5HULA

Crystal structure of nadc deletion mutant in cubic space group
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
284
structure length
284
Chain Sequence
STDLTPFQIDDTLKAALREDVHSEDYSTNAIFDHHGQAKVSLFAKEAGVLAGLTVFQRVFTLFDEVTFQNPHQFKDGDRLTSGDLVLEIIGSVRSLLTCERVALNFLQHLSGIASMTAAYVEALGDDRIKVFDTRKTTPNLRLFEKYAVRVGGGYNHRFNLSDAIMLKDNHIAAVGSVQKAIAQARAYAPFVKMVEVEVESLAAAEEAAAAGVDIIMLDNMSLEQIEQAITLIAGRSRIECSGNIDMTTISRFRGLAIDYVSSGSLTHSAKSLDFSMKGLTYLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Quinolinate phosphoribosyltransferase
publication title Streptococcus pyogenes quinolinate-salvage pathway-structural and functional studies of quinolinate phosphoribosyl transferase and NH3 -dependent NAD(+) synthetase.
pubmed doi rcsb
source organism Streptococcus pyogenes serotype m49 (strain nz131)
molecule tags Transferase
total genus 91
structure length 284
sequence length 284
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.19: Nicotinate-nucleotide diphosphorylase (carboxylating).
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01729 QRPTase_C Quinolinate phosphoribosyl transferase, C-terminal domain
A PF02749 QRPTase_N Quinolinate phosphoribosyl transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5hulA02
3.90.1170.20 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Quinolinate phosphoribosyl transferase, N-terminal domain 5hulA01
3G3MA 2EF9A 5AHLA 1TO3A 2YFOA 4U4MA 2GPTA 3SIZA 2O7QA 3RMJA 1WXJA 1HO1A 4IGHA 1G4EA 1YADA 2X2GA 5BW6A 1VZWA 3R8RA 4RX0A 3UZJA 2ZCGA 3S42A 3FKKA 3L9CA 4JTIA 2P0OA 2Q8ZA 2Q3RA 2YYTA 2RFGA 5AHEA 2TPSA 3HG5A 2YPIA 1ADOA 3BPWA 2VFDA 4RCXA 2H8ZA 3SY5A 2VKZG 4AVFA 3CU2A 4M6VA 2ZYFA 5CPLA 3LV5A 4EF8A 1KFCA 2FQIA 3NPWA 4UTJA 1GYNA 4GJ1A 3RLVA 4LV4A 2VFGA 4UFHA 1V7YA 4N4QA 3GDTA 3R2GA 5U7SA 4NJJA 4A21A 1TCDA 5FF4A 3DH7A 2GOUA 1FUYA 4LVDA 5DY3A 4O28A 3W1NA 4QISA 3TSDA 1VYSX 4O4VA 4JX5A 1TRDA 5FEZA 3VKJA 1A5AA 4K8EA 5SWUA 1GVFA 4GE8A 3STCA 3SSJA 1PHWA 2QCMA 2QKFA 4R7JA 3MP5A 3FYPA 1VLWA 3GKAA 2VEMA 5CZSA 2ATSA 2GQ8A 5FF7A 2ZRWA 3W1QA 4OBTA 3TMQA 3IEBA 2ZBTA 2CLMA 3L0GA 4GC4A 4JTHA 3TV8A 1VJIA 3C2OA 3K30A 2AQWA 2DZPA 1W5OA 2Y7EA 4UFMA 3P80A 2C18A 3OA3A 3G1FA 2TYSA 3DKJA 2TMDA 1V5XA 4MFEA 1EWEA 3NOEA 3W2LA 2PCQA 3S1WA 3LCLA 3MYOA 1UBSA 3TW6A 3GIYA 2J9XA 4NZFA 3HGSA 2OX1A 4WXYA 5F4XA 3GR8A 1MXSA 3CM4A 3O8AA 2CW6A 2ZRYA 4LY8A 2TRSA 1PIIA 3GDLA 4DO5A 3KHJA 3LM7A 1MZHA 2AGKA 2B7QA 4BR1A 2G97A 3UY7A 1P1XA 5AC7A 5EA9A 4N6FA 3R12A 1R2SA 1DV7A 3G1DA 5K9XA 3PVFA 3B05A 1RR2A 3QQ0A 4UFKA 3ZWSA 3NQ7A 1TQXA 4DPPA 2Y63A 3GXTA 4EIVA 2A7NA 3TXVA 4UR7A 1IXOA 1KM1A 4XUGA 3G8EA 3G1VA 3NQAA 2P1FA 4AXKA 3SI9A 1G4TA 5IBXC 3FA5A 1WBHA 5F4SA 3F03K 4KFOA 4CNNA 3L21A 4QNEA 3O06A 4MYXA 4HSNA 3O6DA 4JTTA 3KVLA 2QAFA 1GT8A 1YPIA 3DKLA 4XKYA 5CZJA 3TIMA 1K03A 3W2MA 4LVAA 3SFKA 3W2UA 2DZWA 2E6FA 4E0CA 5DXYA 4EWND 5KINA 3LCHA 1U83A 4JX4A 4FNQA 4JYFA 3TSBA 5KSWA 3U2OA 4IQLA 3T4CA 1QAPA 4UTIA 3PB0A 4A2RA 4PFMA 2GJLA 1LOSA 2CLOA 4WQ6A 1JR1A 1F76A 4LWWA 1SFJA 3UWVA 1PCKA 2E1DA 2YCEA 3MHGA 5H91A 3VI2A 2ISSA 2QUTA 3N9RA 3QM3A 2ZDRA 3G18A 3CC1A 3P8JA 3P81A 1SW3A 1B3OA 1CW2A 3PG8A 4JYDA 1PCWA 4XZ9A 2QJGA 1W5PA 1VCVA 4O16A 5EMUA 1UUMA 2OZ0A 1OFDA 3O05A 3F4WA 4ICNA 4Y8FA 1XI3A 4AWTA 3N2MA 1WOAA 3GK0A 4NX0A 5LNWA 2QCCA 3CT7A 2RH9A 3KVKA 3OVQA 3W7NA 2F7FA 4LS2A 4BI5A 1TJPA 2A5HA 1NFBA 3MMTA 5DBTA 3I68A 1BWLA 1XL9A 3UWUA 4LU0A 4EVZA 1F5ZA 3HB9A 1X8FA 4AHPA 3BK0A 3DXIA 3WK1A 2V30A 1L6SA 4N6EA 4KKXA 4O19A 5K9DA 3C52A 3PBUA 1ICPA 4XWUA 4XTDA 3C2EA 3QQ1A 2FTPA 5KTLA 1OHLA 5F1UA 1SSDA 1SQ7A 2NUXA 1G6CA 3ABOA 3BGGA 4BWLC 2VFIA 5D2WA 5E0KA 4E2BA 1JCNA 4M6PA 4M7TA 1H7OA 4K38A 5FESA 3CWNA 4X9SA 4JTKA 3W2KA 1FWSA 1QR7A 3PSWA 3TNOA 4WOQA 1OFPA 4RXFA 3STGA 3HGRA 1OFAA 4O57A 2CWNA 5AYZA 3FJ6A 4A22A 2IQTA 1AW5A 2H90A 4IOTA 1B9BA 5BMXA 5K2ZA 1OX4A 5DELA 3NEVA 3N9SA 4I7WA 4LNYA 1XCFA 3W3OA 4JYEA 3CB8A 3HJZA 5K3VA 4IJBA 4UTLA 1WQ5A 1EP3A 3MYPA 3BARA 2FPTA 2FDSA 2H3DA 3IVTA 4ZQRA 3PAJA 4K8HA 1XM3A 1G69A 5F2GA 4QNWA 4WY0F 1GTHA 1LTDA 1FDJA 4HSOA 4LS1A 1KFKA 4JX6A 3WFAA 3PSVA 1JRBA 3NQEA 1W31A 3E12A 4IPJA 4RZ4A 1Q6OA 4AB4A 3U8GA 3PUOA 2ZZ3A 3TUUA 1W5QA 1JUEA 3QPYA 4UTHA 2DP3A 3I7SA 1Z44A 4LC8A 4NZJA 5FEXA 1Q3NA 5AFDA 4UFIA 4LTSA 4N9EA 4BI7A 3UWYA 1KFBA 5AHMA 4GBUA 5TQLA 4DBEA 4TX9A 3LRLA 5AB3A 4JTGA 4IXHA 4MY9A 1GTEA 4Q4KA 3TQKA 4UTUA 4LS0A 5MHBA 3HG4A 2ZZ7A 3TA6A 4HPJA 1XDMA 2JBMA 4NXKA 2J9YA 4GUHA 1KLYA 4BK9A 4HNUA 2I1OA 1LROA 1SO4A 3LB0A 4FO4A 2Z6JA 1THFD 2EAWA 4FX7A 1W56A 3QRHA 3EWBX 2NWSA 3UNDA 5KZEA 4JR5A 2VC6A 3EX6A 3TE9A 5AYXA 3VE9A 1Q6QA 5K4XA 2G5WA 4N9CA 3C3NA 1TPEA 1Q45A 3M44A 4JTUA 2GVJA 4UCGA 3FKRA 1PS9A 3E02A 1XFBA 3MHFA 3PF3A 5F1VA 1HTIA 1F73A 4ZQPA 4O13A 1A5CA 3DHDA 1ONRA 4XBKA 2YZRA 2NXIA 1B4KA 2X1UA 2A6NA 3GNNA 3CWOX 4Z08A 4DO4A 3ZFHA 2Y85A 4R53A 2DZVA 3W7JA 1H7RA 2V8ZA 3DFNA 4B5NA 4QAIA 2NX1A 2OJPA 4O50A 4OV9A 4N9BA 5LNVA 2QAPA 3LTPA 4S2CA 5KZDA 2CFFA 1LDCA 3GKFA 4AEOA 3PR2A 3UYCA 1KLZA 3RK8A 1JUBA 5E93A 3EWUA 1ZNNA 4ML9A 1LRTA 4AWSA 3BVJA 2FLIA 5A5WA 2A1YA 2ZFAA 3SJ3A 4D2JA 3GB6A 3GAKA 4GWEA 4LOCA 1KV5A 3OG3A 4O0KA 1FCBA 3AJXA 5HR6A 1YXYA 4OE7A 3ELFA 1AL7A 5AHNA 4M19A 3OHIA 3W84A 5D2VA 3WK0A 3EWZA 4IWWA 1ZY9A 4XKYB 2FJKA 3Q37A 3EKZA 4AMAA 4N9DA 2DZXA 4JIPA 3A5VA 4FNPA 4MJMA 1YTEA 1GVRA 3LI0A 1K8ZA 1KM5A 1UUOA 3M9YA 4LC6A 2DORA 5DY2A 2VELA 4O53A 4ZVJA 1XBVA 2V0TA 3O6CA 4LRTA 1O94A 3EX2A 2J9ZA 4Z1BA 3TC7A 1LOQA 5ABTA 1J4EA 4IUOA 3W1AA 3MI6A 3BV4A 1DVJA 3BLEA 4IMFA 1XXXA 2Y7FA 5D04C 4MPQA 3B8DA 2R8WA 3MBDA 3PBYA 3VE7A 2GVGA 3NL6A 1H62A 3O6YX 5AC8A 1QO5A 3W83A 1YLVA 3B06A 3I6RA 1UASA 4ZMGA 2PRHA 3D0CA 4BI6A 3NXFA 3EB2A 5AHFA 4QITA 3TSMA 3CTLA 1FXQA 3FJLA 2DZUA 3QSTA 1ZJIA 1I4NA 3INPA 5FF0A 1KV8A 1JULA 3UWQA 4JTLA 3LBMA 5EBUA 2BTMA 4NXSA 3O1NA 1LRQA 3LXAA 1LRNA 1LBLA 1LBMA 3NPVA 5G1TA 5LGXA 3W1XA 2C1HA 3C2RA 4MKNA 2QUUA 1K7FA 1JCJA 2Y61A 3DI0A 3NYZA 4TIMA 3A24A 2Y62A 4ONVA 3UQNA 4Z1CA 1EB3A 1M7PA 1WV2A 1VC4A 4FEZA 3W7CA 1K02A 2X1SA 2ZZ5A 1VR6A 1EIXA 4RZ5A 4Y6GA 3PUEA 4AHOA 1AL8A 4NQ1A 2E6YA 1F05A 2VEIA 3HQ1A 2BXVA 4JY8A 1Y0EA 2Q3OA 2HS6A 2CLIA 3CIWA 4A2SA 5LNSA 2QCFA 3I7RA 1U5JA 4DF2A 5IM51 2RKXA 5G4WA 4ADUA 2ATMA 2C13A 3P8IA 5D38A 1ZHAA 1EP2A 3NGJA 1IF2A 4TR9A 1R30A 1XBXA 4ZQNA 3TQVA 1IIHA 1A53A 3QH2A 5CSRA 4MFDA 2W79A 4MUZA 3TR2A 1OX4B 1TV5A 2Z6IA 2J24A 1X1ZA 2PURA 3FIGA 4J9JA 1LLWA 3QW3A 1JRCA 3RFAA 3FFSA 5DCBA 3C56A 3NQ6A 4LUIA 1WDWA 1KA9F 3UD6A 1ICSA 5AYYA 4ZL1A 3C6CA 1SW7A 5F2MA 4DEFA 4NU7A 1KM4A 4HNNA 1I2PA 2Y89A 5FI8A 5HUPA 4JTJA 3W71A 3G0XA 2VFFA 4Q32A 2TSYA 4A3UA 3THAA 1D3GA 3TKFA 5CPMA 2R14A 1R47A 1YPFA 5G4EA 5EYWA 1I45A 4HHPA 5D02A 2JKEA 5CZTA 1EUNA 3GX9A 2V5LA 4KWWA 1PVNA 1FDZA 3IV3A 3NQFA 1BTMA 1ICQA 3TJLA 5CG7A 2QCHA 2ZRXA 3V75A 2QCGA 4NJIA 2E77A 4YXGA 4O11A 1RV8A 5EPDA 2NXGA 4JY9A 3P5ZA 3W1UA 3IIPA 1G7VA 2B7OA 5D2YA 1NEYA 2GQ9A 2CZFA 2RHGA 2FPVA 4JD4A 5LKYA 3LCFA 3P84A 1ZAJA 2HMCA 4DXVA 2ZRVA 4O18A 4O1AA 1HFBA 5U4NA 5I3HA 3PS7A 3GZ3A 1FCQA 4FB7A 1GOXA 2J88A 5C6MA 5A8GA 1C9DA 3P61A 3P5YA 3TW7A 4WD0A 3G22A 2CLLA 4FHAA 3L65A 3CLMA 4PL2A 2QDHA 3BGJA 4OU1A 1TREA 3BW4A 1GPWA 5I3KA 1B57A 4ADSA 4RXGA 2WSYA 2EKCA 1SSGA 2CLHA 3DU0A 5D37A 2C19A 1TYGA 5D2XA 4K39A 3TX9A 3SW6A 1SZEA 1F7BA 1ALDA 4OWGA 1VRDA 1ME7A 1O5KA 1G4PA 3W88A 2WNNA 2ZA1A 3P60A 3W7RA 1Q6LA 3NM3A 3GDRA 2G96A 1S3HA 4L4MA 3W7EA 2B7NA 1EP1A 3W9ZA 1AG1O 3M41A 5G1YA 2NZLA 2AAMA 1OJXA 4ORIA 2YX0A 4CLMA 1CX9A 1VCFA 3LRMA 4Z1AA 1VHNA 3M16A 4WY0A 1Z42A 1FQ0A 4CQ9A 1TTPA 1C29A 4PTNA 2YSWA 2YGYA 3KAOA 1KBJA 3LHVA 2R94A 5K7JA 3S9YA 1NAL1 1GVQA 3N14A 2UV8G 3W7DA 3LX9A 4CCCA 1TB3A 1R46A 1J5TA 3WK3A 1R2TA 4M7SA 3GYEA 5TBOA 3USBA 1L6WA 3DFOA 3S1UA 4AAJA 3TK7A 1AMKA 3LHWA 3P74A 4FXRA 3QF0A 4JTSA 3V1PA 1LBFA 4PC8A 5CZ0A 4YWIA 1HUVA 3WJYA 4FNUA 1JCXA 1OFRA 1H1YA 2BSLA 1J2WA 1TIMA 4XQ6A 3W1TA 3M5YA 4FNRA 1Z41A 4MZ8A 3OBKA 3PBWA 1SO5A 1Q6RA 3NZ1A 3LERA 4TMCA 4R34A 4C1KA 1YTDA 1EX5A 1AW1A 1KM2A 2WPBA 5DXXA 1XC4A 3H54A 4UTTA 3RF9A 1YXCA 1EEPA 1GVOA 1WX0A 4NX5A 3LLDA 3M5ZA 3W1PA 3IVSA 2ABAA 4A29A 3LHTA 3NQMA 3W75A 3STEA 3TAKA 1OX6A 1OFEA 5HJLA 1A50A 2EHHA 5I3JA 2VXNA 1LOLA 1SO6A 3TQ0A 5CGQA 1H5YA 1O5XA 4BFAA 5LNUA 1QO2A 3LGEA 4PEKA 1HL2A 4IX0A 4O52A 4ZQMA 3T40A 5I3FA 3W7KA 5CSSA 4JTFA 1PHQA 1WYIA 3H55A 4UIOA 5AN7A 4ALDA 3VNDA 2VEKA 1P0KA 2NX9A 1B4EA 1DOSA 3LCWA 1FY6A 1SU5A 3TFXA 5KZMA 3E0IA 3P67A 4MZYA 1H7XA 3VCRA 1VQTA 4QQ3A 4NJGA 3RU6A 4UNLA 5LSMA 4HNTA 3H53A 1QPQA 1KFJA 3IGSA 1O60A 3WJXA 5F2IA 3T55A 3HGJA 5G2IA 4DO6A 5I3GA 1KW1A 1JCYA 1SPQA 1P0NA 3C0JA 3UXDA 1QNVA 5CKSA 4KWVA 3GDMA 3L5MA 4FIQA 3HF3A 5GVJA 3E96A 5TIMA 1HG3A 3Q94A 5D05A 2WJZA 4E38A 2Y7GA 2X1TA 3TDFA 3JR2A 2JK2A 3GVGA 1ML1A 3W1MA 5FEPA 2F84A 2RDUA 2NUYA 3CEPA 3W74A 5HINA 2C14A 3FEMA 4NNBA 3OIXA 3NPXA 1G7UA 4TU1A 3NA8A 7TIMA 3PUDA 5BMWA 1QPOA 5BOOA 4NJHA 4X2RA 2ALDA 3DI1A 3B0UX 2QDGA 3IIZA 1JVNA 1VYRA 4XBSA 2DZSA 1LZOA 4ADTA 3MW7A 1JCMP 1W8SA 1RQEA 4KFPA 1TV8A 3SR7A 3C61A 2YYUA 1G4SA 2ZTKA 2GJNA 1M5WA 5DLCA 2A7PA 4N4PA 4UNKA 2E6DA 5C55A 3W73A 4UTKA 3W7IA 3S5ZA 3FS2A 4AHQA 3ATYA 4RZ6A 3O16A 4NNCA 1K7EA 2CU0A 3NQ8A 4N2YA 3R89A 1UJPA 4DQWA 5HWMA 3VFLA 3NPUA 5AHIA 2QCNA 4DELA 2ZTJA 3GXPA 2WSQA 2E68A 1NF0A 1W54A 3CPRA 3M6YA 1H1ZA 2BX7A 4YLWA 2YFNA 2V9DA 4NVTA 3OVRA 1DJQA 1F2JA 1SO3A 2XN1A 3W7PA 4IMCA 1OF6A 1D9EA 1ZALA 3S1XA 4LUJA 4I7UA 5EKYA 3NM1A 3T78A 4H4IA 3SZ8A 4Z1DA 3W87A 1OFOA 3M0ZA 3UZ5A 1LP6A 4H6KA 3NQVA 3SGZA 4AWUA 1QPNA 2QCEA 1FXPA 2OCZA 3KVJA 3P62A 3WJWA 1DHPA 4UR8A 4YCOA 1YDOA 3W7HA 3UWWA 3KFTA 1FDYA 2ZRUA 3CEUA 4MJZA 2CZ5A 3B03A 4MLJA 5BNKA 3WJSA 2JGYA 2WO5A 2ZQ0A 3BG5A 2JKAA 5FEWA 1QCWA 4JICA 4NJKA 3A5FA 4NT0A 2E09A 1FCVA 4QJ1A 2JGQA 3KX6A 4G1KA 3S5OA 3KRSA 4WX2A 2GUUA 5KMYA 2X1RA 4CCEA 2ISVA 2WV8A 3MJYA 5DN1A 3QC3A 4WY0B 5G5IA 2VFEA 3BW3A 4O8RA 4QSHA 1N8FA 3HMJG 3DFQA 3LCIA 3O07A 1WAUA 4W9TA 1ZAIA 2PRMA 1NSJA 1YXDA 2DJLA 2E5DA 4LRSA 2YW3A 2NV1A 2CLEA 4WUIA 3LLFA 5I3IA 3EX3A 3C4UA 5F2LA 1KM6A 2W0UA 3DAQA 5G2WA 2I14A 1ZCOA 4PCFA 2DJXA 4PA8A 1XDLA 3A9IA 1TMHA 3ZR4A 1XKYA 4QM1A 4MVAA 1QPRA 3B4UA 4JDYA 3S0CA 4Y9AA 1QOPA 3THQA 5D2TA 3W23A 4AF0A 4CCDA 3W7LA 3SECA 3EXRA 1N55A 1VPXA 1OYCA 4TMBA 1T99A 5HWJA 3O15A 4FNSA 4O1CA 1DORA 3R13A 2Y6ZA 3G24A 4LVFA 3UWZA 5BRBA 3PG9A 1SFLA 1BKSA 3O63A 4RV8A 1GJPA 3EKLA 3DFPA 3G1SA 1L2UA 3GNDA 4O17A 2B4GA 4JN6A 1O4UA 4P2VA 4UXDA 1TTJA 3EWWA 3ABQA 1TTIA 3M1ZA 1TPWA 3BO9A 3RNDA 3STFA 2HTMA 3AO0A 1H61A 3S1VA 2VFHA 2YXGA 3W2JA 4ZQCA 4YL2A 2QCDA 4R33A 2A21A 2ISWA 1VYPX 4X3ZA 1XUZA 4N02A 3NDOA 4ZQOA 1W3IA 3E49A 3B04A 3W7OA 3MP3A 3L2IA 3KVMA 4UFLA 2WNQA 4NNAA 4HPXA 3HG2A 4S1FA 3OVPA 3W1LA 2ZZ6A 2FFCA 4JTEA 3NO5A 3PBVA 4IMEA 2WQPA 1H63A 3ANYA 5IBXA 2E5BA 2NXHA 3ATZA 4O15A 3S6DA 4U28A 2CLFA 2NX3A 3G1XA 2OT1A 5D33A 3W07A 3HIJA 4KFNA 5CPNA 3UXAA 2CZDA 1TV7A 1DQXA 2FB2A 4HIBA 3G0UA 3GLCA 3LTSA 1IXNA 1JQVA 2HS8A 1VHCA 3HOJA 3F4NA 2OMAA 4PODA 4GUFA 5D03A 1W37A 3WJZA 4GRSA 3QMRA 1F6PA 2WNZA 4UC5A 3MI3A 4JXCA 1RVGA 1P4CA 4JGDA 3DZ1A 3L5AA 2NLIA 1GQNA 2G95A 3TJXA 4MOZA 3W7MA 1FWWA 4C1LA 4FIRA 1T0OA 2C6QA 2EGZA 3RLUA 2CZEA 3BLFA 2JKPA 2PC4A 1GVSA 4K6AA 3DBPA 1TPDA 4BF9A 3M47A 2H8XA 4HKPA 1SUXA 2J27A 1H50A 2XFWA 1A5SA 2X30A 2QUVA 4UMBA 3B0VC 4IXXA 5FF3A 3OEXA 1CI1A 1L6YA 4OQVA 1JUKA 3G1AA 2NV2A 1LLZA 1OF8A 3LHUA 3NR0A 4RR4A 4JDBA 5J5RA 5EY5A 4AH7A 3N73A 3U6WA 2A7RA 3LBCA 3Q2DA 3PM6A 1LORA 2V2CA 3LTYA 3KXQA 2XN0A 3W6YA 1H7WA 1W5NA 1OVDA 4O12A 2CLKA 4IMGA 4E2DA 3LCGA 4JEQA 1VCGA 3IRDA 2XN2A 1AW2A 3QMTA 4IMDA 3N2XA 2V5BA 4LVGA 3TCEA 1WOBA 5HNRA 4NUWA 1FWRA 2BZNA 5AOUA 5HWNA 4O10A 3HPSA 2BWGA 3JRKA 4I9AA 4POCA 1W3NA 2Y7DA 1FWTA 4QIUA 4Y90A 3QPZA 4BWLA 2A0NA 1X7FA 3BG9A 5CPOA 4CNOA 3TROA 1S5WA 2WKJA 3HPZA 2BLEA 3EWXA 2O7SA 1X6UA 1TSIA 1XUUA 4YMZA 3S8HA 3W76A 3L68A 4UFJA 2RDTA 1W1ZA 1MEHA 2V82A 1MSSA 1Z48A 2A6LA 3L0KA 1RQHA 1VS1A 3MO7A 4O1DA 3KRUA 1ZFJA 1RD5A 2FB3A 4FNTA 3MWAA 2ZZ1A 4O54A 2WSRA 2E5CA 3G8RA 4OT7A 1D3HA 1OK6A 1LYXA 3CQ0A 4DPQA 3T7VA 3P82A 5KITA 4OGZA 1TJRA 3TH6A 1QOQA 3GR7A 2ABBA 1H51A 1OFQA 3QEZA 4LW7A 2P10A 1WBJA 3QYQA 3R5EA 2HSAA 1I8JA 2WOQA 4RK8A 4JNMA 5K9CA 3L0NA 1GG1A 4M5PA 4XTIA 3E9AA 1FBAA 2ZRZA 4MLRA 3LV6A 1MO0A 1XBYA 3QFEA 3IVUA 3TMLA 3DFSA 3W72A 3LXCA 3W86A 2X16A 1TPH1 3TFCA 3TAOA 4JIQA 4GFSA 4ORMA 3BG3A 1SZFA 4OHQA 2KZHA 4DF0A 4HN4A 1HO4A 4PL1A 3M5XA 1GZGA 4AF0B 2C15A 2VEPA 2I9EA 3G1YA 3MI2A 1FX6A 2ZA3A 1P5BA 3KRZA 5LNRA 3QZEA 3M7WA 2A85A 5FF2A 2QJIA 1LCOA 2YW4A 1H60A 4RLIA 2J6XA 4GNJA 4Q33A 3S5YA 2OT0A 1PV8A 1SZNA 2PE4A 1GEQA 4K7VA 1K7XA 2DU2A 4FF7A 3A23A 1R2RA 1K3UA 2Y70A 4GUIA 4EOUA 3F1QA 2E6AA 4MY1A 4Z0JA 3DGRA 1KFEA 1LM1A 2Z2UA 2VENA 1DL3A 1H7NA 3I7QA 5AC6A 1VLIA 4WOZA 3N34A 2Y88A 3HGOA 4UTMA 2A2IA 1BEUA 3G3DA 4LVBA 2FIQA 1RPXA 2QCDB 1W3TA 1C8VA 2YR1A 1RQBA 4UMAA 5E1QA 3WK2A 1S5VA 3FLUA 3NL2A 4MY8A 5T26A 2B0MA 1TTQA 2V81A 3FOKA 4K7YA 3W70A 4LT9A 6ALDA 2C16A 1H7PA 3MHUA 3W7GA 2VOMA 5C54A 1MEWA 3NQ2A 3TXZA 1GG0A 2Z1BA 3CHVA 3QW4B 1VH7A 1KFLA 4HT3A 3W85A 5HUOA 4WJEA 1JQXA 1I2RA 1S5TA 1RZMA 1KTNA 3MBFA 3MP4A 3LCXA 4Y96A 1BWKA 3BW2A 8TIMA 2QF7A 2ZZ2A 4FXSA 3IGUA 1ZENA 3PB2A 4WXZA 1MEIA 2NUWA 4PH6A 4UTTC 2A4AA 3HPXA 3NNTA 4O14A 4H3DA 3DHFA 1G67A 3LHYA 3NG3A 6TIMA 1I2QA 1OABA 1OX5A 1SR9A 2ZZ4A 3IGXA 4M6QA 3TC6A 3UPWA 3HG3A 4UMCA 2QR6A 5K4ZA 5LHFA 4MZ1A 1TRIA 2QJHA 3N3MA 1KBIA 1OYAA 4X22A 5L9FA 1W5MA 1TPUA 2Z0IA 4MIMA 5D32A 1X1OA 1NVMA 5HQEA 4CQAA 3BLIA 1TPC1 1DQWA 2QCLA 2GVLA 2H6RA 3EX1A 2RDWA 3C2FA 1ZAHA 1N7KA 1YTKA 1QFEA 3W1RA 3HO8A 3DFTA 4I7VA 3JS3A 2NWRA 4IX2A 5DBUA 2YDAA 4P61A 3UPBA 2B7PA 4UTWA 2R91A 3GXNA 3LXBA 3P7YA 3G0SA 3G1HA 3TU9A 1OK4A 3NZRA 3W7QA 1TPB1 3ABSA 1IIGA 4MYAA 1QWGA 1OG0A 3CIXA 2C0AA 3NQDA 2ZA2A 5LZLA 3EXTA 1M7OA 1TQJA 3A21A 3NQGA 3IIXA 4TO8A 1KM3A 4GUJA 5C5YA 1OFBA 3EXSA 5F4WA 1AK5A 4YCPA 4GXMA 1IGSA 1GYLA 1XBZA 3ZS4A 1DBTA 4FX8A 3LRKA 1YYAA 5DCEA 1OYBA 2V2DA 2D73A 1EUAA 1DKWA 3M43A 3PULA 4FX6M 1QDSA 5HULA 4S2BA 3NQCA 1FCUA 1EWDA 3L67A 4WZHA 3GDKA 1TPFA 3LI1A 4ZZ9A 1EPXA 1A5BA 1UB3A 1ME9A 5DCDA 1KTCA 5HMSA 3T44A 5D30A 3QMSA 4Z0SA 4L4LA 3NAVA 3LHZA 1T96A 3YPIA 2FPYA 1FWNA 2GQAA 1F74A 1I2NA 4RJEA 1NF7A 1DJNA 3GAYA 3M5VA 4GUGA 2W6RA 1L9WA 3FYOA 1KM0A 3NL5A 3L66A 3IIOA 3IIVA 1PE1A 1K8XA 2C3ZA 4OV4A 4K36A 1ME8A 1GWJA 3DENA 1PL9A 5J5DA 3EWYA 3QSRA 3UY8A 1W0MA 3W2NA 4LV9A 3S5NA 4RKAA 4CNPA 5L6UA 1YDNA 1TPVA 1KTBA 4HNVA 3ZWTA 5D09A 1YDVA 2PRLA 2Q8LA 4CQ8A 3C8FA 1SZGA 3N19B 1IXQA 5H2ZA 1SW0A 3C2VA 2DZTA 5LGZA 3QJAA 4O0ZA 1F6KA 3KOFA 2H3BA 1E51A 3NVTA 1EA0A 4EF9A 1UCWA 3LDVA 1JCLA 2LLEA 5HR7A 1IXPA 1JJKA 1WA3A 4O4WA 3HBLA 4K37A 5C2XA 1VGAA 2QEZA 5EL1A 3EEGA 3SGUA 3PY2A 5G2HA 1QMLA 3ABRA 4UTWC 3MUXA 1T8XA 4IPIA 4DBDA 5LHEA 3LOTA 3I65A 1M6JA 3L5LA 1K8YA 3Q58A 4JS3A 4UUIA 1I2OA 4DF1A 3B0PA 2EPHA 3W22A 1O95A 3EX4A 3PC0A 3PWAA 2V2HA 4O1BA 3A22A 3NL3A
chains in the Genus database with same CATH superfamily
3LN3A 2EF9A 4U4MA 3CUJA 2DT1A 2NQ5A 1T7LA 4HMEA 2PF0A 1RA5A 1VZWA 5GNXA 2P3EA 4ROPA 3S42A 2EO7A 3FKKA 3DN5A 4QS5A 2Q3RA 1OB0A 5AHEA 2WP4A 4LUTB 3BPWA 4KEUA 3SY5A 2VKZG 4M6VA 1GKRA 5CPLA 3W6LA 1RCXB 4MNLA 4I5UA 1YIXA 1A80A 4EF8A 2QQ6A 3SUUA 3NPWA 3S4TA 4RZBA 4BZYA 4DUWA 3GDTA 4MAZA 3R2GA 4A21A 3U2CA 4YVVA 4F40A 2GOUA 3ORWA 2UY3A 1S5MA 2WCSA 4RNFA 2WZTA 4JX5A 2PGWA 1TRDA 3VKJA 1GVFA 3MCOA 3FK4A 1X6LA 3NXLA 2OSYA 3FYPA 2VEMA 3N2TA 3TMQA 3IEBA 2HCVA 4DVOA 4AIUA 5B7ZA 1JYNA 1I1XA 4MWAA 3TV8A 4XO7A 4QEEA 2Y7EA 1JD9A 3L7RA 2DSJA 4MTVA 1AH4A 2F2KA 2ZX7A 1S2AA 5A6BD 2ON3A 4MWAD 3FHQA 1BXCA 1Z9AA 3LCLA 3TTOA 3BOFA 3VOJA 4RDVA 4R7OA 2OX1A 4LB4A 5F4XA 1DXIA 3U48A 4LCQA 4UQAA 1FTXA 2ZRYA 4GPNA 2TRSA 3O7UA 2J79A 3KHJA 4US6A 6REQA 5C8BB 1PDYA 4QHRA 3AYVA 4BR1A 1CGWA 1RCQA 4ILSA 1DWAM 1OWQA 3AICA 4XD3A 1QHPA 2W63A 4D72A 3UGVA 4D71A 5K9XA 2WLZA 4W4QA 5JVHJ 1PTAA 4UFKA 3NQ7A 2DH2A 4H2HA 2Y63A 4EIVA 4QJ4B 2A7NA 2YB1A 3R8HA 5FJIA 3R6IA 4GINA 2GDQA 3NQAA 4WRHA 2P1FA 1YJ9H 1A5NC 3SI9A 1F3XA 2Q09A 1TE6A 2E8YA 4KFOA 3MS8A 1UW9A 3L21A 4PSPA 3M6DA 3O06A 4NL1A 1V0LA 3WLQA 4D6CA 2OFJA 3WLHA 5D8ZA 1M9HA 3W2MA 3OU8A 3SFKA 4E0CA 1FWGC 2IKIA 4DI9A 1QHOA 3DEQA 4JX4A 3WEZA 1FFQA 4JYFA 1FA2A 1V6VA 3TSBA 3U2OA 4IQLA 3WLJA 1RLCL 2PGEA 4IPPA 2GJLA 4CU7A 1B9ZA 1JR1A 1F76A 4BA0A 2X05A 1Y65A 1SFJA 3E2VA 3UERA 1PCKA 2YCEA 4MHBA 3VI2A 2INFA 3TN3A 1E3XA 1E0WA 3P8JA 4JYDA 3ITXA 3RGTA 4O16A 4BQ2A 5EMUA 4ICNA 1M68A 2GJRA 3F4WA 1XI3A 3N2MA 1WOAA 2EPOA 1BVWA 2V6AA 5EP8A 3ZMRA 2OYKA 2H9AA 4Q4SA 2RH9A 2HBXA 4ACZA 3AIVA 3OVQA 4KIRA 4LS2A 1BRLB 1NFBA 2D1ZA 5DBTA 4KRUA 3REQB 1PZ3A 1IEWA 4JTAA 4LU0A 1KRBC 4LF2A 5GJNA 3HB9A 1Q8JA 1X8FA 3N17A 3ZQ9A 3SGGA 3DXIA 2PDXA 1L6SA 1KXTA 4O19A 3VDAA 3MJMA 1UKPA 4HPGA 3C52A 3PBUA 3CCRH 2IXVA 4XWUA 4US8A 4XTDA 3C2EA 1VQKH 3WH9A 1GYMA 1EZ2A 3E2RA 4S3FA 4FOJA 3UJSA 3GTHA 3PJUA 4C5YA 2DIKA 4N42A 1IT0A 4HU3A 2OGJA 5FESA 4X9SA 3WSUA 3F2BA 4QBXA 4JTKA 4A3HA 4GOAA 2XJ7A 1MI3A 1R3RA 1OFPA 2PDUA 4O57A 3FJ6A 3ITGA 2AL2A 4IOTA 3A3HA 5BZAA 3VFCA 1ZB5A 1J8VA 3WL1A 4I7WA 4LNYA 1N62B 3W3OA 4JYEA 3HJZA 2MNRA 4IJBA 4UTLA 1WQ5A 2VX4A 3BARA 4ZQRA 1IWBA 4GA8A 5DMMA 4GA5A 2IKJA 4YS1A 1LT8A 4QNWA 3VGHA 4LS1A 3MCMA 3AAMA 2VDGA 4IPJA 5GQBA 3U8GA 2ZZ3A 1W5QA 1PKYA 3VOFA 1QK2A 5IRPA 3I7SA 1EA9C 1Z44A 4LC8A 4NZJA 2VC5A 2CBIA 1Q3NA 1E0VA 4UFIA 4N9EA 4BI7A 1S38A 1JJ2H 4LEFA 5I00A 3L23A 4GBUA 4DBEA 5CPTA 3LRLA 3ETRC 1GTEA 3TQKA 3GC5A 3HG4A 3RG6A 3TA6A 4LPCA 2JBMA 3V1HA 2J9YA 2QF8A 4GKTA 1MRAA 4IH3A 3VD4A 4BK9A 3TTEA 3U7VA 1SO4A 4NAFB 2VT0A 1S46A 4M3PA 1W56A 3QRHA 3EWBX 3CZ8A 4AD2A 1UJQA 1ECEA 5M1TA 2ZUWA 2AOSA 4JR5A 2D23A 3MWCA 3TE9A 4BQ5A 4K8GA 1Q6QA 4PR4A 4CD8A 4N9CA 2VCBA 1X96A 3M44A 4JTUA 1HZYA 4UCGA 3WLPA 3OVGA 1PS9A 3E02A 5F1VA 1A3XA 1QNSA 4ZQPA 3UNTA 2CHOA 1A5CA 2MUCA 2ZICA 1QI3A 2WVVA 3AMLA 1FWIC 1B4KA 5DRIA 3CWOX 2EJAA 2OTJH 4Q8VA 3TR9A 4EWJA 1FWDC 1H7RA 2V8ZA 4L80A 2OJPA 3FVDA 4OV9A 4WIWA 5IFPA 1UWQA 3OW1A 3QHOA 4CN4A 3BLPX 3SCQA 2ODOA 3DC8A 4J35A 3PR2A 3NVWC 2VVNA 4IFOA 2DV0A 3ARRA 5EMJA 1RY8A 4UTFA 3VZZA 2INEA 1LRTA 3BVJA 3OYXA 5A5WA 1FWJC 3M07A 4WJ8A 5BCAA 4GWEA 4O0KA 4OBSA 4MJ4A 4OE7A 3ELFA 1E6NA 1B3YA 3W84A 4US5A 5D2VA 3AIRA 4IWWA 4U67J 4XKYB 1YNPA 4JIRA 1QNRA 2FJKA 3QY6A 3EKZA 4N9DA 3N4FA 3A5VA 3NYDA 5IFTA 3S47A 4MJMA 1YTEA 1GVRA 4US5D 3OIHA 4LC6A 5EB8A 4O1FA 1UD8A 2WHKA 1ZQ5A 4LRTA 4Z1BA 4JL1A 1LOQA 3Q65A 1DVJA 3WQGA 5DEZA 2CXEA 1PX8A 2YL5A 1KXVA 1EKOA 3XISA 4BS0A 2E1WA 3OW2H 1H62A 4LUYA 3W83A 3ALGA 3B8TA 1YLVA 2Z7GA 3NOYA 4ZMGA 2PRHA 3CTLA 2DZUA 2G0WA 2HK1A 1SVDA 1P43A 2VC9A 3GNRA 1JULA 4W5UA 3V0TA 2J7HA 4NXSA 3O1NA 1V6WA 3LXAA 3MKKA 1LRNA 4DM1A 1LBMA 3W1XA 3C2RA 2VGGA 4NZ1A 2FH6A 1CXLA 1JCJA 4DUVA 3DI0A 3KTCA 3OJGA 2E67A 3NYZA 4ONVA 3UQNA 2Y0FA 1EB3A 2DT0A 1M7PA 4C1NB 4FEZA 3FYYA 1MRQA 4XIMA 1ZS2A 1VR6A 2KAUC 1EIXA 4RZ5A 3AMCA 5I09A 4HOXA 1AL8A 2QPSA 4NQ1A 2E6YA 4X61A 4JY8A 2QDDA 1SJCA 2HS6A 4QE1A 2D3LA 4A2SA 2QCFA 5EMLA 3GIPA 1WNOA 1E4IA 2ATMA 2AKMA 3CCEH 1LQ2A 1GOMA 3WQ4A 1R3QA 5D38A 1OY0A 1UWUA 4ZQNA 3R94A 3KBWA 1FOBA 1P0BA 3OTRA 3QH2A 4MFDA 5JH1A 1XINA 1TV5A 2ZWZA 5C9RA 1KD0A 3VIJA 3A4WA 3VNIA 3QW3A 3FFSA 5DCBA 1UQYA 3CAWA 3KL5A 5AYYA 3BCDA 1XGDA 3HPFA 7ENLA 4DEFA 5FI8A 3H4GA 5HUPA 3H2EA 2VFFA 4Q32A 2IQ0A 5C9WA 4LHMA 3THAA 1TV3A 3QC0A 1XH2A 2C7FA 1V3LA 1Z32X 3DERA 1I45A 4IP7A 5G4EA 3P14A 3ABXA 1AJ2A 4B3KA 1JXJA 1NFGA 3GX9A 3H2CA 1B3WA 2V5LA 4DBWA 4EE9A 3DYMA 2POZA 3ID7A 4MJ2A 3IV3A 2Y2WA 1EJSC 1RH9A 1LT7A 3TJLA 2ZC1A 2ZRXA 4YYFA 4H6QA 4O11A 4TTUA 1RV8A 3N04A 2QPXA 5T91A 4CKQA 4AZHA 1YITH 1G7VA 3GH4A 1PKNA 4JD4A 3LCFA 4IZGA 3P84A 1ZAJA 2HMCA 4DXVA 2JFEX 3GTXA 4FB7A 4AVOA 3VIKA 1GOXA 1B3XA 5C6MA 4GA6A 4C6FA 1M90J 4Z2HA 3W53A 4KESA 3L65A 2QDHA 1A0CA 4PUMA 2XVNA 3BW4A 2HXUA 4ES4A 2NVAA 1KCKA 1ZP3A 3ICJA 4V2XA 3SW6A 1F7BA 1ME7A 2ZA1A 3P60A 2ZC8A 1VAHA 4YNGA 3GDRA 2G96A 1S3HA 3K8MA 4QCEA 5CPQA 3RM8A 3ZT6A 1VCFA 4UZUA 3LRMA 3ENLA 3FHAA 5CH9A 2RGLA 2YSWA 3KP0A 1KBJA 4I90A 3GQYA 5FAJA 2Z1SA 3F2CA 4CCCA 1TB3A 1R46A 3DBNA 5DQPA 3T2PA 4HHHA 1W9XA 3G1RA 3DFOA 1ADDA 4AAJA 3W4RA 5E9XA 1QW9A 5GAEN 1JRPB 3P74A 1BGGA 1VPYA 3QF0A 4FXRA 1E6RA 1OBAA 4PC8A 3WJYA 4LAOA 3M7SA 4FNUA 1OFRA 1TIMA 3T2OA 1GOKA 3EPNA 2HXTA 3LERA 4R34A 3F4CA 3PZMA 1YTDA 1KM2A 2OO0A 4GG9A 1NQ6A 3FAWA 3U5UA 4JCMA 1WX0A 4NX5A 3KOYA 3IVSA 3LHTA 1PB0A 3W75A 3TAKA 1OX6A 1E1EA 1S2WA 2EHHA 4Q4RA 1E0TA 2VXNA 1W1YA 4BY3A 2CYGA 3CL7A 3ARUA 3NIYA 4IIDA 1JNEA 3KDNA 2YL6A 4O52A 5G4HC 4KPLA 2WNWA 4FA3A 4NZCA 1WYIA 2D2GA 3SADA 2WHMA 3BSGA 2PP0A 2NX9A 4IIFA 4DZAA 3NSMA 4CUCA 4DHGA 3OZPA 1H7XA 3ZOAA 3VCRA 3N18A 3AHZA 1E5NA 4UNLA 1DIKA 2ACQA 3BMWA 5EFDA 2PDQA 4HNTA 4ZO8A 1KFJA 2DH3A 1DJIA 1O60A 2P8BA 3T55A 1Z6KA 3HGJA 5G2IA 5I3GA 1UP2A 4GGBA 1KW1A 3AIEA 1JCYA 1SPQA 3Q67A 2PF8A 3FN9A 7CGTA 3UXDA 1LUCB 4DYEA 1QNVA 1RVKA 3VGEA 5I7GA 1SZRA 4KWVA 2V5DA 3L5MA 4FIQA 5GVJA 3E96A 5TIMA 4V28A 3RCYA 2P76A 1XLCA 3GO2A 4PMUA 5CBBA 5BXPA 4FI4A 2FH8A 3VKKA 2X1TA 3CCJH 1V97A 3JR2A 4E2OA 2WWCA 3W1MA 3RAOA 1Q6CA 2F84A 2RDUA 3AYTA 4UNIA 4UOQA 1AA1B 2NUYA 2BY1A 5M2FX 3FX4A 4LJ3A 2W3RB 5HINA 3FEMA 4GQRA 1UYQA 1R6WA 4J1OA 3GG8A 1FP8A 4DXKA 2GDUA 7TIMA 3PUDA 3H22A 4ZO6A 5BMWA 1DEDA 5CG0A 2BP1A 1ZL1A 3DI1A 4F2TA 3M0XA 2VGFA 1VYRA 4XBSA 1Q2RA 2QZRA 1M01A 1K77A 1R9XA 3ARYA 3CHFA 4MM1A 3C61A 2OSXA 5A94A 4LAMA 3URBA 3EA2A 5DLCA 4KIEA 4UNKA 3K13A 4J4KA 4O8AA 3W73A 3CXCH 3PTKA 1J2BA 1Q4NX 3FS2A 4D8AA 4GBDA 1K7EA 1JPIA 2ZX6A 4DQWA 1B1YA 1ZSXA 1CXFA 1E4NA 3NPUA 4C7GA 1RK5A 4WR3A 2J66A 1W54A 3CPRA 1SYTA 2I56A 2QEXH 1H1ZA 3T4WA 4FR6A 4NVTA 3JZUA 2DIEA 3OVRA 4GX8A 1F2JA 3TP4A 5I77A 1OF6A 4XIAA 1ZALA 2VQTA 4I7UA 4Q3MA 3NM1A 3W00A 3TN4A 3H7UA 5M3WA 3VM7A 4HD5A 5A6LA 2QCEA 4CN6A 1BLIA 1DHPA 3W6MA 4GCAA 1YDOA 1W1PA 2QT3A 3TOPA 3UWWA 3KFTA 2ZRUA 1O5RA 2W67A 3AYRA 3JZEA 1EGZA 3DYPA 3QV7A 1U1HA 1H5VA 2GOKA 3QR3A 3FV9A 2JGYA 1DJHA 3M0MA 4JICA 1WKFA 4JKLA 1XH1A 3CLWA 8RUCA 3B9EA 4QJ1A 1VF8A 3JVAA 2YL9A 3S5OA 1HJVA 4B92A 4GYKA 3EMQA 2WMGA 3BXWA 1KKRA 2ZUSA 3MV11 2PWEA 3KHDA 3U9IA 4NKCA 3DFQA 4B9ZA 1UHVA 4W9TA 4XD4A 1YXDA 1E6QM 1C8YA 4HJFA 4F0KA 3NQBA 4C6DA 2DJLA 3QYSA 4YU1A 2NV1A 4ZO9A 3LLFA 5FSDC 4O0QA 2Z28A 5FL0A 1KM6A 3DAQA 3VKCA 1REQA 3E6EA 4HOWA 1GJUA 1QI2A 3UF9A 1S2UA 2F38A 1TMHA 3ZR4A 4QM1A 3APGA 1VFLA 1BXBA 3B4UA 1C8XA 3S0CA 5D2TA 2OLSA 4NAEB 3TWAA 3EXRA 4MGGA 4W5ZA 1VPXA 2FVMA 4TMBA 1T99A 4IUGA 1ONWA 5IDIA 4O1CA 3GIQA 1DORA 2Y6ZA 1W3KA 2XM2A 3DFPA 2VDIA 3GNDA 3IJ8A 2C0HA 4O17A 3ITOA 4P2VA 4AD0A 1SFTA 2NSXA 1GQKA 4Q6JA 3BO9A 2PTXA 4JQAA 2WW5A 3RNDA 4NZ3A 1JD7A 1N2VA 4K3ZA 1H49A 5JIPA 4IOCJ 1PTDA 4N02A 3KP1A 3NDOA 3MT1A 1VQ5H 4F79A 4UFLA 3IJ7A 3WD4A 3T0AA 4NNAA 2DY3A 3W1LA 4MDOA 3SSZA 2JF6A 3WBWA 2B31A 2FFCA 2WQPA 1H63A 4ZTYA 3QZ6A 3RRXA 2NQ9A 2DVUA 2W3SB 3MUY1 1RUSA 1XIDA 5MKGB 2NX3A 3G1XA 4HA0A 1HGWA 2HE5A 3IK2A 4KFNA 2V69A 3UXAA 2HNEA 2CZDA 4DJFA 1CGVA 1DQXA 1TV7A 1GQJA 3GLCA 3LTSA 3TQPA 1JQVA 4W8BA 2HS8A 4KETA 2CBJA 4XB3A 2ZIDA 3BQ5A 4E8CA 1CXKA 5D03A 4B15A 3WJZA 3AM9A 4GRSA 2VM8A 2PDHA 2WNZA 1XIMA 3GG1A 4UC5A 1E56A 2P8CA 4JXCA 4A3YA 1JI1A 1GQNA 3ZT5A 1YE4A 2GLKA 1FWWA 3F7JA 2F8QA 1JAKA 2FGZA 3BLFA 3PZIA 4Z2JA 1TPDA 3SDOA 3PFMA 4BF9A 4K1GA 1SUXA 1BD0A 1EGMA 1YHTA 2REQA 1H50A 2XFWA 2XU2A 4PMRA 1DJZA 1J6PA 3ZR6A 1ZUAX 3D3FA 5D9MA 3WBAA 3BJFA 2QHAA 2DUAA 4QE4A 1HVQA 1OINA 1L6YA 3G1AA 1FM0E 5EY5A 1EJVC 4XAZA 3MO4A 4GI6A 3LBCA 4CU8A 4PZVA 3STPA 4YIWA 3LTYA 2XN0A 3W6YA 1H7WA 2J78A 3GXFA 2WZEA 4GK8A 1TMQA 4PN2A 1MW2A 2OTDA 2V5BA 1WOBA 3UYIA 1CB2A 1FWRA 3S2NA 5CC5A 3MVTA 3HPSA 4Y7EA 3JRKA 4I9AA 4POCA 5IHRA 2GJPA 3WQPA 2A0NA 3PZQA 1HN1A 2WKJA 4X9YA 1RM6A 3G4SH 1XCXA 1XUUA 4IT1A 4LEQA 3L68A 3NWRA 4C7ZA 3QXBA 4W7UA 4YTUA 1UQZA 1MSSA 1RQHA 1W2VA 4DNHA 3VIIA 4QTGA 4C6BA 4WLCA 4YJ5A 3S5SA 2ZZ1A 3G8RA 4Y9PA 5G1MA 1Q13A 5CC3A 4GD0A 4OGZA 4S3GA 3TH6A 1H51A 2XVLA 3IUIA 3VTRA 1TIWA 2WC3A 4GZJA 1UR8A 4H00A 1L2QA 3GXMA 1XWYA 3WLLA 2P0IA 1OIFA 3WF0A 2PCEA 3L0NA 2G4JA 1H41A 4M5PA 4ZEPA 1MQPA 3E9AA 3BAIA 4MLRA 8XIMA 2XSBA 7A3HA 1XBYA 3GXIA 1JEZA 2VR2A 3TFCA 5CZKA 3ARQA 4INFA 1XC6A 4P7OA 4F8XA 1QOXA 4HN4A 5FAGA 1MUCA 1DYSA 4PL1A 1ZXIB 2CETA 3C5QA 4AF0B 3T05A 2I9EA 1VFSA 1E9LA 3U7BA 5FF2A 1JGMA 3EA1A 4ATDA 6A3HA 3OHMB 2J6XA 2XGZA 4W7VA 2VI0A 4Q33A 4AZ6A 1AUSL 2IW0A 2FTWA 2OQYA 1PV8A 1SZNA 4ZB0A 5DO8A 4FAMA 4LUTA 3BCJA 1ZBKA 3VZYA 1SIJA 3DGRA 4E8DA 2VENA 1DL3A 1H7NA 3I7QA 4EACA 1VLIA 3N34A 1SJBA 3WBEA 3HGOA 2PWDA 1NVJA 3ABZA 1UR9A 3PBMA 1M04A 3N6QA 2D2JA 2W92A 4AVNA 2PDPA 2EKGA 1C8VA 3UR5A 4C6PA 3UT0A 1RQBA 4GKLA 3WQDA 3R0DA 4IF2A 2B0MA 3A47A 3FOKA 4K7YA 4TVDA 3W70A 3UPMA 1J0ZA 3W7GA 2FVKA 1O7AA 3VDBA 1VH7A 3W85A 1LWJA 1JQXA 1I2RA 4MAVA 1UWSA 1VQNH 3KOZA 4EPKA 5I2UA 2Z4GA 3MP4A 1F61A 1BWKA 4ZOHA 3WQOA 4FXSA 2QNEA 2C91A 1PPIA 1ZENA 1MEIA 3QV6A 4J3TA 5KETA 4N0RA 2P50A 1MQRA 4H3DA 5DM7J 3ITTA 2WJDA 1I2QA 3UGRA 4L4OA 4R85A 4XZLX 4AD4A 1SR9A 3IGXA 3GHTA 2QR6A 1SB3A 2Z1WA 1WKEA 5FSEC 1J5SA 1OYAA 3VIGA 4X22A 3NURA 1VFMA 2PTZA 3WLMA 3W01A 2GWGA 3GBEA 1TPUA 2XSXA 4JFWA 3BLIA 4ZFMA 2A3CA 3CIVA 3EX1A 3PZ9A 1YTKA 1BQGA 3AI0A 2CWXA 3DFTA 1WXZA 4IX2A 2PDYA 1KWGA 1EFZA 3GVWA 4UTWA 4MUPA 4F0RA 3WMSA 3G1HA 3WQCA 3TU9A 3CPGA 1NVIE 3H4XA 3HQPA 3W7QA 4EXBA 1TPB1 1XISA 3R8GA 1IIGA 1PZ2A 1WUEA 3UVIA 1OG0A 3NQDA 5A2AA 4WEVX 1RK6A 3EXTA 4KMQA 3M0JA 1CB7B 1TQJA 1XIIA 3A21A 1V6XA 4XAFA 1J10A 1DP0A 5C5YA 1RBOB 4YCPA 1K8CA 3URNA 3WEMA 2ZADA 1TV2A 1DBTA 2WMIB 1CGTA 3O0FA 4NRRA 3NQCA 3TYBA 1TPFA 4PUDA 3RX4A 3LI1A 1NY1A 4DB7A 1ME9A 4DWSC 1MXDA 1KTCA 4Z0SA 3BV7A 5HMEA 3NAVA 1T96A 3L4YA 1FWNA 1T41A 3MSRA 2NQZA 4CN1A 4BKNA 1HJWA 1NF7A 4IM4A 1L9WA 3THDA 3KWSA 1KM0A 3NL5A 3L66A 3WBXA 1PE1A 4GISA 5C7VA 4ZE4A 3SBFA 1R85A 1ME8A 1GWJA 4JTRA 3EPOA 4A05A 2PTWA 5J5DA 1W2BH 2YDRA 2QJNA 4L1GA 1AZ1A 2WANA 2O0TA 2GQ3A 1V02A 5GADN 1BRLA 3CH9A 4AFYA 2XH4A 3REQA 3AS2A 1ZRQA 3C8FA 3HTWA 1SZGA 1IXQA 1SW0A 1VQ7H 1A5OC 1TR1A 4O0ZA 4IGSA 3KOFA 4EF9A 3KM8A 3EKGA 4P5UA 5E0FA 4EXAA 1IXPA 1WA3A 2Y5EA 4O4WA 4PTVA 3HBLA 5C2XA 5LIWX 1JPKA 4KW2A 1OT2A 3EEGA 4JN8A 3PY2A 3R4IA 3HFTA 1IV8A 2YXXA 1M6JA 1YI2H 3MB9A 8XIAA 1I2OA 4R88A 4ZSUA 3WD3A 3EX4A 4D6HA 1QNPA 1U1JA 5DMLA 5CGMA 2GPTA 4V1XA 1CYGA 3W82A 1MDLA 1QVGH 3UJEA 3OLGA 2D69A 1TWWA 1YADA 3PPFA 5BW6A 3URAA 5EFFA 2CKRA 3SCNA 2ZCGA 4DYJA 4JTIA 3LUTA 4OJYA 1NJJA 2Q71A 2YYTA 5C0QA 4LBSA 3MC5A 4EK7A 2TPSA 3RPFA 1NFPA 2GFTA 5JBFA 1UPMB 4AVFA 3CU2A 4WFNJ 4IG2B 3CWHA 3LV5A 1QNQA 3WMLA 1KFCA 4UTJA 2XISA 3CCVH 2VUNA 2PU1A 3MUZ1 1HW6A 1PKLA 9RUBA 5E9AA 2RDXA 1TCDA 1TJ0A 1WZMA 1SJAA 4LVDA 5DY3A 2RAGA 4L65A 3ONBA 1VYSX 4H1ZA 4S39A 2F6KA 3NFUA 1DE6A 4K8EA 5SWUA 3T2QA 4QP0A 3STCA 4R7JA 1TA3B 5CZSA 2ATSA 3W1QA 4NAFA 1DTUA 3ZLGA 1J11A 1CGYA 1VJIA 1A4MA 1D8WA 4KRZA 3K30A 3LNPA 4AD1A 4G5DA 2C18A 3AJ7A 3G1FA 2TYSA 5JVLA 4H9ZA 3W37A 4HHMA 4JN7A 2Y4SA 4MFEA 3S1WA 4EXQA 2ZUVA 1JYWA 2ASHA 5BU6A 1UBSA 3GIYA 2J9XA 1VFUA 3KL0A 4HA3A 3DG6A 4LY8A 3CD6H 2E4TA 3LM7A 2P88A 3V0SA 2B7QA 2G97A 1V8EA 4HQVA 4IISA 5AC7A 5EA9A 1XQLA 2VX7A 4N6FA 3PVFA 1RR2A 2CESA 1FH7A 4WK9A 4Q4QA 4DPPA 4Q8NA 3GXTA 1PZ0A 3MSGA 2FZNA 5ABEA 1KM1A 2R9RA 2PS2A 3G8EA 2OKOA 3VC5A 1H3GA 4AXKA 5T9CE 1BHGA 4CNSA 4H19A 3LG3A 3FDKA 1HKKA 3F03K 1SR0A 1S39A 3OQ8A 1PEZA 4QNEA 1POJA 4NRSA 4MYXA 5CC6A 2OOFA 4HSNA 4JTTA 3BTNA 4JHMA 3DX5A 4ZO7A 1GT8A 3TLLA 3DKLA 4XKYA 5CZJA 2DSZA 3IV8A 1J6OA 4LVAA 1JZ6A 2E6FA 2D22A 3VOHA 3U2ZA 3WQWA 4EWND 4M29A 3CPWH 5BWFA 1U83A 5I06A 2DIJA 4UOZA 3K4DA 1QAPA 4HSHA 4UTIA 4A2RA 3N12A 1WKIA 4WQ6A 4MSSA 3CUFA 1YX1A 5H91A 1E9IA 2UY4A 2PDFA 3SCTA 1BYAA 4I5RA 3QM3A 5A6KA 3G18A 4MWAC 1AZYA 1VIWA 2GWNA 3P81A 3TZNA 4ZTXA 1CW2A 1PCWA 1A5KC 1W5PA 1JZ8A 4IIHA 2OZ0A 1UH4A 2FHFA 2GSEA 3O05A 2QIEA 1R3SA 7TAAA 1QW8A 3P6LA 3JUGA 4NX0A 1I9CB 3NO3A 2QCCA 3W24A 3CT7A 4ZOBA 3W7NA 3KDOA 3CC7H 3UWUA 1M53A 3SB0A 4HNCA 4C1NA 2DGAA 4P8XA 1W1A1 5FACA 2V30A 3LQGA 1BF2A 4KKXA 2BHYA 1ICPA 1MUWA 5E5CA 2BNJA 2FTPA 1OHLA 3GNOA 2NUXA 1HL8A 2J7GA 5IXEA 3AC0A 4NIRA 4AEEA 1C9WA 1JCNA 1TVLA 3HN3A 2J47A 3VD7A 3TNOA 3EZ4A 3K1DA 4WOQA 3EDKA 1P0DA 4RXFA 2G50A 3STGA 1OFAA 2CWNA 4ZGYA 2IQTA 3FNDA 2J8TA 1B9BA 5BMXA 2XINA 5DELA 3NEVA 3VNKA 1X98A 3CB8A 5K3VA 2X40A 5AVHA 5CC7A 2FPTA 3PAJA 4XD6A 1B0IA 2Z00A 2CKSA 5DT5A 5F2GA 2R6OA 1XRVA 2WK5A 1FDJA 2NVDA 3WFAA 3N1AA 1W31A 3E12A 5FKYA 3HMCA 1HKIA 1JUEA 3ZZ1A 2DP3A 4O1EA 2X1IA 2QIIA 4DRSA 2QVNA 5AFDA 3LMZA 1KFBA 5AHMA 1J18A 4TX9A 2PI6A 1C90A 4LS0A 2HPIA 3SY1A 3TOYA 3GC4A 4NXKA 1P1MA 5A3HA 4GUHA 2VJXA 2UY2A 1ESWA 1PUDA 3LB0A 2Z6JA 1THFD 1RP9A 2EAWA 4XVDA 4FX7A 4DAIA 1XLMA 4H9XA 2INZA 1UH3A 4U3AA 1EC8A 2NWSA 1KB3A 3UNDA 1UKOA 1MNZA 2PZ0A 3QQWA 1IT7A 3VE9A 4KH2A 3FVMA 3CUIA 2G5WA 4NZ5A 2X0HA 2HISA 4GO8A 4US9A 3BLDA 1EX1A 4PTMA 2GVYA 4GQQA 2GVJA 3S3GA 3ITYA 2QULA 4RDZA 3PF3A 3RPTA 1HTIA 2Z7KA 1XLKA 2PWFA 4O13A 3OZMA 3DHDA 4MKSA 1W2PA 4XBKA 4XO6A 4B4HA 2X1UA 4DO4A 2ACRA 4GI9A 1TWSA 2Y85A 1XX1A 2XIBA 3Q4DA 2OWWA 1K9FA 4B5NA 3ONCA 3QR1A 4QAIA 2PAJA 3QHMA 4QQUA 5LNVA 2QAPA 1EJWC 5GJPA 4S2CA 5KZDA 3V7PA 3GKFA 3W25A 1DQUA 5HJYA 4J28A 2XH0A 3RK8A 4DJEA 2V68A 3DUGA 4XX6A 4ML9A 3K4WA 1MNSA 3LSCA 4D2JA 4XAPA 3CMJA 1S1RA 3VOIA 4B16A 1FCBA 1YXYA 1TMLA 4B5XA 2XH7A 4MNMA 5CJ5A 5EGRA 2G3IA 1ZBCA 3F4VA 2VRJA 3CUZA 1ZY9A 1UWTA 1IGWA 2JALA 2DZXA 1N63B 4FNPA 3FGCB 1YHQH 5AKQA 2XG9A 3WH8A 3LI0A 3M9YA 4GHRA 2VELA 2WWDA 4Y8EA 1WYGA 5I79A 2G3NA 1LQ0A 4IICA 3EX2A 2J9ZA 5ABTA 4LB3A 4XZBA 3KL3A 3AOFA 3H2AA 4IUOA 1GONA 3H2NA 5EMMA 1XXXA 5D04C 4MPQA 2HBVA 2A79A 3WO1A 3B8DA 2R8WA 1WE5A 2E0PA 1O66A 3PBYA 2PGRA 3GFZA 3UJRA 3PANA 1QO5A 3U0HA 1MVYA 4EADA 4BI6A 1J0IA 4EPDC 5AHFA 2V3DA 3ITVA 3FJLA 4MB1A 2YZ5A 3IRSA 4GGHA 7PTDA 1TJ1A 4JHOA 3TCSA 4JTLA 4YPJA 3LBMA 3B0YA 2BTMA 1TWIA 1TKKA 1QBBA 5G1TA 5LGXA 1Y5VA 2C1GA 2QUUA 3WDJA 3U5YA 1B90A 2R1NA 4QLKA 4TIMA 5I03A 1LUCA 3C0QA 2HQAA 1UR3M 1R7OA 4PRWA 1J12A 4GA4A 3BSHA 3PUEA 3RPDA 2VEIA 4AYSA 4GNKB 2BXVA 2OWCA 3CL6A 2Q3OA 3ZJ6A 1A49A 4ECLA 3VC6A 3VK5A 4HMDA 5LNSA 3TNBA 3DOPA 3I7RA 1UP3A 2RKXA 4NASA 4ADUA 2E28A 2C13A 3P8IA 3CCQH 3SRKA 1R30A 9XIAA 1J01A 1A53A 2XFYA 3T0DA 1PAMA 3TR2A 2Z6IA 4TTGA 3BLOA 3CUXA 2J24A 3FIGA 5I07A 4PEEA 3C56A 4CNTA 1WDWA 4XAYA 1VFFA 4Y9MA 3C6CA 1XS2A 1CNVA 1KM4A 3TYZA 4HNNA 3LD5A 2CNCA 4JTJA 3W71A 3G0XA 4JFVA 2ZJPJ 2GSJA 3OBEA 2FMNA 1K1DA 4DBUA 4RW5A 3KBSA 4HHPA 1OCBA 1G5AA 1EUNA 4KWWA 1PVNA 4IFKB 1EF2A 1O6IA 1YBQB 3IAQA 1BTMA 1XG4A 4V27A 1ICQA 3OGSA 4PTXA 5CG7A 1AH3A 2QCGA 3WUBA 3MMUA 3ZJ7A 4JY9A 2TODA 3W1UA 5I24A 3K4AA 2B7OA 1C7SA 3LS9A 4J3ZA 4QRNA 1NEYA 3V4BA 1TVPA 3R25A 3GTNA 2ZRVA 4O18A 2VZTA 1JYVA 5I3HA 4DLFA 3FCPA 3N25A 1FCQA 4PMOA 1XIEA 1GQLA 4PUEA 3PZTA 3P61A 1HGYA 3LYEA 1XIGA 3EYPA 3P5YA 4FALA 4WD0A 3G22A 1SFSA 2CLLA 3QZAA 5GPRA 2PDLA 3ALFA 1GPFA 2PLKA 3AMDA 1VQPH 4WDTA 2BVTA 2WSYA 3S2CA 3DU0A 1FVPA 4B2DA 4X0NA 4QS6A 1XR2A 3MZNA 1JDFA 2BDQA 4GZ7A 4L6DA 1ALDA 4OWGA 3W88A 2WNNA 4PMXA 4N7QA 2I5IA 3NM3A 2PDJA 3W9ZA 3AHTA 5G1YA 2AAMA 4ORIA 2YX0A 2ZOXA 4CQ9A 1TTPA 1XLFA 4E8GA 1UD4A 4DJDA 2WM1A 1V0NA 1NAL1 1GVQA 3DESA 4G6CA 1UR0A 3ARXA 3LX9A 4RNJA 5A6MA 2OZ8A 2VZUA 4BF5A 3GYEA 5HPOA 3WF1A 3USBA 1L6WA 3TK7A 3CZKA 3SM0A 4JTSA 1NU5A 3XINA 1K9MJ 4IIBA 1JCXA 4RV3A 1POKA 1EXBA 1TWZA 3M5YA 1Z41A 1Q6RA 4DXXA 4NAEA 1Q2SA 4DAFA 1EX5A 5DXXA 1XC4A 3H54A 4H6EA 4S38A 3H8AA 3T1GA 1SGJA 3WQVA 1GOOA 3W1PA 4FR1A 1N8IA 2ABAA 2ZX8A 3NQMA 4P7LA 1N61B 5HJLA 1A50A 5CGTA 2OWXA 2VEFA 1V3JA 5I3JA 2J8GA 2VWTA 3QN3A 2DT2A 4Z2IA 4H8VA 4F0HA 1H5YA 5HATA 4BFAA 2ZDSA 5LNUA 3KBJA 4IJCA 4PEKA 1HL2A 4IX0A 4ZQMA 1HJSA 5I3FA 3W7KA 3U57A 1PHQA 3H55A 2FTYA 3WNZA 4ALDA 2VEKA 1FHDA 4TVUA 2QXWA 2Q02A 3T81A 1DOSA 1OGGA 4BF7A 5KZMA 3PZVA 3P67A 4MZYA 4WCEJ 4PMNA 3RCNA 2D0HA 1LL7A 3RU6A 1NWUA 2IUZA 3WNPA 5F2IA 3VKDA 1W6TA 2CCRA 4V33A 1HKJA 5MKGA 5CCZA 4GI4A 5CKSA 3CGTA 3GDMA 4A3RA 3G77A 1OD8A 4HU0A 3HF3A 3WDPP 2DFAA 3CMAH 2WJZA 1MFUA 2ZX9A 3WLIA 5C9ZA 1RPKA 3GM8A 2JK2A 2Z2AA 3BURA 1IZCA 1IT8A 3GVGA 4MNKA 2QGHA 2G3FA 1C3FA 5C70A 2FFIA 4GFIA 3VGFA 3OIXA 1R3VA 3NPXA 3TZFA 1DWJM 4MB4A 4C80A 3CT2A 1LF1A 1G9HA 4C91A 1F8IA 3GNXA 4H6RA 5BOOA 3H26A 4X2RA 2ALDA 2WC7A 4C7FA 2XIQA 5HAOA 4RNHA 2NW0A 4LAKA 3C0SA 4IO9J 1J93A 3EDFA 4YHEA 1W9VA 3R7MA 4HVXA 2CZVA 2J7EA 3MW7A 3CNYA 4KFPA 1TV8A 3SR7A 4H9TA 3R0UA 2BXYA 2ZTKA 2GJNA 3H7VA 1M5WA 1E15A 3W27A 4DYKA 2XYLA 5LA2A 5C55A 1ISVA 1TV4A 5I5RA 4ZR8A 3W7IA 3ZVHB 3S5ZA 1BYBA 1PWMA 4W85A 4AU0A 1VIZA 2QJMA 5AHIA 5CEWA 4DELA 4Q8QA 3M6YA 3VX1A 3RJYA 2BX7A 4HZ6A 3E0LA 2YFNA 5GNZA 4PMYA 1DJQA 3JU2A 4JNYA 5XIAA 4IMCA 8A3HA 1FWEC 1D9EA 2VRQA 4QROA 1BYDA 5EKYA 4JL2A 3WH7A 2GUYA 1QT1A 4Z1DA 1XSJA 3W87A 1OFOA 3M0ZA 2I9UA 1LP6A 5E09A 3NQVA 4AWUA 1IEVA 4A35A 3D3AA 2OCZA 3KE0A 4YYYA 1EOMA 1G1YA 4UR8A 2TPTA 1K9DA 4JFUA 2GGHA 1FDYA 3CEUA 1YPXA 1OZMA 4ERGA 2CZ5A 2J6VA 3L4UA 2VGBA 3B03A 3B8WA 1TCMA 1U5VA 2JEPA 1VKFA 3GXDA 1O12A 3F5JA 2ZQ0A 2YA2A 4JNZA 3WFLA 1GOIA 1I0DA 3A5FA 3AU6A 1BYCA 2E09A 3HFYA 2W61A 5LA0A 2WLYA 1Q85A 3H2FA 4ICMA 1NDVA 1AQFA 1JROB 1ZZMA 3PZUA 2WMHA 2FZDA 3CUGA 5KMYA 4NF7A 5DN1A 1EJ7L 4WY0B 1QASA 1LLOA 3BW3A 4QSHA 1N8FA 2ICSA 4HBKA 5BROA 3UR7A 3CTTA 3TA9A 2A3BA 3V16A 2PRMA 1KRMA 3MMDA 5HK4A 1P7TB 2YW3A 1N82A 3OA5A 4HA4A 2CLEA 4WUIA 1EXPA 4JIEA 1W1VA 4GVGA 2RJGA 3C4UA 5G2WA 2DUZA 3VUPA 3AMZA 4KCWA 4H9MA 3UA4A 1WKDA 3I6TA 3L4XA 1K70A 4MVAA 4AYGA 3DHUA 4J3WA 1TWDA 1XG3A 4AF0A 4CCDA 3W7LA 4IIGA 2D2OA 1EDQA 4Q7NA 1Q65A 5HWJA 1UROA 3WNKA 3FC4A 4JCLA 1W9BM 5BRBA 4LUSA 1SFLA 4RE2A 4MWAE 4V1YA 2BHZA 2BY2A 1PO9A 2ACUA 3POHA 3WO8A 4JN6A 1NWSA 2EXOA 4D6JA 1VEMA 3BOLA 3M1ZA 3SN0A 4A8RA 3STFA 3E0FA 3AO0A 1H61A 3AUOA 1JI2A 3FXGA 4AIOA 1JFXA 2VFHA 4R33A 2A21A 2ISWA 4DUOA 1HF6A 4X3ZA 1XUZA 3E49A 1UOZA 2PWVA 3BMVA 3MP3A 3L2IA 3KVMA 3T6CA 4J7RA 3HG2A 4S1FA 3BWWA 5A6AA 1Q8AA 1UIPA 4JTEA 4IMEA 4B90A 4FLSA 3OO2A 3SJNA 3T0TA 3S6DA 3LSBA 4IL0A 4ROQA 3BANA 3KLLA 4TV5A 5D33A 3HIJA 5CPNA 4CU6A 2AMXA 4HIBA 4HZMA 2FB2A 2IXUA 2Y5SA 3C86A 1H4PA 1ITCA 2A3EA 4PMZA 1UD5A 2ZVIA 3F4NA 2OMAA 4PODA 5TAOA 1W37A 2QA4H 3EB3A 1F6PA 3MI3A 1CLKA 4JTCA 3CCMH 3GDBA 1RVGA 3VCNA 1KFWA 1KR1A 3CZEA 4B91A 4FIRA 1T0OA 3KZPA 2QDEA 3AS0A 3RLUA 1L8NA 1EBGA 1GVSA 3L4ZA 5A6BA 3GC2A 4LALA 2J27A 3E5PA 4GY7A 1A5SA 2O92A 4L7ZA 5LIYX 4TOQA 4C65A 4PCSA 1AQHA 1CTNA 3O9NA 1XQKA 2PTDA 3OEXA 4JPGA 4OQVA 2OU4A 1JUKA 2NV2A 1L6FA 1LLZA 1OF8A 3LHUA 3NR0A 3ZT7A 3N73A 3GG7A 3CZJA 2A7RA 5HQLA 1LORA 1BKHA 2XWDA 3RJXA 3WL0A 4WGXA 1RD6A 4E2DA 2VTFA 3VNZA 5BRPA 4HK7A 3F2DA 1VPQA 3N2XA 4LVGA 4NUWA 2BZNA 4YVPA 1XIBA 4M1BA 5HWNA 4O10A 3TTYA 5A2BA 2BWGA 1E6PA 2WMIA 1W3NA 3GHSA 3W28A 4Y2WA 1VBRA 5DX7A 5GAHN 2X42A 4DWDA 3KRBA 4QIUA 3QPZA 3B9OA 5LIXX 3LNMA 4M56A 4A8IA 3WNOA 1ZBVA 5A6TC 1KO0A 2W27A 2AQOA 1EEXA 3WELA 3A4JA 3VUSA 3W76A 5M17A 4FOUA 1MEHA 5A2CA 2Z26A 3L0KA 5A6SA 4Y9OA 2PDCA 3T08A 4H9UA 1UA3A 4DJFC 2DZBA 4O1DA 1RJPA 4KGJA 3MWAA 4AIEA 2E5CA 1D3HA 1JYXA 4WGHA 3T7VA 1EPVA 4AISA 1MMFA 1XPYA 1XIJA 1U1UA 1TJRA 1KXHA 1QOQA 3GR7A 2ABBA 3QEZA 2O9OA 2V3EA 2QIWA 1CECA 3WMBA 4P8VA 3QYQA 2DUXA 2WK6A 3R5EA 3QY8A 5JBEA 2WOQA 4AZ7A 5AC5A 1J0YA 5K9CA 2BMBA 1GG1A 2YDQA 3ECQA 4USAA 1E70M 3LV6A 1MO0A 3AHXA 4PGLA 2C71A 3TMLA 3DFSA 1VQ9H 3HV9A 4ORMA 4BEQA 3BG3A 4H8HA 2R1KA 5C71A 4BJHA 4I6KA 1CXHA 1HO4A 3E2SA 4ZBCA 1Q6EA 1M41A 5EMYA 3M5XA 1GZGA 4B5WA 4RUBA 1AD4A 4G1NA 4HMNA 3MI2A 1FX6A 4JBRA 5A8NA 1X39A 1SMAA 3WD1A 1W17A 3KBMA 4QFUA 4GQBA 4M8UA 4RLIA 1T8QA 3S5YA 2PE4A 4U2YA 1DWHM 2GJXB 1K7XA 1CCWB 1C91A 3UG5A 1LWHA 3IANA 4FF7A 4B5UA 4FXFA 4GUIA 1NOWA 1H2JA 4IG2A 1Z3NA 3I6EA 1JZ3A 3WEOA 3POCA 1MWOA 3N4EA 4D6GA 3AS1A 2ZUNA 3G3DA 1BEUA 3U2EA 2ZVRA 2QCDB 1W3TA 1UP0A 1UKQA 3NRZC 4UMAA 3WK2A 2ZE3A 2L5HA 1BSIA 1S5VA 4AQLA 3NL2A 4HNLA 2XPKA 2BGQA 1TTQA 2V81A 3KOXA 6ALDA 1AJ0A 5LIUX 2E8ZA 1DE5A 1RCOB 4PB3A 4FSAA 2E40A 3CAQA 3CPUA 3ITCA 3VDHA 1S5TA 1RZMA 1TA3A 4Q8WA 1D7FA 2F2HA 3EOSA 3PPGA 1AZ2A 1FMAE 3LCXA 4Y96A 3BW2A 8TIMA 1BFNA 1Q63A 2NUWA 2QUMA 4PH6A 1NH6A 4O14A 1AODA 3HPXA 3NNTA 1CWYA 1XF0A 2HJPA 4GYPA 4JTDA 3S6TA 2DVXA 4H8NA 1Q4WA 4GC3A 3NG3A 5BU9A 3NSXA 1ZP4A 4AZGA 3UPWA 3E5BA 4ZXLA 5CSYA 4XK2A 4MZ1A 2PTYA 3N3MA 1RBAA 3IJ9A 4B5TA 4BQ3A 5L9FA 4PMJA 1XD0A 1W5MA 2Z0IA 1ZJHA 1IWAA 3GD6A 3RU8X 5HQEA 3VIPA 4CQAA 4PMDA 3CHEA 1A0EA 4L64A 3W1RA 3WLTA 3EDJA 2WB5A 3EWCA 4WDUA 4AY8A 4REQB 5DBUA 3EDDA 4P61A 2ANUA 2B7PA 1QVBA 3PK7A 3GXNA 3T8LA 4S23A 5AYBA 1D2KA 1US2A 1V6UA 1Z69A 4QSFA 5JIWA 2C0AA 3VO0A 2ZA2A 3VA8A 4HCLA 1HP4A 3NQGA 4J5NA 3WDQA 3WDHA 1KRAC 4TO8A 3L2MA 2TAAA 4D8LA 1OFBA 3MDWA 1W1TA 5ABHA 2PFHA 3ZS4A 4PTDA 5DCEA 2XFRA 1DKWA 3M43A 3A4XA 3PULA 4AZCB 3KUMA 4FX6M 1QBAA 1FCUA 4WZHA 4L4PA 3EBVA 3HURA 1A5BA 2OTLH 4HN8A 4KCUA 3QMSA 3QGKC 1OC7A 4NI8A 3GTFA 5TD4A 1F74A 3OZYA 4GYFA 3CZLA 2FHBA 4GUGA 5DANA 5BOEA 3IIOA 3RM9A 1PKMA 4OV4A 1X38A 3LPOA 5EMKA 4MB3A 2PBOA 3SCRA 1PL9A 1R3TA 3T9PA 3GU9A 1QK0A 1W0MA 2XIIA 3W2NA 3VOGA 2R1PA 5A1AA 1JDCA 2J62A 3NZGA 4RKAA 3J7ZM 5ABFB 2XVPA 1YDNA 3CCLH 4U5IA 1TPVA 3A12A 4MF4A 4HNVA 2WZMA 5H8PA 1YDVA 3GRIA 1W3HA 2PP1A 1RXOB 5DMYA 2DZTA 4R9OA 4MG4A 3NVTA 1FKWA 1B3VA 3B9NA 2LLEA 5HR7A 3AALA 1JJKA 3QTPA 4D6EA 1VGAA 2HDJA 2QEZA 5EL1A 4UWMA 5G2HA 1QMLA 4UTWC 3MUXA 3LOTA 3I65A 4UUIA 4GH3A 3I3DA 4DF1A 2E9MA 2EG6A 1U5HA 3AMKA 3W22A 1VD6A 3DIPA 7REQB 5A69A 3VGDA 3PWAA 1HXJA 3DDMA 2B7NA 5HQMA 5AHLA 3SIZA 2QJJA 1HO1A 2DQWA 3VNYA 4IGHA 3QOKA 4CGTA 3MANA 2X2GA 3R8RA 4RX0A 3UZJA 2HK0A 3A3XA 4DO7A 1YKWA 3L9CA 1T5AA 4Z42C 2DSVA 2RFGA 3NVDA 3HG5A 3QPEA 1ADOA 2OYLA 4FOKA 2OO6A 2H8ZA 3FJNA 3ZJ8A 2ZYFA 3VIMA 1QATA 2FQIA 3F5KA 1ONXA 1K9EA 3RLVA 4LV4A 2GVEA 4UFHA 3ES7A 3BGAA 1V7YA 3LPFA 3AZTA 5FF4A 3RM4A 4AW7A 3DH7A 1SM9A 1FUYA 3MV01 4W8AA 4O28A 1UD6A 1KRCC 1K9TA 4QISA 3TSDA 4O4VA 1PBGA 4X60A 5FEZA 3AZSA 3EAUA 1OQFA 2V3FA 4W7WA 2HPMA 4C6EA 4GE8A 3SSJA 4OIFA 3W29A 2QCMA 1O68A 1WAWA 4B5VA 3QV9A 4RDYA 2CLMA 4JTHA 2ACSA 2I5GA 1HP5A 4Q7BA 2AQWA 4UFMA 1W5OA 1WDDA 2WVSA 3TJ4A 4DZ5A 5D9OA 2PDMA 4GIEA 1V5XA 4LQ1A 1V3HA 1Q7YJ 5A8PA 1VBHA 1EOKA 3W2LA 2PCQA 3CL8A 1NWTA 3MYOA 1E73M 4NZFA 2GSHA 3WDRA 4WXYA 1S2VA 8CGTA 2DPEA 3THCA 3GDLA 1PIIA 2DSUA 3UY7A 1E6XM 1KGXA 3B4YA 2Q01A 1WZKA 1EDTA 1QUMA 1DV7A 3G1DA 1WDQA 1X97A 1BWVA 4E5TA 3QQ0A 1TQXA 4Z2GA 4UR7A 1IXOA 2UY5A 3PHAA 3GE7A 3AS3A 4HMCA 3GNPA 1BXNA 4U10A 2PBGA 3FA5A 5F4SA 4CQCA 4CNNA 3S2LA 2PUZA 2BOEX 3LK6A 3KVLA 4Q4MA 3IUHA 1RHCA 3VX0A 1YPIA 4W88A 1UMYA 1E71M 1OEPA 3W2UA 3FGCA 2X41A 3LCHA 2BODX 5LXXA 5I78A 2YXOA 3T4CA 3NSNA 3PB0A 4QX4A 4PFMA 1X1NA 3WF2A 2CLOA 3UWVA 4AZ5A 1A3HA 3MHGA 2WVUA 1R9ZA 4PSRA 2ISSA 3VNMA 2DT3A 3N9RA 3NZQA 2ZDRA 3V35A 4ZENA 2PD5A 1EJXC 4GIYA 1B3OA 3PG8A 2YCJA 2VR5A 3ZSSA 4XZ9A 2J75A 4C6LA 1VCVA 4NSBA 4J3UA 4Y8FA 4AWTA 1W1B1 4I8YA 4UQCA 3GK0A 1V6TA 5LNWA 1N5WB 2Z25A 1GVEA 1VQOH 4BI5A 1JZ5A 4BEUA 3MMTA 1XL9A 1WB0A 6PTDA 3GHRA 4EVZA 1F5ZA 2C1IA 4AHPA 5ECVA 4AUBA 4BHYA 1IQ8A 4DI8A 2OX4A 1JZ2A 4MADA 3SURA 3QQ1A 3R43A 5KTLA 5F1UA 1E5JA 2DDXA 3P2VA 4Q8PA 3NEHA 1G6CA 3BGGA 2VFIA 2O9PA 5D2WA 5E0KA 1DWFM 3CHDA 4E2BA 4M6PA 4M7TA 3OYZA 3VILA 1H7OA 1CIUA 4FLQA 3CWNA 4K38A 2XZ7A 1YRRA 2FKPA 3R1ZA 3W2KA 1FWSA 1UC5A 2PGFA 3MSDA 3PSWA 3HGRA 5AYZA 3RO6A 1UH2A 4NP7A 2H90A 3WUEA 1KGWA 3IJDA 4F9DA 3PPHA 5E6YA 1Q81J 1UR1A 1EF3A 2FGBA 3KZSA 4V15A 1A47A 3MYPA 2ONEA 4Q8UA 2H3DA 3UG4A 4XISA 1WPCA 1IR2A 4X0VA 3CBWA 1LTDA 4HSOA 1KFKA 3PSVA 1JRBA 3NQEA 2I57A 1TFVA 4RZ4A 1Q6OA 3RX2A 3MQTA 3QPYA 2X7WA 4DIAA 1V6YA 3MDUA 4FP1A 3EPMA 2OODA 4IFKA 3FSUA 5HBFA 1YBQA 1EYEA 4LAUA 3M0LA 3BQ6A 1TX0A 2WM0A 1JDAA 3UWYA 4G8TA 2PODA 5TQLA 5B80A 5AB3A 3CQHA 4IXHA 4MY9A 5MHBA 2ZZ7A 4B5SA 1OM0A 2VEGA 2AKZA 2BHUA 2MANA 4JFTA 3AN1A 3TEVA 1VFTA 4F48A 2I1OA 2Q5WE 4FO4A 2ZXAA 4WSHA 1XIFA 3HU7A 3AXKA 2PZNA 5AYXA 5K4XA 3MA8A 3DYOA 3TLQA 1KWKA 2VL4A 3C3NA 1TPEA 3E0VA 1Q45A 2FDMA 2YA1A 4CEXC 3NTYA 3CCUH 3FKRA 4GZIA 4ZB5A 3MHFA 4CNUA 4I9MA 2HWGA 3UETA 1ONRA 3VIFA 1GOWA 4LYQA 2NXIA 2A6NA 3GNNA 1YNYA 2WPGA 1RA0A 3ZFHA 1I60A 4KS0A 4QG9A 4R53A 2DZVA 3QV8A 5I6SA 4PB5A 1HNYA 4O50A 4N9BA 2VDHA 3T42A 3LTPA 3TYAA 1FWFC 4LCRA 2CFFA 4D1IA 1LWIA 3I4EA 4F2UA 1KLZA 1JUBA 5E93A 3SFWA 4M24A 2EBNA 3EWUA 1Y69K 1PZ1A 2FLIA 2A1YA 4TX6A 2ZFAA 4AXNA 4R3UA 3SJ3A 3TN5A 3GB6A 3GAKA 5AECA 1CGUA 2XHYA 3OG3A 4PMVA 3AJXA 1UWIA 4M19A 2BG5A 2XUCA 3NDZA 3FA4A 4UZSA 3BMXA 5CBJA 3M0VA 3EWZA 2F6XA 3JW7A 3Q37A 1XJBA 4JIPA 5I0DA 4ZA0A 1K8ZA 1UUOA 2DORA 5DY2A 2AL1A 4ZVJA 1F9CA 2V0TA 3O6CA 5CAKA 1O94A 5AYIA 2Z1VA 1J4EA 4TQTA 3W1AA 3MI6A 3BLEA 4IMFA 2Y7FA 3MBDA 4Z17A 3VE7A 4G9PA 4OUEA 3NL6A 4AY1A 2R1MA 3O6YX 3TW9A 2QMJA 2D20A 3B06A 3I6RA 3NXFA 4LGXA 3EB2A 4QITA 1FXQA 5KEZA 3QSTA 1ZJIA 1QI0A 1H11A 4IL2A 5FF0A 1MZRA 4GH1A 1TUFA 2XWEA 2C79A 3UWQA 5EBUA 3BAWA 4YHGA 5FJTA 4Z2KA 1LBLA 5CJMA 2ZXDA 2C1HA 3KBVA 1I6NA 3UJFA 3MKCA 2QV4A 4AMCA 4LAZA 4Y9NA 5AN9F 1PX3A 4KERA 3BZGA 1P0EA 4Z1CA 3IK4A 2BY3A 3G5EA 1FHVA 3W7CA 2W4XA 2QUNA 2ZZ5A 4Y6GA 3UZYA 4AHOA 1XLJA 4ZB2A 3GZAA 1Z7AA 4OECA 1WZLA 4XVEA 4QGCA 4DJEC 4M0XA 1N8RJ 5HMDA 1Q7ZA 1VBUA 3CIWA 2WMJA 3CAKA 1XICA 4YTQA 1XYCA 4CD4A 3WLOA 1ODZA 1ZHAA 3NGJA 2VMFA 1IF2A 1IIHA 4WFBJ 5CSRA 4ML4A 2OZ3A 4EAYA 4MUZA 4EAMA 3AXIA 1OX4B 3R11A 4QAWA 5H6HA 3SQMA 3VKAA 3RFAA 3H70A 3GUWA 4LUIA 1GZ1A 3UD6A 2FJUB 1JPMA 1SW7A 5F2MA 1OC5A 5H8MA 4NU7A 3LGGA 4ATLA 4A6GA 2Y89A 3WN6A 1VDVA 4OBRA 3DFHA 4E3TA 3HQOA 1BG4A 3K5XA 2TSYA 1DWGM 4A3UA 2IPJA 1D3GA 1DJYA 1UZ1A 2WSKA 1V51A 1XFCA 5CPMA 1R47A 5EYWA 3H2OA 1WKYA 5BXSA 1AJZA 3ZVHA 5D02A 1JGIA 2NSOA 3AFBA 3KTSA 2E7FA 2OYMA 3UCDA 3S46A 1FDZA 3ARTA 3NQFA 3NO1A 3IWPA 4KT2A 1XDJA 1YW1A 1RY0A 3CUHA 3QLLA 2QCHA 2VVSA 3NVYC 4LCSA 4NJIA 3PIOJ 2E77A 4ZOAA 2O9RA 4GJJA 4AY7A 2J8FA 2GQ9A 4GY1A 2FPVA 1VQMH 2VX6A 1E1CB 1HFBA 3VKBA 4IOAJ 3OLEA 3WQ6A 3PS7A 2A3HA 3GZ3A 3ARP