WHSA 5EZYB 3PRJA 4AJLA 4OQZA 3KOWA 3DYBA 3OT4A 5HQ3A 2HHAA 5DYIA 3I04M 3M1AA 3WL6A 2PZLA 3MFIA 3OIWA 1FVHA 3EDQA 1H93A 2CMDA 4BKPA 3JZIA 2NU9B 3LGAA 4DJ5X 3CZAA 1Q6YA 4FSDA 1Z3IX 4XCXA 1QO0D 5TQ2B 4OMUA 4A8JA 1MO4A 3LIPA 4HN4B 1M6YA 1N48A 5I5SA 1C5KA 3CCMH 2ZYTX 3RUAA 1SURA 4YB8A 3C8ZA 2W9BB 2Q7OE 4Q4JB 3EDOA 1SXJE 3RT1A 4JU9A 5CX4A 5DLGA 1P1IA 3OESA 1UZAA 2VF2A 4B7UA 4DQ0A 2IXDA 2VUUA 3QVXA 3VR4H 3KK0A 1COWA 1J1ZA 4LV5B 4B6EA 5CR5A 4C7VA 3HOVG 1X9IA 1TJYA 2HFKA 1E4EB 1FP7A 5FWXA 1XWIA 5L95A 3UV7A 1WEKA 3U6KA 5F21A 3MG9A 4X7MA 1QQ5A 5LZ9A 4PAOA 4H18A 3R5SA 4GBGA 4TSFD 1Y8RA 4CETA 3SXPA 3K09A 4CMKA 3NIWA 1H4TA 2QX9A 3JRXA 3QU9A 3DLIA 4US2R 2IYZA 1MAUA 3NJ4A 4IMPA 4R8VA 5TT1A 3OA2A 4JI7B 4WZAA 1Q7YJ 4U6QA 3TNYA 5BSFA 3ZBUA 1K97A 4JV1A 1RTTA 4CUJA 1JFSA 3GV7B 5LMCA 5HJ5A 4ZHQF 2XMDA 5AKLA 1Y7PA 2EOAA 5TQ0A 3O7MA 2VZ8A 4URFA 1CF4A 4MMXB 3TUIC 2C83A 2CMHA 5ADWA 4OBEA 1IPHA 4PR0A 1P5JA 5CK5A 1NTRA 5K3WA 4HXEB 3KNZA 4JKOA 3PCTA 3T3HA 2OV3A 4Q47A 5LD2C 2NAFA 4BO7A 1TEXA 4ARZB 3H3FA 1H6AA 4H0NA 5CMLA 4NENB 2VSQA 3T4XA 3NWPA 2DE0X 4WNCA 3LXUX 1ISMA 2Z1DA 2PGLA 4MJLA 4XM1A 1HYEA 2PFGA 4R01A 3AR2A 3IP9A 1WCIB 4AW9A 2Z6QA 5IYZF 4K9DA 4FIDA 3PUXA 4PPNA 4UOEA 1U28C 1E1QD 2HMTA 2NSLA 4TZ6A 4Q48A 5LPNA 1XMJA 2I76A 2WHPA 4K9SA 1GZ7A 3MWGA 3PHLA 4M0MA 1ADGA 2BEVB 2KI5A 3OP1A 1DEOA 5DFAA 3RGZA 3LBYA 4XYBA 1GKKA 1T9GS 4ZRMA 4CDNA 3N2ZB 4YQFA 4EX7A 3Q9SA 3WWHA 4DEVA 2PGIA 1XL1A 3A04A 1X7XB 4CM5A 3PW0A 4E70A 1E62A 3H1AA 3KTAB 3ADKA 3T3PB 1XE3A 2VSNA 4Q9JA 3HB1A 4RTNA 3CZMA 2DBQA 3SZUA 5C44G 2HO4A 4Z8XA 4ZK6A 3LHIA 1ABFA 1OILA 1QNLA 4QSMA 1IHDA 1NXXA 4PDBA 3Q3CA 4J6FA 1KQNA 5FI1B 3GFTA 2XT0A 1PG2A 1O5IA 3KHGA 2EX0A 4D98A 3LZ6A 1XG5A 1FSPA 4YP5A 4KOEC 5EIAA 5ENZA 1GUAA 3UK0A 2V98A 1VQOH 4EW3A 3NRCA 1JV2B 4UUQA 4F92B 5JAOA 4YJ2B 4OGLA 2I78A 5CLGA 4WOBA 2ZUCA 3O0TA 4M1SA 3L43A 2BUCA 3NT5A 2VPTA 3I6ZA 4LF8H 4REQA 5IJZA 2RAUA 1N9KA 1WW2A 4RS3A 3GEMA 4QASA 4Q7QA 4POOA 1TEHA 1PL0A 1B4DA 3WZMA 1BXZA 2CYCA 3QMMA 5AVWA 2ZT8A 3LVFO 3AKZA 1OLUA 2V6MA 3W6UA 5IABA 4TUYF 4J1NA 3H18A 4Z7NB 4D0NA 1FF9A 3ZLTA 5ALJA 4EADA 5EOVA 4AP6A 3JD4A 5K20A 3WGIA 1L2TA 4EUSA 2W6PA 4I4IA 1H9BA 5SY4A 3PSAA 3KXLA 4U2BA 4Y2SA 3TDNA 3OETA 2YZGA 2DVMA 1Z0FA 2BFEA 4ALMA 3EHEA 4A0GA 3I1IA 3QXXA 1P77A 3D7NA 4HNAB 3TLXA 3AFMA 3KZCA 2AGVA 1J8MF 1RYMA 1E2JA 4LDJA 2Y3IA 1IWBB 1Z4PX 2XUHA 1X9HA 1ZD8A 1P0MA 2ZVQX 1Z33A 4D82A 1NRJB 4BFXA 3PQCA 3A3NA 3ZI4A 1GA6A 3UV6A 4ENSA 3BWCA 1WR8A 4LUCA 1N32H 3EZGA 1KU0A 2V3CC 2COEA 3K05A 4UDNA 5A6SA 5TV2A 4M7WA 1QAMA 4TQUS 5JYCA 1I7DA 5BWWA 1TZJA 1VG1A 3CMCO 4I50A 1YMQA 3KB8A 1E3MA 4IHJB 1Q17A 4EY4A 4X94A 1A5SB 1IUOA 2Z4TA 4KYIB 1K68A 1DMRA 1VPVA 3PSHA 2WPDD 3QE3A 3S2EA 2Q5LA 2OECA 1M2OA 4OLFA 2OHOA 2EQ5A 1FYXA 1GZ3A 3K0AA 1QSGA 3P4XA 4CBVA 1NT2A 2FEKA 5F12A 1KT8A 4JP2A 2J0SA 4DA8A 4C07A 1PJ3A 1PFVA 5NULA 2C58A 3BWXA 4J0QA 3JYLA 5DHAA 1YTEA 4ZEVA 4FKZA 2V0CA 1KAMA 4AO6A 2GX6A 2IOFK 2A1IA 1SULA 3AI1A 2HCJB 1RPZA 1QPOA 5D7BA 3V4RA 4E5UA 2CXUA 2ZSDA 3Q2IA 4V1CA 2W9CA 3NP7A 3KHUA 3R6WA 3Q7IA 5L3RA 3L7OA 4OJQA 1I36A 5FAKA 3SZLA 4NSNA 2CCGA 1A9YA 1Y4ZA 5HMMA 2PMFA 4QC2A 1Y7HA 3QOYA 1OKKA 5J5VA 4X95A 5FUQA 4L85A 1DGQA 1XHLA 4N8SA 1YKSA 4FBLA 3TZKA 3ENQA 3VX4A 1GUBA 2RC5A 4YREA 4EEKA 2EYUA 1HYQA 1JTFA 4XYGA 4XWOA 3B2QA 3HJGA 5ED0A 1PHRA 4MTLA 1A0OA 4GA4A 1R88A 2ZSEA 1ZLYA 2JGJA 2ST1A 3G0HA 4D1YA 2UUOA 2I1QA 3N9IA 2XB6A 3LRPA 2FA9A 1PX0A 1XJWA 3HNOA 3C2OA 2PXXA 3DPUA 4Z51A 1FW8A 3SYRA 1AGNA 2VHCA 1CZKA 5J2TA 2PFSA 3IAXA 2E2HA 3A32A 3NHKA 4ABYA 2X77A 3T7DA 5IULC 5C9ZA 4Z1MD 5FBRB 3L4BC 3LFTA 3A1WA 4MV1A 3F46A 3WIUA 2F1RA 1WAMA 3OZUA 1AA6A 1YS4A 2Z3ZA 1LD3A 4JFAA 1OWMA 1QHFA 4UEQA 4P1ZA 3Q41A 5FD6A 4BWSC 3RC7A 1RAEA 1JTVA 5EHIA 2LZ0A 3NQ41 2DGDA 1QFJA 2YL2A 2GILA 4UE3S 4UXHA 5ALIA 3PCRB 3LI2A 1CK4A 5DM6J 4DR4H 3LW7A 1NQUA 3KQWA 1KBLA 3HZRA 1G5TA 4UTZA 3KZMA 2P7IA 3QLVA 1RRVA 4MV5A 2OT3B 2WFZA 4QJIA 4YQZA 3RASA 2V3WA 4D46A 2O2ZA 3NDPA 4IOCJ 4HH3C 3O75A 4K5QA 5ALZA 1FMJA 4NYJQ 2FDCA 1KVSA 2EFGA 1D2GA 1VIMA 1IN4A 1O4VA 1GTMA 2ZS9A 9LDBA 3LMKA 3L0YA 4JI5B 3R7LA 4RORA 2ZJRJ 1R5NA 2PO7A 1DQNA 3OT1B 4S24A 3CUUA 3G2OA 1IPFA 1O8CA 3RJ5A 3F47A 1SBCA 1YDGA 1W94A 3BSFA 5BV8A 2YX1A 3FUXA 5HYVA 1OH7A 4YAFA 3NJ8A 3F6YA 2C1ZA 1UZMA 3FPEA 1M2HA 3GQBB 3SP1A 2XZLA 4R16A 2EIXA 3DL0A 6AT1A 5B6JA 5CDUA 1C1XB 4O2AB 3PE6A 2GN8A 3ZY6A 3R6GA 3T7TA 3NBQA 1NJFA 3L7CA 5CCBA 3QPCA 1H65A 2OO5C 5CNMA 1WTAA 4YDRA 4DG5A 3JPWA 2ZRAA 1Y3DE 1AUOA 3FRHA 1FDVA 3P0JA 5ER9A 1JQ5A 1NYRA 3DV0B 3ND6A 4QDTA 4JA2A 2P79A 1QIGA 1V3UA 3S6JA 2JCVA 3EAFA 5AW5A 5F4BA 1NW7A 5DU2A 3SHQA 4PYJA 4GPTA 4FE2A 3SX0A 2CNQA 5BSKA 4S1OA 3B36A 3ZGXA 4JS0A 4WQMA 2ZCJA 3G9QA 5T4BA 2XF2A 3KB6A 3K9LA 4UNIA 1FP2A 2XUJA 1FFYA 1FRFS 5MGNA 1ZD2P 4OY3A 2WUFA 1MOPA 1HG1A 4OI4A 5B7PA 3NBYB 3T1TA 3WIEA 3C4VA 2CZGA 3K92A 3M9OB 3E53A 3B70A 2W3RB 2CDBA 5HIAA 5HIMA 3DZGA 1PO7A 5EVCA 1KJ8A 3HUEA 4EUKA 1Y33E 1UKZA 4NXNB 2J7KA 4AZSA 5FFFA 2WB1A 4EGCB 2APJA 3QEOA 4DMMA 1L7RA 1G98A 3QZ8A 3FTCA 4FOSA 5JY1A 4BZXA 4OHOA 3SF8B 3TFQA 2C4WA 3MUOA 5AOVA 4DCJA 4E1BA 2A9KA 4MAFA 3QIVA 5KFBA 1L5MA 3WYCA 1K9SA 1L5QA 1YDFA 4LS3A 1SPBS 4EYQA 2ZJ1A 1ZK3A 1KR2A 3S8YA 3KREA 3NBAA 3ZLVA 1KJNA 5KNCA 5ICSA 3EBPA 3H4MA 4LZOA 2X19A 2BMJA 4UMDA 3MGBA 3AU8A 3T3IA 3I9LA 2X8AA 5KTTA 4B48A 5EY5B 1PW7A 3QW2A 5B2FA 1FFWA 4M9RA 2PRJA 2Q2QA 1HDCA 1VTKA 4XM0A 5A6VA 3ES9A 1UBEA 3U44A 3RBXA 1DXOA 4IDOA 4UKDA 3RFFA 2IPOA 4MCJA 3OY7A 1Z25A 2ZJAA 4FYHA 1GTJ1 2IZZA 4IUBS 4CQJA 2NVUB 1LTHR 3U0GA 3OHMA 4LH7A 3OZEA 3AUXA 2M1ZA 1MAWA 2YY7A 2PRZA 4U2GA 5BWTA 4WX2B 1CS4C 3OSUA 1T5TA 1LPMA 3OUTA 5DMHA 1U7HA 1IG0A 2W8ZA 4RGYA 2C98A 3Q7QA 4G5OA 5DNUA 5GM2A 1WXDA 3CLTD 3HKEB 5ECWA 4PR3A 5A0FA 3H8VA 3DLLJ 1NE7A 4FM9A 2PUBA 5C8YB 3VR2D 3IHWA 5CLIA 2ZWAA 2WAMA 3GUYA 3OHSX 1CR0A 4R7TA 3NBUA 4HDMB 4R40A 1R8SA 1CEQA 4MZDA 3E3NA 4RZXA 3UYYA 3BF8A 1TECE 4XJTA 3FSEA 1HNXB 3FTEA 2F3PA 3MJDA 2XMBA 2GETA 2W2QA 5IKPA 3E8SA 3WTCA 5LQRA 4IMIB 1UKYA 4B9EA 1GL6A 4FHDA 3U4QA 2J3DA 4RF4A 4EMBA 4N7BA 1BXRB 4CKCA 5CA1F 1ETUA 1KMIY 3AVPA 1ZN7A 3W8DA 3V32A 1SGWA 4J0MA 3DKVA 2V7TA 1SOWA 2B37A 3TW6A 4D6YA 1G5HA 3LCCA 4RCNA 1ZK4A 1GGJA 4NZYA 2R8HA 2WVJA 2CBGA 1GT91 6Q21A 4U9UA 4PF1A 4GMGA 3W5IA 5KSYA 1TT5B 4Y2XA 1PJ2A 3JS5A 1BTOA 4P86A 3FPJA 1R1DA 1XNJA 1H1DA 1WBBA 2B7NA 4DBLC 4B4UA 2MYUA 1BA3A 4C0QC 3R6TA 1Q1EA 3RPEA 4DABA 5CFPA 3RVQA 1VECA 3G5MA 3BH7A 2DUWA 4M0UA 4FWBA 5LYYA 5ICGA 4NFYA 2PGDA 2IF2A 4X9XA 5KIAA 1MJNA 1ISHA 1LV7A 3FWYA 4UTVA 3ICEA 2F8LA 3KT0A 3N74A 2PKXA 2OZPA 3CT6A 3EN0A 4JUBA 2QZSA 1T8SA 5K0GA 4TTVA 2GCEA 1RZ3A 4OQFA 4KE7A 2FFBA 1IZ7A 2I99A 4XB2A 4D42A 3NRZC 5JCOA 4BNHA 5TT0A 5CB4B 3ORYA 4E5SA 4TKVB 4BYGA 4PRYA 2PGJA 1WTCA 1N2GA 2VHYA 1BX0A 3WJAA 3DOEA 5KNBA 2CL7X 1X70A 3F3MA 3KYBA 4WBNB 1QONA 5FNVF 3G79A 2BGRA 1OH8A 3T9DA 1EG2A 2P69A 1C1DB 1HT3A 2Q9CA 5AK0A 3H5WA 4FMCB 2VZ0A 1QBGA 4JT4A 4ZVTA 1RRGA 1WR2A 2C3OA 3KU4A 3T5KA 1I4TD 3NAGA 5LMUB 4QL3A 5E4TA 1JQLB 3NI2A 3A2MA 3CG4A 1AF4A 5E2IA 3WGUA 2G06A 2X5KO 3LY7A 2I22A 1X1EA 1SVWA 4LC1A 2FLNA 1TQ2A 5HTOA 3OCWA 2HPAA 4EKDA 3FHTA 4OHWA 4W9MC 4G81A 3NFYA 3PCXA 5ITWA 1T8UA 3FYCA 2HRCA 4EATA 3I73A 3ZQKA 2W9BA 1IBKH 2PH1A 4C0WA 2HT6A 3M6AA 1B8OA 3K2IA 3EJ6A 3W3AD 1ECCA 5IFLA 2CDCA 3GMIA 4MUYA 3OE7A 4Z4GA 4GC6A 4D96A 4YQYA 2WHRA 2Y93A 3CB4A 3ONNA 1W0KA 3VZRA 3D4BA 3VUEA 4BE4A 3QF4A 3I9JA 2UUBH 5CGZA 1X2EA 2Q5EA 4MCHA 1Z06A 3JSXA 5AM4A 2AQKA 5SY9A 4FX2A 3D6VA 1YVRA 3VNNA 2C8JA 4AL4A 2WMOB 4RXMA 2UXDB 5K3OA 1HYGA 3WKBA 1YL6A 1CJSA 2ZPTX 5BMOA 4OH1A 1QPRA 1QTQA 4ZVKA 3P52A 1WPXA 3TY9A 3GRCA 1Z18A 4URWR 4AYXA 1PSWA 4GNKA 1J09A 3WI7A 2GD6A 3CCBA 3HU1A 1G16A 4BNJA 5K3FB 3DVQX 3H2KA 4TM8A 1H05A 1AA9A 4IDEA 3ZCXA 3IHKA 4QXAA 3FVQA 3TLKA 2PNFA 3OQIB 4LK3A 4C7JA 4MUGA 3HVHA 5H70A 5JU6A 1A5TA 2ZRJA 3K3VA 5CCXA 1QDUA 1CB0A 4KLCA 4UAUA 3ICVA 4P3OA 2NXCA 3STXA 5LQJA 3M9LA 3K9BA 1P61B 3T3GA 2OTLH 1WVGA 4M0LA 1WQ3A 4X60A 4UZEA 2YHIB 2J45A 1RYBA 1VSUA 4ARZA 2QUAA 2MOKA 2F64A 4NENA 4HTFA 4I9HA 5ARCA 5LP6F 1YF3A 2HUPA 2ZZKA 1KYXA 1WCIA 5LB4A 2OH2A 2Q2NA 3OQVA 1L3CA 3WL4A 4ALLA 3SYTA 1NJ8A 1WRBA 3KR0A 2OMEA 3CVJA 4JJ8A 2JAUA 3BMNA 3JQ7B 4G0QA 1RHRA 4YMHA 1YHYA 1TYBE 3Q7PA 4DV5H 3OZ7A 2EJ2A 5AVQA 1ZK0A 3VZPA 1SNYA 3TSAA 4UTOA 3QFSA 4JX8A 5GZ6A 1BN6A 5A04A 4CEHA 1KC8J 2D5LA 4RNNA 2C35B 4E5KA 1Z0SA 4NULA 3AHIA 4XX1A 4HLNA 2QVCA 2E4ZA 3I8SA 4O7TA 2W2PA 4WV3A 5CIWA 4MQFB 3JD1A 5F64A 2W83A 4MGHA 2R87A 3L0SA 3WISA 3C2FA 5I60A 4QFCA 3B82A 4J2OA 2YIJA 1IBRA 2OAEA 1W7AA 2HIAA 1R6XA 5JY6A 1PWHA 3E1GA 4OLJA 2ZI9A 3WRXA 2I9KA 2ZYSA 4CG0A 4BEJA 3K6JA 3R41A 3WGOA 1AKUA 4ND1A 3TVTA 3MMSA 2ZRIA 3TR6A 2O2CA 2DEUA 1YU6A 4XDZA 2O3JA 2BHNA 2PV7A 5KFQA 2YMQA 5JCJD 4DVJA 3D4LA 4E5DA 2D2IA 3K0BA 2R1TB 3OAAA 3AEXA 5I4IA 1SK8A 4P0TA 4CM9A 4HNUA 3OQJA 1S2IA 2FU5C 4I1SA 1XC7A 2ZIWB 1KY4A 4F1JA 2AFHE 4L5JA 3ENKA 1IIRA 3R7FA 1J99A 1ECFA 3DBHB 2R00A 3QUSA 4RA6A 4TTAA 1ULBA 3FDZA 4BC0A 3CH6A 4MVJE 2GERA 1P29A 5DGIA 3WYDA 4O5OA 4BLRA 2XCOA 2QR5A 2C42A 1LGYA 2J6TA 5K09A 2I66A 3D7MA 2G8LA 1HPLA 3F6PA 4ZANA 3I6BA 3H4TA 2Z1MA 3U4DA 3PQ4A 4BV8A 2WRZA 2H11A 1NVVQ 4IMJB 4M9XA 4DJEC 2WWYA 3K30A 1YE5A 3ZXUB 4J3NA 1GSAA 3PVXA 3D3WA 1ODJA 5I4KA 5LSAA 4F4DA 1P8LA 2YHAA 3W9SA 1KA9H 4DV7B 1HMYA 1Y8ZA 3MPOA 4JJAA 1NLZA 3H1GA 5LA6A 2WK1A 2UVUA 3RBDA 1I7SB 3HT5A 4FKMA 3GJZA 4RJJA 3T1VA 1OT5A 4XSVA 4HH1A 3FOCA 4KYTA 1HSZA 3Q4GA 3AHCA 1B43A 3E3LA 4GU5A 4XM2A 2FGKA 1BHQ1 1ZR4A 5WRFA 4ZQFA 5B37A 2B2XA 4IHJA 3SC2B 3LQRA 2VEOA 4EY3A 2BFPA 1NVKA 3JRWA 5AJYA 1I1KA 3H3XA 1NOJA 1JX4A 4XR4A 1RU3A 4TVIA 4O1MA 3EA4A 5G4LA 5M5BA 3GNNA 2IDMA 5DNWA 1CQIB 5LP6C 1Q92A 3NLLA 1C0LA 3AZOA 4DFDA 4F2WA 1I94B 2JIMA 3OSNA 5LZ7A 5LZ5A 5JI2E 2H4YA 4HH0A 2G0AA 1U9ZA 1OOEA 1R64A 4ZYTA 2B1RA 1WY5A 2VPQA 2B0CA 3ZE2B 2VPZA 3QVKA 4FZ3A 4W4TA 1SELA 2HPVA 4K9NA 2H7XA 1V9LA 2YMPA 4F7DA 3RSLA 5B4TA 1SG9A 1GGMA 1JS1X 1VSVA 2NAPA 3EH1A 4N47A 4IVNA 5DHTA 4REOA 1GTG1 1HOXA 1ZESA 3M82A 3MSXA 3TLCA 4F2HA 2X2EA 4ECTA 4X65H 3T1NA 3B9BA 3GRUA 1X15A 5CVUA 1Z12A 1EFRA 5EMNA 3SHOA 3GDHA 4Z99A 4L7QA 4JUFA 2X22A 3GGDA 3K8OE 5KSOA 1ZJWA 4X46A 1NLMA 3MHTA 3D8UA 4B3SH 4PGAA 4OQDA 721PA 4YCSA 3NANA 2C4NA 4NNPA 4AY3A 3PNLA 2X8BA 4FGJA 1GGEA 4L9WA 3GLIE 3OI7A 2VP2A 2PLFA 2Z8YM 2JASA 4WY8A 3ETLA 3R0ZA 4YA6A 4QFBA 4LQ4A 3F8TA 3T5AA 3FPKA 2VDPB 1HC7A 1A8PA 4CCYA 3DFKA 4MVJH 3K0FB 2DFLA 3ENVA 1T36A 4KQ9A 1X77A 4PEVA 5FA8A 1UC4B 1XQVA 1EHIA 1E4FT 4AJ1A 4QUJA 1WDLA 5CNKA 3LO8A 5GP1A 3ZHVA 4WOKA 4DR7H 2JK1A 4X64B 2BLNA 2BISA 3UJ8A 2UXCH 4KUEA 4P7JA 1D5WA 3P9SA 2Z8YA 4AJJA 1AUXA 5CDTA 4CFYA 1JDBB 2ISQA 2O8NA 3JRNA 4EKIA 1YV9A 2OM2A 1UBFA 2EATA 3M6FA 3GJ3A 3CN7A 2BGKA 2IITA 3CRW1 2B63G 1JAYA 4YAEA 3T7JA 2RDMA 3PP8A 2WFMA 4UNNA 2DH6A 3OF3A 1V45E 3AQ4A 2ZUTA 4ZJUA 2O14A 4JBLA 1QRRA 1VYTA 3BJIC 1SJ9A 2DY0A 4ESVA 2W0MA 1VIVA 4W9NC 4M8KA 2NO7A 3REQB 1SN7A 4MEBA 2YFHA 2FR1A 4KBYA 4KXMA 4PONA 4RVGA 1YZHA 1TWCA 4DCGA 4UREA 3FF4A 4JLWA 4BAZA 4Q05A 4EDHA 1PDVA 2HH9A 4R2WA 3U1BA 4FDAA 1NR7A 1OFVA 4I5GA 5FA5A 3E05A 1RWVA 4ZAXA 4ZGBA 4ED6A 5HZKA 1M83A 1QCDA 3GJXB 1AQLA 1VQKH 2O23A 3WWZA 1DIRA 2GM9A 3OT1A 3DFUA 4AQ7A 1BMDA 4JLVA 2QWXA 3TLMA 4U6NA 2C84A 3GQBA 4WINA 5IW8A 1Z8HA 4N3AA 2XDWA 2PH7A 4O2AA 3UN1A 1R8JA 5B3LA 4UUAA 4TROA 2H54A 4PBTA 1OBHA 3IPLA 1K9VF 4DDVA 2W7OA 4KPGA 4BVHA 1L9KA 1QAPA 1G4HA 3FHJA 3NG1A 4U8HA 3DV0A 2HT1A 1YMUA 1OIXA 3KOZA 4IRCA 4B76A 2O54A 3VSCA 4O7YA 1YTKA 4IRUB 4RPGA 4NV3A 1VIAA 1TM2A 1H2WA 4DV3B 3AWDA 3PD0A 1G38A 4M0EA 4HTAA 4AKEA 1R9TA 4FFDA 1VLBA 2WKWA 3RSHA 3C74A 2G0NA 2ZYRA 1KI4A 4G5GA 1J90A 2G9VA 3LQFA 3LUCA 1WP4A 2ZU6A 2BW0A 2O0MA 1WLSA 5HSGA 2GBGA 4Q3NA 3ORHA 2HQSA 2OVBA 4FT4A 5JAZA 1S97A 4OQMA 4RIIA 5LB2A 3TNJA 4PZUA 5KBYA 1F48A 3RADC 3NHFA 1COWD 4LMPA 2BGMA 1P2BA 3IEIA 5BN4B 4NCKA 3GMDA 4WUVA 1VQ4H 3RS9A 3CSSA 2JGDA 4KN5A 1ZAUA 1EJBA 5B3JA 1N9GB 2C2YA 1PR5A 3N0WA 4IW3B 4F97A 2WOOA 2QL7A 4JYBA 4MA5A 1Z4IA 3BA9A 4G2TA 4KSBA 1UK9A 3LZCA 5JTTA 3Q9NA 4FJ0A 3T7SA 1TNDA 4L2IB 5FOVA 5KQRA 2QPAA 1N77A 2CD7A 4JITA 4D3DA 4CMEA 3VZDA 4B4DA 2C8LA 2G40A 3R4VA 4OXRA 2X1MA 4NZOA 3KQUA 3QG5A 1Z4OA 2O7QA 4PHHA 4F56A 1BW9B 2QD2A 2X0SA 4DUGA 2FG6C 1DG3A 1UANA 4BX3A 1PK7A 3OQBA 1Q5PA 3G2QA 2Q6TA 4J7XA 3ESBA 3FAKA 1UJ4A 5KQGA 5CFOA 2O2XA 4PINA 4ZQEA 5JNRA 4DQDA 2VOJA 4IIGA 2O9JA 3HXKA 3FPAA 3RHSA 3L7LA 4A5SA 3K6RA 4M46A 1WXEA 3GA5A 2IIPA 3R8FA 4H2DA 4R69A 4HAXA 1KEWA 3T0FA 2VF8A 4DR3B 5KS2A 3AVOA 5GONF 2X1LA 1ZCAA 1UPCA 1XDGA 1VL2A 4WLNA 1KTIA 1SD5A 3EYWA 2CNVA 5DGHA 4Y3UA 3K35A 2Y2UA 1SVLA 4BO5A 5CNIA 3A11A 2HJWA 2V03A 1Z28A 2ARKA 1CE8B 1E1LA 3HKEA 3ROZA 3UJPA 4MCIA 2UYOA 4OA8A 4B32A 1W4ZA 3IAS1 3EUEA 3P2IA 1FNBA 2WHXA 1DFHA 4WEQA 4M55A 4XARA 3CZPA 3BK2A 4BAUA 1U7DA 5JAUA 3JTEA 3RAGA 2AX3A 1XA4A 1GR0A 4KOAA 3AEKB 1QGYA 4IFTA 2ZSFA 3TNDA 2ZE7A 3S2UA 1ESNA 4M6WB 1V37A 3PGA1 2D7JA 2X76A 1NX9A 1P18A 1YJCA 3V1MA 4ZV4A 3DTVB 5BN5B 3DR3A 2ZQYA 2OP1A 1U99A 3FR8A 1A7AA 4FC6A 5D1OA 3D8NA 3HV2A 3BREA 1Q74A 3EY4A 5DI9A 4PNEA 2G9ZA 1OTHA 3MJFA 2GUGA 4OXYA 1RMQA 1J8QA 3FTNA 1RLIA 3WL7A 4A2WA 4KTVE 1U0FA 5I51A 5HM6A 1KI2A 4AULA 1R5OA 1TT5A 1KSGA 3TSZA 5DK4A 4F1WA 4C2MA 1NXQA 3GJ6A 4A2AA 3ZI7A 2Q27A 3U5TA 1LEHA 3K70D 2XNHA 4KNYA 3ENZA 4UEJA 4QU5A 1BRMA 3FNGA 3EARA 1H0KA 1G17A 2VTEA 2FJ0A 3PUWA 1J0EA 4Y2TA 2RGWA 5IVIA 2UU9H 1G8PA 3C4QA 4Q1VA 3LO5A 5BYKA 2V65A 5T4EA 3PEFA 1QB7A 4FLMA 4QGHA 5K3DA 3VNBA 1GRVA 3JQBA 3L06A 2FKAA 2HCFA 2ZM5A 4KHPB 5TX7A 3PR1A 4F5EA 3H05A 1PNOA 3OJFA 5BW4A 4D4HA 2ZDHA 3OFJA 4B0OA 4MMYB 4YRGA 3CCUH 2P6NA 3KCNA 5P21A 4V0NA 3WGTA 1LQTA 4II7A 1NGSA 2ACVA 3BKWA 1M75A 1GYRA 3DZCA 3JYNA 5CB4A 4TKVA 3TKAA 2QD4A 5DWVA 1L7BA 4HQLA 3TH5A 5CH8A 1QJ4A 4RPHA 1A9SA 4B3TH 5D86A 1OYWA 2XCRB 1VLZA 3M49A 4TN5A 3F78A 3M5PA 2YVKA 4N5HX 4BXOA 5KQPA 4GX2A 4JC0A 1F8UA 4D4IA 2OXTA 4WBNA 5FBHA 5UKDA 2ZREA 2EJTA 5BW8A 4JBWA 5LDHA 1C1DA 3DMNA 1N36H 4LZPA 4ZOQI 4UXIA 1FDIA 4KNVA 1ZNWA 1IXRC 2PUTA 2ZULA 2OFPA 2V0GA 3T9EA 3WMEA 1R6TA 3IESA 4C6TB 2NMVA 1Q0LA 2XTZA 1WZIA 2R44A 2IC5A 1UAYA 1V7PC 5IRCD 1GPNA 3C3XA 3WHPA 3RHTA 4ENUA 4GL2A 3V80A 3U9SA 2I4TA 2XLBA 4G8CA 5G1OA 1VIYA 3AR4A 3ZTWA 4X3CA 2A1HA 5LDGA 2OXFA 1PSDA 3IH5A 1Z75A 4HAUA 1NAIA 1YVPA 3U31A 5DH9A 2ALJA 4JBIA 2JKZA 2ZSJA 2WIGA 5J5CA 4G5QA 3X3HA 4EGJA 5HKBA 1KK0A 4LJ8A 3ZU2A 3LNTA 4JI3B 5BMVF 4XD7A 2ZUWA 5D1NA 3O8OA 4TZKA 3VGPA 3VOBA 2PWBA 3DCYA 3DNPA 1MEEA 2CYBA 2AU0A 3LC7O 4LF4H 2X5JO 3PQ2A 3LQ1A 1GFIA 1I3CA 1TU4A 3ZH2A 1K8YB 2WG0A 2AA3A 2R6DA 5D3MB 4ND2A 3KP1A 1UT8A 521PA 4E5YA 4NJOA 2OCPA 4O8CA 1J20A 3JQ8A 3AERB 2DAPA 5AKKA 3JQQA 3UKJA 2C5AA 5KFXA 4CFSA 5IUJC 1OTPA 3IP3A 3HN6A 1GV0A 2AW3A 4NZZA 3I45A 3JQGA 1TF7A 2QP4A 4J0JA 2JAXA 1EEHA 1OKKD 4E2ZA 4M1KA 3UMRA 5J9FA 4AS2A 4QDJA 3COWA 4PIPA 4YCMA 3TOXA 4FT2A 5K3FA 2ZRLA 4B3FX 2VZLA 1WOYA 5IM4F 2R66A 2VTVA 2BKAA 2PUVA 4EPXA 3TRFA 4BMZA 3R7DA 4X1YA 2X0IA 4U5XA 3EUFA 4XZ3B 5IP5A 4HYYA 2ECKA 3HR8A 4KX3A 5DX1A 4BHTA 2B30A 3QWFA 4MRMB 2GMWA 2ZPAA 2EKDA 2JJ8A 1SU8A 4O4IB 5BXQC 1G21E 1LSOA 5KKCA 4XTRA 1H3FA 3VTFA 4Z7QB 3L46A 3FVRA 2WUEA 4TV8A 1M54A 5U4QA 1LNQA 4O84A 4EUEA 4DWOA 1EWTA 1JB1A 1AE1A 3CLVA 3TD2A 1JLHA 1XLWA 2RHRA 4RETA 3RAPR 3H5OA 4GOJA 1GSIA 1ODCA 1N92A 1M3SA 2J9GA 1H4SA 2QDXA 2EGUA 3NHWA 4GR9A 5EGSA 1LLFA 1T6ZA 2HVRA 4I7HA 3QVVA 3F67A 4B84A 1GRRA 3TO5A 2JFOA 4ZAGA 2ZBUA 2GNAA 3SBDA 4DRZA 3FI9A 1C4WA 5JROA 3E3MA 3I53A 4ZJZA 2XCAA 1K98A 3U7FB 1UK8A 4N12A 4PLPA 5B5SA 3VPHA 1YL5A 4I1IA 4OL9A 1QM5A 1YE3A 2XMPA 1K8XB 1A5BB 3CVZA 4CR7A 5D8DA 3K8QA 2A84A 4AICA 1S3GA 3RHFA 3JQEA 5F3DA 3RKSA 1FB5A 1NPDA 4MQFA 2EKPA 4JSTA 5EQJB 4BP1A 3PQEA 1JSLA 2WE6A 2O8FA 2QLNA 3MFQA 2DUMA 5B7NA 2CHQA 5GY7A 4HPXB 2IHYA 1KP9A 3MS7A 1KDZA 2D5IA 4QAQA 3O8DA 3F9RA 1NYTA 3HVIA 4K9KA 3RODA 2JAQA 3H86A 1JLRA 5JCXA 3NORA 4WXPA 1H0SA 3TGPA 1NVBA 3NTRA 4JH0A 2PRYA 4QM6A 1JG1A 2IXTA 3H8JA 5TS2A 3GV5B 1VB5A 2C94A 4JR2A 3NEPX 3DB2A 3ZU3A 2Z58A 1BNCA 2IGTA 2EYQA 2KX7A 4M8SA 3FJYA 2NTVA 1Y69K 4GW3A 1HFJA 3GA0A 3CUYA 5EJ2A 1UZLA 2H1WA 3BWBA 2WYWA 1T9GR 2DETA 2ZBFA 2I9PA 2YRXA 2OOSA 3DBHA 1E3QA 1Z0AA 2WYVA 4DLBA 4U39A 3AW8A 1N2XA 5BPFA 4V2UA 4L74A 2IEYA 3K9WA 1QP0A 3VR3A 1N57A 3AB3A 5KJFA 2QT0A 1PT5A 4DLTA 4RMIA 3K4PA 3ZQUA 2FSIA 5C5CA 2FQWA 1Z83A 4ZT4A 2FRDC 3ABZA 3V6HA 1BVUA 4PHGA 5CLFA 3PW2A 2OPHA 3ZU6A 4EJ2A 3I42A 4TRJA 2G1AA 3IEKA 1SUWA 4N76A 3IG0A 4F84A 1Y48E 4ONEA 4F45A 4N18A 4RS4A 1CHDA 4AMVA 4YP7A 5H0IA 5EP8A 2NN3C 2WMDA 2Q5FA 2O5VA 2CVFA 3QE9Y 2WI8A 1NMYA 1E61A 2IX3A 4RE5A 2OLSA 1JU4A 3STYA 3N8KA 4RFLA 1JSZA 4PRLA 3HUTA 2OORA 2XV1A 2I2BA 4DXDA 5C35A 3RU3A 4FW9A 2RIRA 4HXYA 3AG6A 2JLBA 4BRUA 3FUCA 1HUQA 1SZPA 4FUQA 2R8BA 5KZMB 2QD5A 1G5FA 3QWIA 1VJ0A 3UENA 3E9DA 4WHMA 4BUJA 4LF5H 1NBIA 3H5IA 3L4SO 4QJBA 1HNWH 3RIHA 2BL4A 2EJVA 1ZX1A 3H5AA 2NUPB 3RJMA 2JLRA 1SBHA 3U56A 1EM8B 4R3WA 1PCXA 1P19A 3IVAA 4PWYA 2H5EA 3SJ7A 4HS9A 2FSFA 3CPEA 5K3BA 4WCFB 1EVLA 3MB8A 4RPKA 4CM3A 1TJ4A 1VHWA 1FSFA 1DRWA 3Q5DA 3WO1A 4XYEA 1CUHA 2AMFA 1A95A 3D1JA 3CXUA 5LL6P 4H7PA 1WW8A 3ICPA 2R5FA 3DTYA 3QEMB 5B7GA 2WUVA 2DF8A 5HK8A 1QX3A 4G0MA 2XVZA 2HRBA 3ITDA 3R5KA 1QZZA 3ZWMA 2W9AA 1TC1A 2VHEA 2YQ5A 2Y1FA 2V4UA 3G0CA 4RF5A 3GLVA 3HGTA 3PJEA 4MKGA 2YBEA 1Y3CE 4UCQA 4N6NA 1AU9A 4B3CA 4LISA 1S8FA 2QSJA 5JNLA 4MV9A 3DEKA 5HS4A 3RPFA 3QZUA 5IZ4A 4V0QA 5CLHA 3DD5A 2AOUB 2CT8A 4TMVA 5JDIC 3DOHA 1QIIA 4P4SB 2OCAA 1ID1A 1MVNA 1M2FA 1XYYA 1E2HA 2BFFB 4UBIA 1F51E 1HI9A 3WA7A 5JLJA 4RESA 4LTDA 1YS6A 3TQHA 3FH0A 4G5HA 1X7YB 2A1TS 4PN3A 1BJKA 2X6TA 3HABA 1N8TA 1X9GA 3HU5A 4ITVA 5JAQA 3LT0A 3K94A 1ZA1A 2A0FA 1P0QA 1R0SA 1PD1A 3SEQA 2XECA 3UJDA 1NI4B 2QSYA 1T26A 4JI8H 2C9DA 3HBMA 1FU8A 3V7FA 3H1PA 1AHHA 1S5PA 3NXSA 4J9PA 4F5DA 4D97A 1SQ0A 1QAQA 3H6KA 2TS1A 4KWHA 5C4MA 2X0KA 4ZCPA 2Q4DA 1LVUA 2B99A 4MPTA 3T7KA 2PUEA 2HA6A 4IJWA 3L7KA 3FTFA 3LNCA 1Z4QA 2C77A 3MTEA 1AD2A 2QLFA 1OXXK 2VJOA 2BGWA 5HTKA 3WLMA 1UBUS 4BQSA 2CVOA 1JAXA 1SVNA 4LXIA 4ENTA 1VQPH 4EHKA 2H4ZA 4MWSA 1N6LA 1DRUA 1RQ2A 1PR9A 3LUBA 1Y42X 1LX6A 1TGYA 4J94A 3WV5A 2UUCB 3AL0C 1P2TA 5F1PA 1HNZB 4HWSA 3FOAA 2DMRA 3D81A 3GLQA 3L49A 3Q0EA 5EJ7A 5FLYA 2DABA 3SR0A 5T4FA 4G5SA 2HHHH 1YZFA 5FCDA 1LNSA 3ENWA 1BVYF 2HV8A 4BJ6A 4IWYA 1GADO 2Q8QA 3JYPA 3DW1X 3N2YA 4MWCA 3AR3A 2FPPB 2UVWA 2D00A 3QELB 1U5BB 3CLTC 1GKLA 2QAGA 1RRMA 4QWBA 3VI4B 1QG0A 4WFBJ 2IBTA 3CW8X 1THTA 1LCIA 1X13A 4AD8A 1B6SA 4YP3A 1TUEA 3I2GA 1H85A 1VDVA 4M8NE 2YJ3A 1X1OA 1QG2A 4A23A 5HE8A 1EKVA 4C06A 4L76A 1B76A 1WBDA 1KIFA 2COIA 5I7AA 5CGQB 2QNIA 5KNBD 2LBPA 5CVVA 3BERA 1CF9A 2D2XA 1PJCA 3LXRA 4IFEA 1OAKA 3LZDA 4YEDA 3E9CA 1W73A 3F49S 4Z0HO 3GVXA 3QE2A 1BDJA 3LDFA 3R9KA 3VH1A 3MIZA 5I9SA 3MNFA 2IIBA 3D02A 3UUEA 2RHWA 4KIUA 2OXIA 3EVBA 4BUZA 1FVIA 1JEYA 4LRWA 4YRJA 2B7CA 3EX7C 3J81k 1W1WA 4WGFA 3I6IA 5U1PA 2CFIA 2VH1A 2VQFB 4U3JA 3WP1B 3B7WA 4EZEA 4A3BG 3IQDB 5I7RA 5LXTF 1T9BA 2WYOA 4DL4A 4ZC8A 4NZPA 2GN6A 1ZGHA 3WS7A 2Y6UA 1VBMA 5E1BA 1U5CA 1WG8A 3OE7D 5KWSA 1BD4A 5KMGB 1FMTA 3D8TA 4YJ3B 3WLRA 2BZSA 3VKWA 2RARA 5AKZA 1W0KD 3QX8A 1V25A 2R8IA 4ZARA 6REQB 3HCFA 3CUVA 5BN4A 3H4BA 5LYJF 2A6PA 3G9TA 1S7GA 1N9GA 1QIMA 4ND3A 1DWPA 3DR5A 3JZAA 4HBZA 2HMSA 2EKBA 3O4FA 5EXXA 3T5JA 3P2OA 2F55A 3KR2A 3S8EA 2E6KA 5H82A 4JV5B 4O83A 1N2EA 4XDYA 1YB5A 4PYLA 3NZEA 3RARA 4NPAA 2BONA 1FSZA 5KX5F 4NR0A 4NHOA 4WE3A 3RYIA 1IJBA 3BQ1A 1CUFA 5A5GA 3VDNB 4EHJA 2G25A 2H3HA 4UVIA 3P19A 1GTSA 3BFVA 1IYEA 4HNGA 1QX4A 4OHRA 2QTZA 4H1UA 5JR3A 1KE1A 5E7JA 4XE5A 2QN2A 1U7PA 1SBNE 1ZD3A 3ZGYA 3A36A 4GKAA 1GL9B 4DJDC 2AB0A 4B2LA 4X41A 5JSZA 2B25A 2NV0A 1BFKA 4OM8A 1JALA 3W5JA 3PENA 1KORA 4FZ5A 3V6MA 3A4TA 2VP6A 1ECGA 4FBTA 2HWXA 3F9CA 5IM5A 3FSJX 4C08A 3NNDA 3GTKA 3CLSC 4D8VA 1UBHS 1JHVA 3AP3A 4QVIA 2I8AA 3R3YA 1DTSA 4YPFA 2VFAA 3DTTA 4Y1FA 1V5EA 2DTEA 1OZHA 4MGIR 5IDYA 1NASA 3HSYA 4ZYLA 1F8GA 1NT4A 4ZI7A 3P9ZA 3I2JA 4BAGA 2HLDA 1GD1O 4DCOA 4ODIA 1OV4A 4JQCA 3OBIA 4OV6B 4LV6A 4WZBE 2A5DA 1VHJA 3EGCA 3VPBA 5CAEB 3RS5A 4AN1A 1T94A 1YBMA 1KJZA 4GE3A 4F4FA 2AOXA 4EW6A 4KLZA 1G3QA 3F90A 1K5DA 2VP5A 4HB2A 2DR0A 5K8UA 1R10A 1XZBA 3HVRA 1H4VB 5JFOA 3KQVA 3ZK9A 4LZWA 1RHQA 3AL3A 4I81A 4KXWA 1ZHSA 1S2NA 5JQGB 1SCQA 4PSKA 3CH7A 3N8NA 4COKA 3PUJA 5DV9A 1P2SA 4UNQA 4R2KA 3K1AB 5EZYA 3V46A 2AGQA 4XPIB 4M6WA 1KMQA 1PQ4A 3TG2A 4LGYA 1RE1A 3VHLB 4AY6A 1JHPA 3RGWS 4AMYA 5BN5A 5FPYA 3G5TA 1I6LA 1NBOA 1JHMA 1TJ5A 1PWYE 4JR0A 3UGJA 2IS2A 2HKIA 1R9NA 2EX4A 2NU9A 3IV6A 1KZ6A 3K20A 1LY1A 2VK1A 5IUNC 2AX4A 1A4RA 5TQ2A 1JJVA 1JKIA 2WILA 3LUPA 4PWZA 3S29A 5KQLA 4GFDA 1JWAB 4A8HA 7MDHA 2FMHA 4C7MA 3L0DA 4Q4JA 3F2VA 1YRLA 2XUGA 1MW8X 3AIOA 3IUNA 3GIQA 3OAAD 2OUIA 2O7SA 5DRYA 1E6MA 2AKEA 1L7QA 4CM9D 4BFTA 1FFAA 3K31A 3AB7A 4FYKA 2RDIA 1MGOA 2OKGA 3S7TA 2ZUFA 1QPZA 3OY2A 1SU7A 1E4EA 1ZMBA 3OPYI 1RRFA 5K9ZA 1BU5A 1NURA 4N5LA 1SHTX 3EXHB 5C51B 2M1XA 3MFHA 2NZUG 4BPBA 4KFSA 3WQHA 4B75A 5FXMA 2IDKA 3S2SA 1EWQA 2NTEA 4DZTA 1M1YB 4UJ5A 4HVLA 4EG6A 3S44A 4YAOA 1QIDA 2EU8A 3ZGLA 2HNKA 4EECA 3PTAA 2VHWA 2XJ4A 2XWSA 4P7KA 3IOCA 1RK6A 3QIAA 4MRVA 5JADA 2Y9MB 2HW8A 1P62B 4RY8A 3T12A 4QUHA 4NABA 5HIJA 3J80A 4L4SA 4AJIA 3ZY2A 3T06B 3CCQH 1ZH6A 1B8VA 3SJZA 3S1SA 3UMCA 3PVCA 1P8JA 4MW7A 1G5RA 3FWHA 2ZJPJ 3B13B 3M1IA 3W34A 1JR3A 1L5SA 2WU1A 2HQOA 2HGXA 3SMVA 3CY6A 3S5UA 4J9NA 4TKLA 2BELA 2L82A 1QCYA 3U4HA 3FCEA 4JI6H 5IYDG 2G7MC 5KDOA 2HDKA 5LU8A 4EFNA 3VZQA 1QP8A 1P1RA 1JAZA 3NV7A 1ISSA 4CT5A 1Z9BA 4LOHA 1MVOA 3ZXXA 3ZWOA 2W57A 3RVRA 1BC5A 4R1PA 2PJDA 1N7HA 3HG7A 5DOVA 3C7KA 1WPQA 3PNPA 2GA8A 2X6QA 2C8KA 4M49A 4KQXA 3LKVA 5AMXA 2OK8A 4YY3H 2QBYB 1U2DA 1DIOB 3LCJA 1JF8A 4MA0A 2REXB 3AHEA 2P9TA 2W2XA 5INTA 4E6NA 1JN0A 2DZDA 2ZK7A 3QU7A 2VZEA 3K5PA 4GOOD 1Z0DA 1SIWA 1Z16A 4GZMA 2EW2A 4ZT7A 3KZOA 3RAEC 2AJDA 4IIHA 4EF6A 4CIWA 3EIOA 1GILA 2JFHA 2DBZA 4EGSA 2RG1A 3AF5A 3BHNA 2AEEA 2BEVA 3HRHA 4UVDA 4I4NA 4QDOA 1W75A 3P9IA 5KFFA 2GYVA 5H3LA 4LHYA 1F9AA 4F72A 4C2TA 1X7XA 2EDAA 2VPSA 3IBSA 3KTAA 5HKLA 2RKWA 3HVUA 2F4VH 4CDRA 3A9SA 5IBQA 2OGSA 3OLXA 2ZGVA 2MT9A 3STWA 1EFRD 1EWRA 1XXHE 4DY6A 1O87A 3S55A 3PGKA 1WMBA 3ZV7A 3PS9A 3HCDA 4R6XA 3ITEA 2OCYC 1NZJA 2NO1A 2ZRDA 4WHXA 4CL0A 4W6QA 1G9XA 3NETA 1R4AA 4MYHA 3NU1A 3EFEA 2FP4B 1RXIA 1RM6A 4YRAA 1OFUX 3U16A 3CVYA 4FFPA 1OZAA 4HMOA 3BWMA 1SKBA 3SEZA 4MPPA 2GPAA 4YJ2A 3WBBA 1DC7A 2IDZA 3TTVA 5DLEA 3NV9A 3SVZA 3R2JA 1AS0A 1WETA 1RM3A 4MRMA 1UDCA 3PFFA 3ZCVA 4AMZA 4O4IA 1AHPA 2BH9A 1WXWA 4BCDA 5IT9A 1X1TA 1C2YA 2FB9A 3ZI0A 4HUJA 1T2DA 1JU9A 2ZDGA 3S1LA 1FDRA 5HJ7A 2OBXA 4FGWA 2RJOA 4IDGA 5HZHA 4CIAA 1OIVA 3ANYB 3SNOA 1ZI6A 1LPPA 4RKRA 3R7SA 2GVDC 2XGOA 2F8MA 2Y1EA 2ZVJA 5LUAA 4YNBA 2GAOA 2Q21A 3DPSA 1TQ4A 3B6KA 1BVRA 1T13A 3C70A 3KAJA 1VMIA 2XE4A 1BJRE 1XF1A 1XAHA 2BBWA 5CVTA 1NZFA 2QQ5A 2EIYA 4QLAA 1JDEA 5H4HA 5C5DA 2YV1A 2OCGA 4DUYB 4PC3A 3N42B 2HDNB 3CC2H 1RBYA 4HNAA 3CINA 1HL3A 2CV0A 4F2GA 5AYZA 1X8KA 3T1YH 2C4TA 3FVVA 2JEFA 4HGZA 4DBZA 5BWNA 1NN5A 3O82A 2BHLA 4BXXG 2WK6A 1ZJJA 2W0SA 5T64A 2R7KA 3FHLA 4I2VA 3Q40A 2FPKA 2CEKA 3SYLA 5DT9A 5LC1A 3RIMA 1V96A 2NYAA 3KKMA 1RWQA 1RYSA 3RVMA 4XXHA 5TJHA 3RROA 2PM8A 1I50A 3HDGA 4H4DA 3I0ZA 2PPLA 4Z9AA 4FFSA 2BTQB 4DKXA 1AZYA 5JD4A 1E2DA 3D1LA 5HUPA 2AQHA 3MCTA 1NNUA 3UXYA 5KWIA 5LWHA 4MUIA 3WVNA 5HF6A 4FGRA 1TE2A 1WUTA 2V9CA 5IXSA 3JQPA 1I4EB 2RAVA 4NKRA 4WH0A 3WKCA 3G6YA 3TNFA 2ZRCA 4IIXA 5B30A 5I48A 2HF9A 2BI4A 5FH9A 4D6XA 3R9XB 3CXRA 1BMTA 2H06A 2NYRA 2WJYA 2C82A 1CY6A 5GV7A 1GQ2A 4Q4DA 2AFIB 1IJKA 1PLLA 1Z36A 1N5RA 1V9SA 1XKTA 4F12A 1YR2A 2AG1A 4DSNA 1OYVA 1W36B 4DAAA 3KDPA 2QQGA 4GZ6A 4UCRA 1ZUWA 1E63A 4PM4A 3K8YA 4J90A 4G0OA 5CB8A 5BURA 4AJEA 4HFRA 2LXNA 1IDOA 1L3BA 3FNEA 2H2WA 3ETDA 3U26A 2DHRA 4AQYH 1INLA 4IZIA 3WGKA 4DY4A 2VHVA 4BFCA 3FRIA 3O8LA 4H08A 3AIMA 3S3TA 3L7IA 4MV0A 3ZHUA 2XXAB 4IIYA 1PJQA 2EBWA 1T6BY 2VWQA 1MEOA 3TJZA 3AOGA 3RAXA 4NMHA 4V0ME 4QUGA 4EO9A 1IXYA 2HSWA 3HUFA 3IHTA 4P7BA 1P81A 1WMDA 3LVQE 5LKRA 2O2GA 4K05A 3RRZA 3TFWA 2Y0PA 1AUQA 1V35A 1IEQA 3UTDA 2NUAB 3ROPA 1JJBA 3FMAA 5TVKA 5B2ZA 3MJTA 3DL2A 4ZVSA 4XVRA 1S2LA 1HKUA 4F7WA 3QQPA 2JFVA 3W9YA 4MW4A 3PEWA 3CA8A 4F86A 3A7EA 4MSUA 1GAQA 4IXMA 3VNQA 3U62A 4IINA 3MUFA 2HF8A 4KAFA 4MKIA 1BCSB 4V0LA 3B6IA 5FEMA 1C30B 3OE5A 2NUTB 2I2AA 2FK1A 4JX9A 4GPEA 2P91A 2Z4RA 2CN1A 4D4KA 4CGZA 3KD2A 3E7XA 2PL9A 1MTZA 3CUEF 5I8PA 4ZVLA 1T0PA 1D8TA 4WCFA 5CU7A 5E7MA 4F38A 4MPJA 3PIDA 4Y6LA 1L1RA 3OOHA 3W8EA 4FDVA 3AI2A 2Q5IA 1L7DA 4AP5A 3N3BC 3Q8XB 1NQAO 3WAKA 2PX2A 1GCGA 4CIDA 3VHQA 1W96A 3R7BA 621PA 3S4YA 3NVZC 2HMWA 4CXMA 2PKYX 1CD5A 3GZJA 2DQKA 3KHTA 4G36A 5L4NA 4NECA 4BY1G 2PUDA 1UP6A 3I9KA 1SPXA 4DANA 2NYVA 5KFCA 1TW2A 4BO2A 2RHLA 4K81B 5IBRA 4YV7A 5I5TA 4P5PA 4RHEA 1VPWA 3M1LA 3GVCA 2ZYWX 1FM0E 4KAAA 1AKWA 5G0WA 4PXAA 1GNLA 5KTYA 2XY4A 4RK4A 4M8IA 1I3QA 2W58A 4H9GA 1YS7A 3T7EA 3OZTA 4RU9A 2WJAA 3DMPA 1CP2A 1C1XA 1F17A 4RHUA 3G7UA 3B3JA 4GX0A 7ABPA 1A4XA 2OL4A 2IYVA 3BTSA 2FOIA 3HOZG 3ZDZB 1PK8A 5C3MA 2PUGA 3V5NA 1X86B 1NHGA 3LUFA 3U13A 5D2CA 2HIXA 3V8BA 3HA2A 1NI4A 1DAGA 5KFHA 1EX6A 4DV4B 1CRPA 1MXFA 4A03A 2HY7A 1OJLA 2JLUA 3K2BA 4UM7A 1AKYA 4BBAA 1X0VA 1GCOA 4IQ0A 1VLQA 1PSZA 3F7OA 1EVZA 5ALVA 3B38A 5FBWB 4ACAA 1RMYA 2V6FA 3F8WA 4PIVA 2A33A 1U8AA 1IHYA 2R82A 4NEHB 4YK7A 4BVFA 1ZIYA 4I50F 1FVOA 3HDTA 1OPXA 5EJ4A 2GHQA 3R1IA 4LFBB 5EMHA 1M5UA 1WUJS 4IH9A 3OFKA 2QYHA 2PZJA 4RK0A 4IUYA 1ML4A 1ZVMA 4R2LA 5KYNA 4OQYA 2I67A 3GRAA 2B5WA 3BUSA 2H9IA 3VPSA 2AH5A 3KSMA 4ZT5A 4DSUA 1CUIA 3N44B 1GVNB 3V2IA 3SF8A 4MLPA 3TTTA 2GCGA 2BKVA 2O7VA 1UMKA 3LOQA 1NYQA 1X39A 3DCNA 1Z2PX 1Z0ZA 2VPIA 4QYTA 3KKOA 1B42A 4RXTA 5CEEA 4ED8A 4PIMA 5KYVA 3EGWA 5GIOE 3KKLA 3CIOA 3D7KA 3ON5A 5JEDA 3PXEA 3FUVA 4GP9A 1DX4A 4BRSA 1N4AA 3COPA 3BSYA 3H5VA 2X7JA 4F5ZA 2H2GA 4BO0A 2Q4EA 5FUMA 4AMGA 2W4MA 2VQ3A 2EZ9A 3NIBA 3GWZA 2UUAH 4J0DA 4F50A 2CHGA 2QUIA 2YJ6A 2XUAA 2QTVB 3T4UA 3DZDA 1RXYA 5I9LA 1H69A 5ALQA 1RXCA 2OFWA 5F35A 1UADA 4LXHA 3QX9A 1DBIA 4MGKR 1YZUA 1CKMA 1Q44A 4S2EA 1SVUA 3HA7A 4X6LA 2G4CA 4RVUA 4FFWA 2E49A 2YFYA 2HMAA 2NVUA 3L8CA 1ZN8A 4Z2AA 3R0XA 2JLWA 3ZVKA 4KB5A 4JWTA 4D3YA 3EPIA 2WUWE 1J7JA 4EY7A 4I55B 1K3UB 2ZTVA 3GV8B 5YASA 4FGKA 3H5NA 2C07A 3SF0A 4XWWA 3QKRB 5LVAA 1TVMA 1LK7A 4J2TA 3WLOA 4QLBA 5LNK1 5C8YA 1UMDB 5KMGA 4YJ3A 4YPVA 4KR9A 4XD7D 1F4LA 1P73A 1O8BA 4QTZA 4HDMA 4D8YA 4KJZA 1I6UA 2WIKA 3NNSA 1TM5E 5HBGA 4ZEWA 1P9NA 3A7DA 5GOTA 3K0SA 1DXQA 5LR6A 4EGQA 2KWIA 3FNQA 2G5GX 2BMWA 5JNWA 1G63A 4TTJA 2OHJA 1GQFA 2WVHA 4F85A 4UMEA 4RMGA 3BDAA 3FZGA 4XLLA 3I9V6 3V34A 5BR8H 4C7ZA 1BXRA 3P1JA 4U1RA 3F3YA 3KDSE 1W19A 4P93A 3DKIA 2RK3A 1S3SA 3F6SA 3PDHA 3A9CA 1R6BX 1E5QA 3BS4A 4NBKA 5I3CA 5JZ9A 3BGWA 4JUDX 2M6RA 3SHWA 3FMPB 4DIBA 1WCMG 3D43A 4BNXA 1O5TA 5AKHA 1LF5A 1EX1A 2IZOA 1UOUA 4LSAA 4OYYA 4ARSA 1MR3F 1LS6A 4GZ5A 1Y5LA 4YDSA 3LSYA 1SD2A 3Q0TA 1MBZA 1NOKA 5FHQA 3UFXB 2IWHA 1J8DA 4L5AA 1WWKA 5CH5A 4BFUA 5KG1A 2ZWVA 3WLJA 4CU2A 1HYHA 3ZE6A 3Q2OA 4S1PA 4B3BA 1MH1A 5CH3A 3GPCA 1SB9A 3AVVA 2YBDA 4C05A 4D4GA 5KSWB 4A1OA 3OOEA 3GGCA 4Y2UA 5TGDA 1EGVB 5ELMA 5BSRA 3N2GB 3ELYA 3ZWKA 5ED4A 2OZEA 3SY8A 2F9LA 3KJHA 2YTZA 1V26A 3TW4A 1BHJA 4EYKA 2CMFA 4UE6A 3OCCA 4DLUA 2I80A 1KY5A 2XCSB 3O21A 1V8FA 2JFNA 2AXPA 3EIFA 2C97A 3A27A 3VAAA 2RHGB 1SIUA 4QXMA 3BMCB 4WFIA 2IPXA 1XNRH 4PQFA 2X1HA 2NOAA 3OTOB 4YYYA 2EJCA 5LLSA 5JQGA 2REOA 4NE7A 1YOVB 4NXMB 2XYQA 3CNBA 5AJZA 1CY2A 1W0CA 3CLHA 3RTAA 1GUFA 4FDUA 4D92A 3K1AA 3GLHE 4JBNA 4PX3A 3EIWA 5L4SA 2PEZA 5KOJB 3DVLA 1DJOA 4F4WA 3SIXA 2Q07A 1VBKA 4G4GA 1RYDA 4RZUA 4Q1FA 2GJ9A 3OQNA 1ZCJA 4AAYA 5K0BA 1NLUA 3OHPA 1IEXA 4TQSA 1E3LA 4B82A 2AUTA 1SB8A 1SCAA 1XB2A 3ID6C 3PFIA 2XUIA 2C59A 5BR7A 5KYGA 4JLNA 1KIAA 5SICE 4A2PA 2VHZA 2XNSA 1SVSA 4AJKA 3KAQA 1PQWA 4D9CA 1U0LA 2I7VA 4R81A 1ZD9A 3T7CA 3NWEA 4LJAA 3TLAA 2FR8C 4DCPA 4WKCA 4OTZA 3MVEA 4OU4A 3KVVA 4DC1A 2QPTA 1JLSA 3E3OA 5FWNA 5LIPA 1Q81J 2G1JA 3ZVNA 2G76A 3H1FA 3PC6A 3CJQA 2HA4A 4FX5A 2YJ4A 3CTMA 2YWFA 3BIIE 3G85A 4O6VA 2BGGA 3ZCQA 4W1SA 4MAAA 3LUJA 4J0KA 5B6IA 1N5WB 3EXHA 3G3EA 2KSWA 2Q3EA 1XNQH 4CF7A 1HORA 1P4RA 4YRKA 3VR3D 3FGOA 5CW1A 3Q6MA 1FYDA 4BQFA 3STVA 3PC3A 2VAXA 3F5MA 5TMPA 1VAJA 1Q1NA 3GP3A 3GXOA 4H7JA 4L6CA 1J5XA 2XGQA 2F9FA 2B21A 1FMFA 8OHMA 3H9BA 5AIBA 3ZDAA 3VR1A 3PV0A 4PX9A 1H6BA 3EMVA 1RPAA 5TEWA 4FWIB 5DNDA 1SC4A 2BSQA 5HVNA 1KAEA 1Q16A 5G1NA 1UXHA 2AOTB 2ZIUB 2HJ9A 9MHTA 3OQIA 2X9LA 1QPGA 2WUDA 4MWGA 2W11A 3ELWA 4C04A 2IP4A 1YJXA 4MP3A 3G7NA 1K6XA 4L8LA 3WMWA 1V95A 4YRTA 2J1LA 1RADA 4N40A 5HCNA 3GJ4A 3F73A 1XWWA 2YHIA 1IOVA 3WGGA 2WWXA 4EHFA 1KBOA 3D6AA 4L57A 5JALA 2VYNA 2H2FA 4QU0A 2GJ4A 3TJRA 2XE6A 1M2JA 3VX3A 2JGIA 5EKXA 3PNKA 5EZQA 1KQPA 3H6HA 3VHRA 4KDRA 3UK2A 5DIZA 3A8TA 4GVPA 1EUDB 3ROKA 4O86A 4RW0A 5F9HA 4QPZA 1ZQ9A 4LJKA 2QBYA 1I30A 4EHAA 3UXMA 1L4NA 3G2LA 3RYCB 2XMCA 3JQ7A 3M34A 1WCMA 1D2AA 1LFDB 3JCZA 1YBVA 5J40A 3FW1A 1X3SA 1MC8A 1CEYA 3DT9A 4WZ6A 4F6CA 4O5AA 5EHNA 4M7RA 2J0QA 5A7GA 3TLEA 1SIOA 4ZOAA 3H99A 1A69A 2YQZA 3JU3A 2YZKA 1MOZA 3HWWA 1I0IA 2DFVA 2Q8PA 1CUDA 1J24A 1TU3A 3GT7A 5AW6A 2HGSA 2JHGA 4PWQA 3F6EX 1ANKA 1JVSA 5BUSA 4JLAA 2HHFB 4F4ZA 2CBXA 4WXEA 2CNNA 1M6VB 4RV4A 4NJEB 4IILA 3SSAA 3NVYC 3RRYA 3OQ6A 1KOLA 1H6CA 4RHFA 1MCZA 4CC5A 4LXYA 3L1HA 1IUKA 2FP4A 2RG7A 1JXAA 1SCBA 1E64A 4BZWA 4PTLA 2V7EA 1F12A 1RYHA 5FWAA 1RAHA 3RJZA 4UE2A 5JC8A 2R1TA 4NBSA 1THGA 1S8OA 4X66H 3LGXA 1OYYA 1FS5A 2ANCA 3DOFA 3X1YA 3GH3A 2P6OA 1D1SA 3NM5A 4UBOA 1I1MA 4QIWE 4WN3A 3QYJA 5EC8A 4Q8EA 5FV7A 3BXXA 1JKJB 1YQEA 4JUIA 3R74A 5TLSA 5BN1A 3PDWA 1M1XB 5ALHA 1YI2H 3IUBA 1EA5A 2O20A 5LQUA 4FQ5A 2C03A 5A71A 1WE2A 4QSHA 1FMLA 4AS3A 2C2DA 2ZIEA 1ZR2A 1ZH8A 3Q8QB 2H1OA 2WD9A 1XZCA 2QUJA 3R8XA 3MWFA 1ZW1A 1B3BA 3WBKA 4IDBA 3KALA 5EPOA 1U3WA 5L6LB 5F76A 1SUDA 4M0PA 2C4HA 4QYMA 5H68A 4FYIA 4U9IS 2O3RA 5E9JA 4PG4A 1K8RA 2P11A 3GUCA 5KAMA 1EGMB 4MVJI 5JE8A 2OGZA 4JEUA 2D7DA 2DY1A 3NGMA 2ZUDA 2X23A 5ALOA 3N2LA 4ZP1A 4YRLA 5BW5A 4QIHA 2CXRA 3FYUB 2Q2UA 2H31A 2PE5A 1IBSA 1XCLA 1G8GA 3W5CA 2R1UA 4WK4B 1VJTA 4TZTA 3OECA 3IIJA 5J58A 1HDZA 4IDAA 1RHMA 3SC2A 1V5IA 4LF8B 2IXBA 3GEDA 4CKWB 1HKHA 1UBKS 2DULA 2O1WA 1I5RA 5LWQA 2OV6A 3I5UA 2HRRA 5DI3B 3VTAA 3LCUA 3KWLA 4J9KA 3P9CA 1CQIA 4GPBA 1VRVA 5C3UA 4PZZA 4OXNA 5KNCD 3CF6R 3WDLA 5EJFA 1MF7A 1K0UA 5ULLA 1V16B 1PBNA 3PLNA 1THMA 2BBOA 3CKKA 3LDUA 4L8WB 3A10A 1LF0A 2WDPA 2KS6A 3K6SB 3TOCA 1DTWB 1X42A 2Q28A 3SFZA 4CMDA 1Q7CA 3L6UA 1C9DB 1K9MJ 1HBJA 2VDUE 4O3OA 2QIOA 1HDRA 3KKKA 1N4DA 3FXAA 4N5MA 4Y6SA 2CV1A 4J0CA 1RLTA 4AYBE 1ZRNA 4QKQA 4YCJA 4W99A 3H4IA 1GPH1 1BKYA 1RWXA 1R6UA 5IEBA 1LWOA 3P2EA 3W6ZA 2VJYA 3EZ2A 2XXAA 5AK6A 4ZIRB 5CDFA 2XKJE 1M8KA 4WAUA 1WU8A 2PYDA 3PXAA 1HGXA 1H23A 5HX7A 3GT0A 2CMKA 4DA9A 4CR6A 2Y0SE 2UZIR 1O95A 9GPBA 1VM6A 5IANA 3C6ZA 2P1RA 2IU4A 3QVLA 4GLBA 1RKBA 2FEMA 1GLGA 3RU2A 2VS1A 4K6KA 4U2KA 1FSSA 4RKYA 2NPOA 1FP4B 1E6LA 2QTTA 4UVEA 3HFSA 2HJRA 3K0FA 1ZOSA 2UVDA 2PRIA 4QLOA 1KFCB 3AFIA 3KQSA 3NUAA 3CO5A 2HHLA 5IJ0B 1M1KJ 3UY4A 4A3JG 2D3WA 3BDVA 3VR5H 3IKVA 4XSHA 1YIAA 1KMCA 2NUTA 3L7DA 4URZR 2B94A 2XZPA 4IRKA 1QZXA 3KJZA 1E8MA 3OLYA 4RCVA 4OBWA 4M83A 2EHJA 1J1UA 3KXYT 1KZGB 2FWIA 4X00A 3SZOA 4PY2A 3IQGX 3FE2A 4BNKA 4MW1A 2X41A 2HB6A 1S4MA 3UKOA 5JATA 2H4HA 4G0XA 3D6TB 4QPJC 3V1NA 2OO3A 4HDCA 2WZQA 4PLGA 2G77B 1R4MB 5HL7J 2I4OA 3TXXA 4N01A 3QVJA 3PBKA 3R6LA 2CLLB 4S0ZA 1U31A 1MC5A 4IG9A 4ROTA 2DWCA 2EJBA 1PV2A 4N9WA 2F43B 1JDZA 3BOSA 1G0NA 3A6GA 3REQA 1D07A 3CISA 3IPCA 5C81A 4S1TA 4YH1A 1EKXA 1YAHA 1GG5A 4TGLA 4MYCA 4ARAA 2KBFA 5BSGA 3FPHA 5FB3A 3WYFA 2RGXA 4CE6A 2D62A 1Y9JA 2CV2A 4NH4A 3LQSA 1T5LA 1HQDA 3KLBA 2D8AA 1EA7A 2VNJA 1EBUA 2HLDD 1BXGB 3H83A 2P6PA 4ZFNA 3PW7A 3IOBA 3T3OA 3E81A 1G5QA 1FU4A 3L8GA 2H3EA 5L4LA 4CMHA 5I4BA 4W5OA 1O2DA 5CJ2A 3SOPA 4O3QA 5KKAA 2PUAA 1XAJA 2FZEA 1SKQA 3H6GA 1K2VN 3MJ4A 3NBZB 3EVGA 1S03G 1FQJA 4O2BB 1I3LA 1KR5A 5MHTA 2YWDA 1T3NA 2ZM6H 2QG4A 3UIEA 3ZE8A 4X8LA 1AHNA 1E5VA 2UYQA 121PA 3VKHA 2DR2A 1TTPB 5L3SB 3I76A 1UBRS 5DNVA 3HY6A 2GH1A 2UKDA 1LBHA 1P7PA 5IARA 3CRQA 4M21A 5L51A 2PL5A 2BGJA 3ML1A 1KJQA 2CCKA 3NVDA 4LK2A 4ML3A 4TN1A 3EDCA 4PAQA 3DVRX 2XZOA 1XEFA 2L17A 3K73O 5LA6F 5DBHX 4TXHA 1EGQA 3NHYA 1DX6A 4J49A 1JIQA 1UPTA 4BC1A 3T5LA 2IZ7A 2LKCA 4EKNB 1V6CA 2P9GA 3BJEA 4EGAA 5C8ZA 3OQPA 1Q0ZA 4UTRA 2BCEA 1USUA 2PLRA 3FY4A 5HM8A 1JRLA 3LW8A 4EVIA 2A1TR 3HOUG 3NDRA 5FR1A 1N5DA 1JXOA 3ESXA 3IPRA 3JATB 2VAMA 4ECQA 2PKWA 1GZUA 5FEUA 3WKDA 3LYHA 4QYIB 3OUUA 3OPQA 4ZEMA 4YGXB 3IAFA 3CRVA 2FVXA 4ED9A 3DV2A 1PQPA 1CNEA 5CYFA 4A91A 4ECWA 2VQDA 4AKTA 4B7CA 5M04A 4ME6A 1KS2A 3CC8A 2GVNA 1BX1A 1NVGA 2IMWP 3TQFA 1XCOA 4B46A 2HIMA 3T41A 4DBLE 4GLLA 3P0HA 2OHFA 4L2IA 4P7FA 1WHTB 1XMVA 4UAJA 4X62H 3UK1A 3TIGA 1ZM4A 2HA2A 2W5UA 2C04A 5T6MA 1ZNQO 2ODWA 1J7KA 3ZE7A 3BN3A 1OASA 1BW9A 3LBHA 4YXWA 3RREA 1SWWA 4M22A 4Q1CA 5A0TA 3N87A 4Y2JA 2GFQA 1EKFA 3CZ5A 1JR3D 4LHXA 2G5PA 2QTVA 1HZZA 3FPFA 3A58B 1W2GA 1F0YA 3GZ4A 3G5UA 4KH0A 1DQSA 3HMQA 2QTGA 3VYWA 2VJQA 2GPSA 3WRXC 2XTMA 5L6MB 5C34B 3L5OA 3V7NA 1US8B 2JS7A 3FTDA 3U3ZA 2ZR8A 4RJKA 4RH1A 4WFKA 2CUNA 4RLQA 2WDTA 1NW9B 3U54A 1VSTA 4Z9BA 4O7VA 1STOA 2PXAA 2V1XA 3X1XA 2IZ6A 1HR0H 3P96A 1N5JA 3UWDA 4J7AA 3FZQA 1YUNA 4DNOA 2VUSA 1D4AA 4UTPA 4NWIA 2B8TA 2F3QA 3LPDA 1C8BA 1Q3KA 3VNAA 4FEGA 2X15A 4UBKA 3ROGA 3W5BA 1PNTA 4FZVA 1ZHFA 1ST3A 1XDZA 3N2KB 4JGBA 5DHRA 1JG7A 3IMGA 1CE8A 1EK0A 4DB4A 5LBIA 2FE4A 1XMQH 4M37A 3LK7A 2R00C 1GARA 2QMQA 3GIMA 4M7EA 3H7IA 1QH9A 3RG8A 4JYZA 1IBMH 1LK0A 3ABQB 1H2EA 1KDTA 2ECPA 5BR1A 4O7RA 4YAJB 2BMVA 3AEKA 1PTKA 3GO4A 1E1KA 4RD0A 3OX4A 1TKAA 3IXMA 4WOPA 4YRRA 2PA3A 5EIWA 1B2RA 3W2HA 3PRKE 5AI8A 3DTVA 1CEEA 5L9XA 1GZ6A 5I01A 4H0CA 1SXIA 1U0OC 5DP1A 1YVDA 2FXIA 1ARZA 3OJCA 3F0TA 1UJ2A 3OZFA 3BHJA 2VF7A 4JB0A 4MV3A 3W8RA 1Y6GA 1X3LA 4DLPA 3AN1A 3C5HA 1TAHA 3AF3A 5BUQA 2VF4X 1I2ZA 2HCBA 3U3OA 4MP6A 2VNSA 4EHLA 4BNUA 5DSTA 1DJMA 4XJXA 2PMZA 2I1WA 4A4DA 4OXQA 5KB3A 1CUSA 3DA8A 4DAOA 4KXNA 3UFXA 3BMOB 4B83A 3E8MA 4L9RA 5DHUA 3IMKA 1URPA 2K5UA 2Y1WA 3E8XA 4HUQB 2NPIA 1WJGA 5HDBB 2SNIE 2REQB 4MI9A 5FKJA 3AY6A 4LN1A 1D4FA 2Y27A 3B7PA 3DQPA 2PLWA 2WNSA 4ZOLB 3BE8A 4UW9A 2C2WA 3DOOA 1LBSA 4RAOA 3OJOA 4ZO9A 2FFQA 5K4HA 2AE1A 1BOOA 2YN2A 4JD5A 4DNQA 3PQFA 4UC0A 1KPHA 4RNCA 2VUHB 3UT0A 2W4QA 3IAEA 1A3CA 3P5SA 3CNHA 5B6PA 1LI5A 5DM1A 3BC1A 5JD6A 2DT5A 2Z2XA 3E0QA 1T2CA 3TQQA 1XALA 3WXMA 2X8JB 3G1WA 3BMCA 2JGRA 4G25A 4V3CA 5GWXA 2H4WA 1W46A 4LJ6A 2IYAA 4AZVA 4F9FA