3WNZA

Crystal structure of bacillus subtilis ywfe, an l-amino acid ligase, with bound adp-mg-pi
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
465
structure length
465
Chain Sequence
KTVLVIADLGGCPPHMFYKSAAEKYNLVSFIPRPFAITASHAALIEKYSVAVIKDKDYFKSLADFEHPDSIYWAHEDHNKPEEEVVEQIVKVAEMFGADAITTNNELFIAPMAKACERLGLRGAGVQAAENARDKNKMRDAFNKAGVKSIKNKRVTTLEDFRAALEEIGTPLILKPTYLASSIGVTLITDTETAEDEFNRVNDYLKSINVPKAVTFEAPFIAEEFLQGEYGDWYQTEGYSDYISIEGIMADGEYFPIAIHDKTPQIGFTETSHITPSILDEEAKKKIVEAAKKANEGLGLQNCATHTEIKLMKNREPGLIESAARFAGWNMIPNIKKVFGLDMAQLLLDVLCFGKDADLPDGLLDQEPYYVADCHLYPQHFKQNGQIPETAEDLVIEAIDIPDGLLKGDTEIVSFSAAAPGTSVDLTLFEAFNSIAAFELKGSNSQDVAESIRQIQQHAKLTAKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Alanine-anticapsin ligase BacD
publication title Single Mutation Alters the Substrate Specificity of l-Amino Acid Ligase
pubmed doi rcsb
source organism Bacillus subtilis
total genus 142
structure length 465
sequence length 465
ec nomenclature ec 6.3.2.49: L-alanine--L-anticapsin ligase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13535 ATP-grasp_4 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3wnzA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3wnzA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wnzA01
3.90.1170.60 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Aldehyde Oxidoreductase; domain 3 3wnzA04
5IYZF 4ZOLF 1EZ1A 1SCUB 5H80A 4GGMX 3N8DA 3U54A 3VPCA 4O7SA 2IP4A 2XD4A 2HGSA 4O86A 2GQRA 2VHEA 1DIKA 4O2AF 1Z2NX 4O7VA 4O4LF 1KJ8A 4FFLA 2YRXA 2YS6A 2R6FA 3JZIA 4FFRA 4Y8VB 2W6PA 4O7ZA 5J2TF 2XCLA 3KAJA 5LP6F 2DWCA 2Z04A 3UFXB 2YS7A 4MA5A 1Z2OX 4HQ6A 1KEEA 4O2BF 5LYJF 4YBZB 3U9SA 3K5HA 4FU0A 2SCUB 2YZGA 4C5AA 3DF7A 3JZFA 1GSOA 4ZQIA 2W6QA 3U9TA 4MV7A 1C3OA 3R5HA 2R85A 4O7YA 5I47A 3BSYA 2P0AA 2WYOA 3VMMA 2VR1A 3KAKA 4C5BA 2X0SA 3R9RA 4EAAA 5FNVF 4WBNF 2DLNA 3BSSA 3AW8A 5C1PA 3JRXA 2Z02A 1BXRA 5CAEB 3MWEA 5LXTF 1JDEA 3V4SA 5C8YF 1M0TA 2R87A 4IWYA 1IOVA 2R7MA 4ME6A 3VPDA 3VPBA 4YB8B 4MA0A 4IWXA 1A48A 2J9GA 4YAJB 1M6VA 4I50F 1KBLA 3VA7A 1CQIB 2GPWA 4NYEA 2I8CA 4YJ3F 1KUTA 1M0WA 3R5FA 2W6MA 3E5NA 2QF7A 1UC8A 2CNQA 2CZGA 3RV4A 3QFFA 1KJ9A 3RUPA 3WNZA 5JH7F 2DIKA 5CB4F 1B6SA 3KREA 3BSWA 3R23A 1GSAA 4FFNA 4FFPA 3Q1KA 4O7RA 5KKNB 2I87A 1VKZA 3SE7A 2YW2A 5LA6F 2YZNA 4O82A 2V59A 4IHJF 1Z2PX 2FB9A 1KJQA 4O7TA 3HB9A 4EABA 5CA1F 1W96A 1KJJA 2FPGB 1JLLB 4HNTA 5BPHA 4XYLB 4MAMA 5C1OA 3V4ZA 2NU6B 2W6NA 1PX2A 2R7KA 4MV9A 1OBDA 5EZYF 2W6OA 4FGRA 3U55A 4QSHA 3LP8A 4O83A 4O84A 4M98A 4O7NA 5HBRB 2NU7B 2NU9B 3RFCA 1A9XA 4IIJF 1ULZA 4XYMB 1KC7A 2R7LA 5JQWA 2OLSA 3K3PA 5KX5F 4TUYF 2I80A 1OBGA 1BNCA 3MWDA 4HR7A 1EUCB 2V5AA 2YYAA 2R84A 5JVDF 3ORRA 2PBZA 2W71A 2ZDGA 1JKJB 3NUAA 2NU8B 4EA7A 2W6ZA 1I7LA 3TIIA 2NUAB 3HBLA 5DMXA 2ZDHA 1AUXA 1DV1A 1B6RA 3R5XA 4O81A 3LWBA 5D8DA 1EHIA 2CNVA 3KALA 2CNUA 2YWVA 4O7WA 1PK8A 1CS0A 2YZLA 4FFMA 1DV2A 2GPSA 3G8DA 3G8CA 4DIMA 4MV8A 2FPIB 2YZMA 1E4EB 2V58A 4IZOA 2ZDQA 4WD3A 5K2MA 5HV6A 2DZDA 1UC9A 5JQGF 4C5CA 4M9UA 3I12A 1KJIA 4EGJA 2GLTA 4M9CA 4XX0B 4MV3A 4O4IF 1E4EA 2FPPB 4ZI7F 4EGQA 1AUVA 2PN1A 4EA8A 4MV4A 4FE2A 2FP4B 1GSHA 3TIGA 1T36A 5LOVF 4I4TF 4EA9A 3JRWA 4O4JF 5JVLA 1VBHA 1CQJB 5GONF 3ETHA 1EUDB 3TINA 4M99A 2R82A 2PVPA 3Q2OA 1IOWA 4HNUA 3OUZA 4MV1A 4YAKB 3AX6A 1GLVA 2R7NA 2YL2A 4ZHQF 4DLKA 2HJWA 3VOTA 1C30A 1JDBB 4MV6A 3GLKA 2CQYA 3TW6A 5J2UF 4TV8F 4EG0A 1W93A 3WO0A 4HNVA 5BMVF 5BPFA 1I7NA 4TV9F 4XZ3B 2W70A 3BG5A 4FFOA 3TQTA 2VQDA 3RV3A 1GGOA 3WO1A 1CE8A 3MJFA 1EYZA 2QK4A 2C00A 1VBGA 3BFPA 2VPQA 3ETJA 3K5IA 3ORQA 2R86A 2GQSA 4O7LA 3GIDA 3N6RA 4RZQA 3OUUA 5CA0F 4E4TA 3HO8A 1WR2A 4I55F 2YRWA 4L1KA 4O4HF 4J6EA 2NPOA 4YJ2F
chains in the Genus database with same CATH superfamily
2ATCA 1T8RA 1K5GA 4H7IA 5IH3A 1WUTA 3NEAA 2HAEA 3HN7A 1SCKA 1BXZA 2F43B 2MSLA 3V6KA 3Q72A 4X95A 3HXQA 1GZSA 5AW0A 2Q0SA 4XASA 2G28A 4HPJB 1MFPA 3I0NA 4DGSA 1ZA1A 4RNNA 4YALA 1KEEA 3B7GA 3RVBA 3K5HA 2VH1A 1QDEA 2BJHA 5FAKA 3ONVA 4QXMA 4MUGA 4WJZA 2QG4A 3DF7A 5C8YA 1Z3IX 2R85A 2UXBB 3PXEA 4MUFA 5A7GA 2OLJA 4TKMA 1SHKA 4YYEA 4MVJF 1T3ZA 1XELA 3H2IA 4MS4B 2CLMB 4CUZA 3OEWA 3KZCA 5DG9A 1ZIXA 5IRCD 4ARZA 1FDWA 3F7MA 4WY2A 3K92A 4F4HA 3NVVC 4JFAA 4IWXA 1VDZA 3VR4A 5TGZA 5G02A 3CB4A 2BMEA 4M1ZA 4LWQA 2MMGA 4YAJB 2AF4C 3TRJA 4YV7A 3D59A 4IIEA 3ZE9A 3RTEA 3L1HA 4OQNA 4JVLA 1Y89A 4NK5A 4FOOA 4KFCA 4O3QA 2ERCA 1GUFA 4ESVA 1IBRA 5BY2A 1HRDA 5CDTA 1JTVA 4FFNA 4XIYA 4FFPA 1JXAA 3GR6A 1JH9A 1RHUA 4JOCA 1YVDA 3PR3A 4ENVA 5I5YA 3R0XA 4TWBA 4C7YA 2C20A 3ILSA 4YN3A 5M7EA 4ARUA 3DNFA 4J4TA 3DBOB 3GLFE 3UZBA 3L9WA 4MHTA 3IEPA 3ZI0A 1X94A 5BPHA 2VKQA 4H6VA 3G68A 4EF5A 3QUCA 4FLMA 3WIEA 4OHRA 4U3JB 2XZOA 4AU1A 3W5VA 4YAGA 4NS1A 1B6GA 3F1LA 1ZHOA 4RESA 4HFNA 4QQNA 4AMGA 3MFIA 1DAHA 4I1OA 4N41A 1WA5A 4IIJF 1GUBA 1KY3A 3D8SA 3V46A 1HY3A 2A7XA 2Q4TA 1VHJA 3UG7A 4DXDA 2PJUA 4L5BA 2J48A 1WKVA 1Z74A 5JWOA 5DYNA 3OM1A 1WJGA 2ZDGA 4J7UA 1P4HA 3EGVA 3SEAA 5BQXA 2J9YB 4KQXA 3LWDA 5DG7A 1VCNA 5CR9A 4GNRA 4M86A 1OWLA 3H11B 4UHEA 5EZYB 3T7KA 2VP6A 4GMXA 2J5QA 1M1KJ 3CC7H 4GEGA 1PT9A 3V4LA 1G5IA 3S2GA 2XB9A 1WUYA 3AGPA 1I4WA 4Z0TA 3MBIA 1QOPB 1P60A 4G65A 4KL8S 2P9JA 1C7ZA 1JIXA 1F20A 3OQIA 3ZWMA 5FPHA 3OQOA 2DFNA 3FWYA 3KUKA 1DWQA 2AXNA 1FDRA 3HM2A 5J5CA 4CMEC 2CJFA 1K5HA 1BWSA 2WAQE 1G2WA 1T1RA 3CVZA 2FWBA 4TYYA 1CE8B 2J31A 4K2AA 4MVWA 5KUTA 1PGPA 4M9SA 1GCGA 1D2RA 4WXRA 4XPIA 3N75A 3PJEA 1B33N 3D7MA 4JA2A 1NZDA 5AICA 3PUVA 1TZ2A 3GV5B 4Z99A 4KR6A 1IJEA 1A9PA 4Q12A 3KHTA 1KYTA 2AN9A 4L5AA 1U0HC 5A05A 1AU9A 3KJGA 1M7JA 3P9XA 1ZQ1A 2QY9A 1DIGA 4B9AA 3OF5A 3O93A 3FF4A 1HYEA 1QHFA 4HDNA 5K4HA 1YNOA 2GK7A 4YUZA 2ZR0A 3T9EA 3QKUA 4DLYA 2Y6UA 4DCSA 1N3LA 1CSEE 5T3UA 2MHCA 4D80A 1L5FA 3OZDA 4YGYA 4DHEA 4MWZA 2OCAA 3ORYA 1SFRA 5AVYA 5HPYB 2ZYUX 1SAYA 4WI1A 1Z5ZA 1KKUA 4CCSA 1YFZA 2GPNA 5FOXA 3ZWQA 3CF2A 4ZMSA 5H4HA 1EKVA 1DEXA 4YR7A 3AOEA 4P5PA 2Q21A 1JA9A 4MWSA 4GU5A 1TE2A 1S96A 2FK8A 3CLTD 4RB0A 2PUVA 2YVKA 3ZX5A 4N12A 3R5HA 5IYZB 3FMGA 1FA9A 4ALJA 3D4NA 2WU3A 3K70D 4R69A 1RYFA 1ST2A 4WBNF 1JS1X 1BWRA 5B36A 1LBTA 2BGRA 4ZYLA 3DLLJ 2FMFA 4GDFA 2ZJ3A 1FRVA 4WK4B 3K3VA 2WIBA 3J7AK 4DXAA 2ZIVB 1W2BH 2NTJA 1UJ2A 2RHMA 4PYLA 4ADSG 2PBFA 4CTKA 1O94A 4DLTA 3DHEA 1IHPA 2AW5A 3HGQA 2GT1A 3Q3EA 4YP3A 1M1NA 1DEHA 1OWNA 1V16B 1EP3B 9ABPA 3LV8A 4O3OA 2IIBA 3VNAA 3EXHA 3A6DA 3RRNA 8OHMA 1THMA 3B3QA 1H1LA 5C1DA 4S1OA 3MC1A 2QN2A 4L6IA 2OBFA 5A6SA 2V6IA 3TLCA 2GERA 5JNVA 2YWJA 3PW7A 2G1JA 3W8DA 5EOVA 3QKWA 3A1SA 4IOMA 4DILA 5IVKA 2Y05A 1JJVA 4MVJA 1E0AA 2GCOB 1R74A 4GQIA 1PJQA 3JYPA 4LI3X 1NW6A 3U4AA 2P9QA 5HW0A 1R16A 3AHGA 2ENWA 5FNZA 2P7IA 3UJBA 3SC6A 2QV0A 3PFHA 2WG2A 2NSJA 2Z4TA 2KWIA 5LBUA 5CCEA 1PEKE 1G5HA 2WP0A 3NKVA 3QSGA 4HAOA 2BTEA 4F56A 3LQKA 1Q21A 1FP4A 1R5BA 2NUAB 3HGMA 1X7WA 3F47A 3D8TA 1LTKA 5KYXA 3U6BA 4Q9HA 3M6UA 3LLMA 4NMHA 3QIVA 3R0JA 3T1NA 1XN4A 5TGDA 1V45E 1XZDA 2VPPA 3BH7A 2ASVA 2FUCA 3RBDA 4I8IA 4KWWA 2NXCA 1M74A 4EPVA 2DGDA 2PT7A 2BHSA 3H1TA 1EIWA 4FZ5A 1S0NA 4ZVOA 1WBJB 3IVGA 3U5TA 4AB1A 3FWHA 5IKXA 3TZQA 3IUQA 2H7VA 2C61A 5SYNA 3A2MA 3EYWA 3LUCA 3WYAA 2XTMA 3JZMA 4JLDA 4CMDA 3FH0A 4IIJA 3S1AB 2MCFA 4RK4A 5IP9G 3UUFA 1F8FA 3H4BA 2DR0A 3QHPA 1KEWA 3N86A 1HV8A 2BSAA 3D6AA 3ENVA 4RB3C 5KREA 4O2LA 2X77A 4AXXA 4PNEA 1SQGA 3DHVA 3ETNA 4JI1B 3T3GA 5JROA 4AZTA 1EKFA 2DUNA 3P4XA 2OV3A 3O8LA 4LDAA 1DI0A 1LC0A 3G82C 3C5WP 4RABA 3FZQA 2AYXA 5G0UA 3HBFA 2ZR8A 3BXEA 3ZG6A 4JP2A 5HCIA 1N9GB 2P5UA 2AB0A 3AP1A 5EIXA 2BGUA 3ZJUA 2VZ9A 2QLJA 1X86B 2FK1A 3GIMA 2BGKA 1BEEA 3EWAA 5HIJA 1FX1A 4D82A 3G2OA 2IT1A 2HDOA 5E6SB 4E4TA 1FMAE 1BROA 1JHOA 4NCAA 3WMXA 2QBYB 2ZYWX 1N9ZA 3QELA 2V0GA 3LTEA 4ZT4A 3KT6A 4MYCA 1IYZA 3ZQ6A 2RJOA 2H63A 2Z9CA 3WGUA 1KK2A 1QCCA 1JBEA 1U0RA 1TIPA 3VPCA 1PUXA 2GQRA 1QH8B 4BNGA 1LPPA 3NOXA 5IHXA 2B0CA 1L7MA 2HYIC 2G80A 4YR9A 5BWXA 3FZYA 4U8GA 5U4QA 1XXLA 1IHUA 3ROPA 2R1TB 5IUJC 1Z62A 1P2VA 3COJA 3HS3A 5I3ZA 4MVJG 4HYKA 5CJPA 1TU4A 5I7FA 3VJRA 2P2ZA 2ADMA 3LM8A 2AMYA 1TVKB 4O2BF 4M21A 4ZPJA 4EMTA 3U9SA 1UMKA 1AQ6A 1C7EA 4ZQHA 4U00A 1IY8A 5AP9A 2IL1A 1RLJA 3AY3A 1RAIA 1GLGA 2O1XA 3VHXB 2FW0A 2L19A 4GWKA 1RIIA 2SBTA 2AXPA 4J1NA 3D2CA 4P58A 4BMOB 3LYLA 1YZFA 2OG1A 5IKEA 3NHAA 1MZBA 4HWPA 1YS1X 4ZOCA 3DHNA 5CLJA 2HJGA 1VQ1A 4JKYA 2X5KO 1J0CA 3DJFA 4QPJC 2O3UA 1JEJA 1XVVA 3BJEA 2VDPB 2CJWB 4F06A 1IONA 2X9VA 4K9NA 2PIAA 3QFTA 1YOBA 4CQJA 5CB4F 1ZL0A 3LX6A 3GGGA 3KQWA 1E1YA 4WA8A 4KK4A 1A5SB 3A4IA 3ZK9A 3KLPX 3FA2A 5I7WA 1SRRA 1MH9A 1UPTA 4ZQBA 3KXPA 3TAXA 1C9JA 4WBNA 5KVSA 4ED6A 1HSZA 4URWR 1ZHQA 4YI5A 2CCGA 5DYGA 4OHYA 2V5UA 3IDOA 3A6EA 3U60B 4FGRA 3IR5A 2EFDB 5KTSA 1SUWA 1H2EA 1VI6A 4DA8A 4PLPA 4X6XA 4DE5A 2Q45A 2VYFA 1YOVA 3LQQA 3A1TA 4NJMB 4FFBB 3HJGA 4GZMA 1I0IA 2IUUA 5K09A 1RR6A 3V32A 5AW7A 3JWEA 2ATLA 2Y6VA 4BMSA 1Y1TA 1LPMA 1E9EA 3UT5A 2I7XA 4Y7DA 3T8YA 3GBVA 4E1BA 1OTHA 3ISTA 4G4SP 3U4QA 4AMBA 3EZ7A 1UBFA 2GZ1A 1JEYA 2Y1EA 3LI2A 3TXYA 1BJTA 1LWNA 1YV9A 1RJ9B 2F9MA 1CQWA 1K08A 1W73A 3OUTA 4S1WA 1DLIA 1EK5A 5A5GA 1XTTA 2J45A 1MABB 4G0UA 3RVRA 2FR1A 2F3RA 2B5OA 4W6QA 3M4YA 2BFBA 3RSQA 2X7HA 5K6AC 4DSTA 5JVLA 2B61A 4AG6A 1Z16A 2OR3A 4OB8A 1SUDA 4Q0MA 1W85B 3ADBA 1PUJA 4U9HS 3OEHA 4DCOA 4ZDIA 1ZK4A 4Z3KA 3DZBA 4AJIA 3GJ8A 2YHIA 4KNWA 3S68A 5LZ8A 5JAQA 1U4NA 2Z1DA 4UATA 3N3AC 1E1CB 5EE1A 5FTNA 3KR2A 3T7RA 4W9RA 4EVIA 1A2KC 2WWYA 2WK5A 2NNWB 1KJNA 1QR6A 4G0MA 4M0LA 2TS1A 5SZIA 4B2IA 4IGAA 3T35A 3DXZA 1XJQA 2JLCA 4TQAA 4QVGA 2YQ4A 1YB2A 3GH3A 1QG2A 3QE2A 4MUMA 4ZEXA 1J21A 4RVCA 3D7LA 1L5HA 3MGGA 3OJFA 3G17A 3W7BA 1J5EB 1NI5A 1UK9A 5DNYB 3DCNA 3INGA 1XEXA 2QX7A 1MHTA 1OF1A 4ZOLF 4C2AA 3MB5A 4X6YA 4BVAA 4P3YA 4M8NE 2MDTA 3FFBA 4LTNA 3AVWA 3WJAA 1D04A 1F2UB 2O0MA 2DH5A 1KI8A 3RSFA 4DQXA 4CF7A 2HPZA 2BT4A 4TLAA 3E5HA 3CW8X 5ED4A 2GCIA 2W55B 1JIUA 3OM0A 5BOSB 3CH6A 1QUFA 2OA0A 4UBOA 1IXYA 4L6AA 2PGJA 2GYUA 4ROSA 4YCLA 2FUG6 3V8MA 1DOZA 3JAKA 4JSRA 2WA2A 3AEYA 3BPSA 5TMDA 5DT2A 3I4NG 3GCWA 3VMMA 1ABFA 1LW6E 1DAGA 4ND8B 3QOWA 2HHJA 2OSBA 3V7UA 1X7ZA 4G24A 1JRPB 3KEGA 3GGJA 4ARCA 2WU1A 2NLOA 1GPUA 4UD6A 1SULA 4MW0A 1RLUA 2NVBA 3QENA 3ECCA 2VDNB 1G3MA 5KHOC 2Y1XA 1O95A 421PA 3WIOA 1JSCA 5AHOA 1C8BA 1QBGA 2NXJA 3WV5A 5H1YA 1IFXA 1EJ2A 4I1PA 3I0MA 1EFKA 3LSYA 1W25A 1X7YB 1YCDA 3HCCA 1IJKA 4XJSA 3TW0A 1CQZA 2Q28A 1IEXA 1JRLA 4J0GA 2CJYA 5E4FA 2PXCA 2PT5A 1VQMH 3R5JA 5K3DA 1YE8A 1W4RA 1QAQA 2FOXA 2GR9A 2HX1A 4C14A 3KFLA 3S2ZA 5JI2E 4PG4A 3LY9A 1NFFA 1I6UA 1XL1A 2QYOA 5EXEA 4QXAA 1TJ5A 4W1SA 3H4MA 1NXPA 4CZ2A 4P6VF 1XK5A 3MRTA 3GGCA 1II8A 3VR5H 5AH0A 1ND5A 2IHKA 2G67A 3PDHA 3N70A 1ZVMA 1P7VA 2NP7A 3O4RA 5CT9A 5E7MA 3RC3A 3C98A 3UK0A 3CA8A 3W5CA 1H4SA 5DLQC 4NSNA 2H4YA 4GRDA 2H92A 4BFVA 3A6ZA 4YT8A 5K1ZA 4X8MA 2I6XA 1FE8A 3DHYA 4ZYTA 2XTNA 1AA6A 4MYUA 5JPDA 4QT4A 5CB4A 2WT4A 4QRIA 1M90J 1W1WA 3BEOA 3ZVLA 2BLLA 3MJRA 1NF8A 4F72A 1YK1A 4MUNA 4LHVA 4US2R 2IYXA 2R9VA 3RU9A 2YZLA 1W6UA 1S2OA 4HRYA 3N7AA 3BJMA 3P2MA 3SE0A 2AZTA 1YL6A 4BVBA 2HJRA 4MGZR 3PIPJ 3EAGA 1A1SA 5DYIA 2JI6A 2PMWB 3F4KA 4GL2A 4QNRA 4PYRA 3IR6A 5KB3A 4XX0B 2W8ZA 4ZGWA 5ITVA 4TUYB 5CM9C 1I6KA 5TF0A 2QRZA 3EPPA 2NO0A 3L8GA 3CCCA 4N3NA 4M0CA 5L95A 4A3DG 4ZI5A 2NXNA 5JCXA 2OMDA 3HKBA 1UOEA 4B3IA 4BNZA 3U62A 4X6LA 3TW8B 3E4CA 3LG2A 1MCZA 1BX0A 3RHSA 4UCUA 5G4LA 4FZVA 4CI9A 2GBLA 3WICA 2AVDA 3IOMA 3W2EA 5DEIA 3EZGA 2BTQA 1IZYA 2WZQA 5CDYA 3WO0A 4ZXFA 3EPIA 4XWYA 1Q0RA 3PT9A 4N18A 2NZXA 4XD2A 2H7CA 1I1LA 2HH9A 2ZB8A 3CE6A 3FYCA 4M1WA 2ERXA 4CRWB 2ID7A 2Y3IA 1W9HA 1NLMA 3QEBZ 2GZ3A 4JXKA 3BVPA 3LP5A 2A67A 4MVCA 3QWAA 2NADA 3L79A 2WAAA 3QV1A 3PS9A 3MWYW 3T94A 3VKUA 4FE7A 2FK2A 2YY6A 5AM2A 3LTNC 5TQ2A 4Q3EA 4H3HB 1HM5A 4IZ6A 5DHPA 3K4HA 4O33A 4NMMA 1VQ9H 3FTNA 4FXPA 4OM8A 3GN2A 1CX9B 2P5SA 4R7ZA 3TLGA 4KRYA 3U26A 3AUUA 2K2QB 3ZZ1A 1FQOA 2EDAA 1ZWLA 2ZAIA 2UYGA 5LP1A 4BC1A 3PLRA 1KEEB 1BQ3A 2CFIA 3CT4A 4RMNA 5HM6A 2F8LA 5L3QA 3VFDA 4I9NA 1ML4A 1VL1A 4MTEA 4QFBA 1EVZA 3UAYA 3BK7A 5KIAA 2F8TA 4Q02A 2YHBA 5D1OA 2QZZA 3R0VA 1CKMA 3QFRA 2GN1A 3R44A 2G76A 4RM3A 1W581 1YMQA 4NULA 4KAXA 2YZGA 2ZIWB 2F55A 4IV5A 2VH5R 2VP9A 1Q0SA 3W5IA 2Z6VA 1UDAA 4H0NA 2C2KA 4ARZB 4Y2SA 2HK8A 1KFCB 1MEEA 1ICEA 3ESXA 5BW8A 2ISQA 5DG8A 2PGOA 4NEHB 3D4BA 1NVXQ 1M0EA 4ZOLA 1WRVA 1YWGO 2PZBA 1LVGA 3DV9A 2IEDA 2JFPA 2ODQA 3TTSA 2D1TA 4XQ0A 3VHRA 1SCDA 4KYTA 5DASA 2UZ4A 1ETHA 5LL6P 1WLSA 3SIPA 3DJYA 3LOQA 2C0PA 1X9IA 1UXIA 2I8CA 4TOIA 3DOIA 4TMTA 4EF6A 4DJ5X 3GGOA 1F6DA 1TW2A 2WJHA 4KR0A 3Q41A 1JXOA 3H4VA 3LX8A 4LC9A 3QUQA 1RTKA 1WW8A 1WQ3A 1GDDA 1JAYA 3H5NA 1A8IA 2Q62A 4WRRA 4X91A 2CEKA 2QQ0A 1A3CA 2D3WA 5A0FA 4MB0A 2W2MA 4LXUA 5SZHB 4GYKA 4EF4A 3PNSA 2G70A 1TF7A 2ZQYA 3ZNQA 2O54A 3WHKA 4MQFA 1E1MA 2ZK7A 3RFFA 4DB4A 3DEYX 3ZKAA 4BNNA 4BQPA 2C22A 1E6EA 1S02A 3H8SA 3H0GA 2PX6A 4MLDA 3K8QA 1NJSA 4CTNA 3OICA 3CZQA 4OP1A 1I0ZA 3LXUX 4XQCA 1TCBA 4CDNA 2D2IA 5L1IA 4ECXA 4IWNA 1GZ6A 3FKSD 5KC9A 2P2YA 4RZIA 5EY5B 2HVQA 2B98A 1DKUA 4RE6A 4DLUA 4ED8A 3ZGVA 2AL7A 1ZQ7A 2AG5A 1F4VA 3ZX4A 4DARA 1N9GA 4MCHA 2ZRHA 4L73A 3UJ9A 1LI5A 3AVYA 5B3KA 1TTPB 4GM1A 4OI2A 2P4QA 1D7OA 4OBEA 4GC7A 1IDN1 2HLHA 2ZB4A 2AG0A 1KYVA 1CUSA 4ZAXA 2B7BA 2N1BA 3L1KA 4JI6B 1E9AA 4ZHQA 3UKDA 3OQIB 1VYTA 3LCUA 1I1QB 4D9FA 1R0BA 2CDBA 1AGYA 1AXGA 1TLTA 1L2ZA 4XQGA 2ASEA 4HWGA 4B8YA 1XD9A 4ZYWA 3CD6H 4GNKA 4HGYA 3C7CB 1IBLH 3HRHA 4TYWA 3I9KA 3Q4GA 2IEIA 3F3KA 1QVAA 3IUSA 1W8DA 3T9AA 1F8YA 5LDGA 5K3AA 1I33A 5D6NA 1T0JB 1N62B 3CCEH 1OKKD 4ZARA 1C9NA 4BLTA 4XPIB 1W0JD 2VATA 2NVYA 5GIPE 3GLRA 2WT8A 4QIHA 1E9RA 1HDGO 2Q6TA 1NW9B 2EVWX 5A6VA 5A4DA 4GKJH 4PAMA 2Y2UA 3T15A 1PGJA 5ES4B 3BWMA 3ZY3A 1YCFA 5D1NA 2WJ6A 4I9UA 4BRZA 2VTBA 4GKKB 5ILGA 4I4TB 3TQHA 5MGBA 2FFHA 4DLVA 2YXEA 1MQSA 2IF2A 1PTJC 4HDNB 3LKDA 2FW9A 5KNCA 5AVWA 4JUBA 1NUAA 1CFZA 2HB6A 5G0VA 3UANA 1KDPA 2PAAA 4DL2A 5BWCA 2WFAA 1PR9A 1M0SA 3CFYA 1I2KA 3VNRA 1ZJ5A 3WL4A 2D1YA 3U3OA 4F3YA 4FFLA 5HBGA 5A04A 3PTZA 1FMCA 4ND5A 3TLXA 2OFPA 2JJMA 4NL4H 4HN4B 3HEAA 2AV6A 2DYKA 2ZM6B 2CV1A 1QJ4A 3VZBA 2FPXA 5JSYA 4CKEA 1WSBA 3QMPA 3JU3A 3FHCB 1NV8A 3RHZA 4LF5H 3W1VA 2VR1A 1JA0A 5AN9F 4BL5A 1D9XA 3NOQA 3SX2A 3FNGA 2PRSA 3ANYB 4OKSA 2TYSB 3VH3A 2BE7A 3ICPA 3MM4A 5JI3E 5CVVA 5DQGA 3RTAA 1HYQA 1CUAA 2AFVA 4FFBA 1J24A 4ASUA 1M1NB 1HE5A 3PGKA 2I4RA 4FSDA 1QPNA 1DAPA 4PCUA 1DEOA 4PCLA 2IYLD 4D8TA 3NC0B 3EXHB 3NIBA 3OE4A 3TX2A 3OF3A 4JXXA 4OGGA 3GPCA 2DY1A 1H1LB 1T9GS 3GF4A 1UAGA 2B4YA 2I2DA 4Q21A 4RACA 5B7NA 2P67A 4RY8A 3K2BA 3SQXA 4N6NA 1C81A 4D8VA 4MRSA 1K86A 3PGA1 5NLLA 3PKZA 3OE7D 1YRLA 5HMLA 1Z39A 3JYLA 4BECA 4QASA 3HE3A 1FXSA 1M9NA 3UZUA 2GF9A 3K8OE 5EIBD 2C3YA 5LWQA 3VTKA 5FFFA 5ALVA 5IABA 2CL6X 1HH4A 4L76A 3WJ2A 3LQRA 2ZJQJ 2ZSIA 1PZEA 4JGIA 5HK8A 3A1FA 3FMVA 3KHKA 1ZW6A 3C2VA 3UO8B 2X1VA 3MUNA 1V0JA 1PNTA 1FP4B 2IXGA 4BO1A 5DBIA 2XNDA 3QZ7A 3D3NA 4IRDA 2E85A 4BO3A 5C8DA 4EARA 3ZV6A 4XOIA 4NBRA 4YIKA 1EHIA 1P0MA 4NFLA 5KFBA 4ZQGA 3QX7A 1Z68A 3Q3JB 3KKPA 1LBIA 1ZN8A 3I32A 4LFBB 3TNYA 1Q95A 4CKYA 3FC4A 4U7FA 1JHYA 1ZIPA 4D74A 4OAPA 4QTZA 5K0JA 1EBUA 3QE9Y 3T3NA 4CI0B 3D64A 4IIJB 1GVNB 1ISIA 3RNOA 5BSFA 2I0FA 4XYBA 4G0WA 1OU4A 5EMKA 3ANXA 3H6HA 1L1FA 1DIOB 2XCTB 2BRUA 4M99A 1IWOA 1CRPA 1ZBQA 3TZ6A 1GFIA 2J3QA 2G6BA 4PVCA 2H06A 3DFMA 4H4DA 4NZMA 2AQHA 4J9KA 2NSYA 1XVIA 2VJAA 3ETEA 2QYSA 1ORWA 3DFFA 1ID1A 1WXFA 2R68A 2YWEA 3I42A 4IS3A 2WVHA 4MUKA 3G23A 2LV8A 1XYGA 5JNUA 3QH4A 3V9AA 2CD9A 3AW9A 2VDKB 1T13A 1FVIA 3EHEA 5CMLA 1OWMA 2L18A 1OYYA 3K5IA 2PQ6A 2VQSA 5G41A 3QELB 3DONA 3PZPA 2GKSA 5HUJA 1Q19A 4C7OB 2VJKA 1VAJA 2G5PA 4KPUA 3KZMA 3E81A 5JDCC 1W59A 3ER6A 3TXAA 1QKIA 3NXSA 1YXMA 5E25A 3LVBA 3R09A 2FMHA 3QE4A 1X7YA 3T1HH 3O2JA 5KYVA 4IHQA 2H5LA 3KDSE 5K3EA 3ON5A 1HNZH 4CGZA 4LX0A 1Z5WA 3P45A 3MJCA 3OE7A 1Y6RA 1V37A 1M6NA 5LD2C 5GOTA 2QWXA 2P1RA 3KJFA 1G8PA 4W5WA 3FLBA 2HRDA 3N53A 5DGDA 1UK6A 1EK6A 3HADA 1PTKA 4AYXA 3PCXA 3B13B 4L8WB 1NJ6A 1ZGBA 1S2LA 3KHSA 1ZUIA 1N4DA 4ZU1X 4R8KA 4A0SA 2JJ2D 1UPXA 2COUA 2J5BA 3K6JA 3BKXA 4E5MA 1U1DA 4I1IA 3SC2A 2FWRA 5KPJA 4C21A 2C4UA 2QROA 4YMWA 5LBTA 5JAOA 1IZ7A 1C0EA 1ORHA 3VNBA 3VZPA 3P0JA 4RLHA 2BI7A 2BR4A 2BGTA 4Z49A 4GLJA 4I8DA 2IELA 1UOOA 2OHJA 4PR0A 3V4SA 4GZLA 2R87A 3S24A 4NTZA 5KTNA 2LP4Y 3CVUA 1IB0A 3C3AA 1S8OA 2Z9DA 2GEFA 3VR4D 4BASA 1ZUD1 3IPYA 3HO1A 3KB6A 2A86A 4WZBA 3ABQB 3CCLH 4PHFA 4IFBA 3MR6A 1L4HA 2XT9A 5KT3A 1K1QA 1NX9A 3QXGA 4QRDA 2ONKA 2UUPA 4ODIA 5DHAA 5HNKA 3A6LA 1N32H 1TLFA 2QAIA 4WBNB 1EFCA 4HLNA 4O82A 2QKYA 5D01A 4FD3A 3IBSA 2OD7A 3ZOKA 2F4VB 2UVRA 1RBMA 3CXRA 4TUYA 2JA7A 4TPKA 1FFCA 1M72A 3UATA 2WG0A 2UV8A 3C8HA 4J9VA 3R5TA 4C4ZA 1XMIA 1YOVB 2F2TA 4GPTA 2W6OA 1ZD9A 5FV7A 4M98A 4QJIA 1CUJA 3C1TA 4ENUA 4RD2A 3TW8A 1YR9A 1H4VB 2VDMB 3K0KA 4EENA 2R84A 3HY4A 3U4QB 2AUMA 1V5EA 4DCPA 1UXHA 4PHTA 4E51A 1VIMA 2YY5A 1JEYB 4YEKA 2HMVA 4MIKA 2PSFA 3KZNA 4NMWA 1X1AA 4F5WA 1C8KA 3LUBA 5AK3A 1OT5A 1BWQA 4NENB 2CNUA 4C78A 2QMHA 4F85A 4RTOA 1EG7A 2C8JA 1GLNA 1R6VA 4AJHA 4Y6LA 3KXIA 3RT9A 3GLVA 2CHUA 1V48A 3TM4A 1CUZA 4RQUA 5FF9A 4D3FA 2BFBB 3MJVA 2N0SA 5FJIA 4X92A 4BMZA 4LFAH 1ZOIA 3R8FA 3CEMA 4HNGA 5ITWA 3EGEA 3QWBA 2QXYA 3H0KA 3PK0A 5AI5A 1P1JA 2PU5A 2I9PA 2I4MA 3UJCA 1WUKS 4ZZ3A 2J41A 2YHIB 3ELWA 3GL9A 1T3HA 3D3EA 1M7BA 1RU3A 2CFMA 1V1RA 2J87A 2IXTA 4RPLA 1RAGA 1KYYA 1AN0A 4TQUS 3PYXA 3UAOA 4LISA 4MINA 2JJ2A 3BM5A 2B8WA 1B2LA 5DM70 3IEXA 2WU8A 1G55A 4GR4A 4NBLA 4NCNA 2W70A 1AUPA 3E5MA 2YR0A 4RD0A 4BS9A 1RRVA 1JIIA 2FMXA 4Q1AA 2WTXA 5H9WA 2YVLA 1L5HB 1XTRA 1FTYA 4E6EA 2D4AA 3N6RA 1XEXB 1DJPA 2GFQA 3BA1A 1WRBA 5CXSA 1QU3A 2YRWA 2RGEA 4G8CA 1QZTA 3G2KA 3DEHA 4PEVA 3N87A 3JX9A 2BZGA 4KR3A 4N8EA 2WQZA 2PS9A 5JXJA 4EIWA 4QUHA 1XF9A 1HKUA 1K88A 1TO6A 2ZUSA 1N63B 2NV0A 1S2GA 3AYXB 5JG7A 4J2TA 1XMQH 2YQ5A 4B5LA 1GQYA 1D2NA 2OLKA 3HJCA 4HJRA 4G1BA 4ZHSA 4FYHA 4LX8A 2H9YA 1YRWA 1PD1A 5JZ9A 1O2DA 2PWBA 4IHAA 2JA7G 4KFTA 1J70A 1QVGH 1IN7A 3JAKB 4G0OA 4II2A 4LQLA 3H2BA 5JUMA 1G20E 4QJFA 1K92A 1M2KA 5HILA 4C5AA 1X7ZB 4RKWA 3NAMA 1M1YE 3U3MA 5DBFA 4NJOA 5FJJA 2YV3A 4AF8A 1PR6A 1YR7A 4L5CA 1YJWH 1XCGB 3HCAA 4B6OA 2WJPA 4MW1A 1XMOB 5JAMA 2WM3A 5F7XA 1ZL2A 3HNOA 2ANBA 4XR9A 3LYHA 1QTRA 2VJMA 3K9BA 1DBIA 5H16A 1SMKA 2BI8A 5FL3A 1JU4A 4UXHA 1O94D 2AJBA 2EYUA 3L6UA 2Y1LA 2PKQO 4O2BB 5D5PA 1WPQA 1QGAA 3Q10A 2Q1WA 3GJ4A 1ZNXA 2CZGA 1KOLA 4X3PA 4JXZA 4JSYA 4JS0A 3I83A 1GILA 3IPLA 2JIRA 1MOZA 1TO2E 1VKZA 3H19A 2HCRA 1SCIA 1LDMA 2GWRA 3TVTA 4DDKA 4GBJA 4BBRG 1II8B 4AN0A 4LHXA 3RCBA 1U9CA 2DFDA 2QEXH 3T5BA 4MVJD 4ZV4A 1YC2A 3HCFA 5DNDA 4OKIA 3G3EA 4I9GA 5FUYA 1C9DB 2G1UA 1X15A 3CVXA 5LC1A 4RH1A 2QXTA 2XF8A 1YCHA 2P90A 2H2IA 4N3AA 3IAXA 3DOEA 5CB4B 2P3OA 3FCAA 2QT9A 4BWFB 5ALWA 3TR6A 2DABA 1D2EA 5KSZA 2DHDA 3FI9A 3EG9A 5IM4F 4FNOA 4E33A 1H4TA 1MQ9A 3KALA 1PJ3A 5CDUA 2BJVA 1MVNA 4W82A 3AV3A 3SIXA 4MGEA 5IASA 3I23A 3CRW1 5KFFA 1AM4D 4G25A 1J9ZA 3ONNA 2YCBA 1XZQA 4QOIA 1U1FA 4I4TA 2CHQA 1Z7GA 2QD2A 5BUZA 1PL8A 2AUTA 4KN5A 9LDTA 2GPBA 4LRTB 2VUSA 5ICSA 4YHHH 3I12A 3G79A 2DTDA 1DOAA 3NHLA 4QUGA 3KJQA 4RVGA 2HN9A 3OQPA 2WZBA 1P4JA 5JBIA 5IDXA 5IXJA 3FAZA 3DMPA 3B82A 3HKBB 2D0PB 4JP8A 3R5KA 3IHTA 2O8CB 1A76A 3WSVA 1Q1ZA 4FGUA 5JVHJ 3KOYA 1TF2A 4QPCA 4JI0B 4EW1A 1ODFA 2XMZA 5DP2A 2BTQB 1CIVA 5K3SA 5ALIA 4XQEA 3AF0A 4R3WA 1CLUA 2HDWA 1D07A 3OZWA 1P2BA 4M37A 3LQFA 3ND5A 4DJFC 4DJDC 4ZTBA 1FU4A 1TO1E 1TA9A 2Q5CA 3DE6X 2OCIA 3BG5A 4FWTA 1N8KA 2X2PA 3SIRA 3BOSA 1YR1A 3ZOZA 1JI0A 2PS1A 3QI2A 5IBPA 2J08A 4MX8A 3NJRA 3W79A 1D2CA 1YZUA 3B20A 4LBZA 1N36H 3RWOA 4HLUC 2C35B 1XEWX 5F2KA 1W1UA 5TQ2B 2GQSA 4GEKA 1B3RA 2VNAA 3RUHA 5FWXA 1PJSA 3DZ8A 5ADUS 3EWSA 2CW5A 4IDNA 4QO7A 4C0KA 3I1IA 3WKCA 3MJTA 2Q1YA 1SXIA 4MYRA 3QFHA 3TLGB 3TI7A 4BKRA 5H80A 4C4XA 5C18A 2ASJA 3VPXA 3LVRE 1FDSA 1JFTA 1LPSA 3IPAA 3HLYA 2CV2A 5L3QB 1X7GA 1RYHA 1U0JA 5CIYA 2SECE 3FGNA 5D1OB 1DXYA 1RIFA 1UBCA 4RY0A 4F5DA 2C5GA 2E87A 2XNHA 4I4NA 5CW1A 3W6NA 2CSXA 1AS3A 3G2QA 1YQWA 2AXQA 2IUTA 5DM0A 1I30A 3ZXYA 3PW0A 1MAVA 2QIEA 3H97A 1U3UA 4O5AA 4MWOA 3I9JA 3SYTA 4DSNA 4US9A 1ES9A 3B5IA 3INYA 3U9TA 4ZOLB 3RPFA 3MUFA 3UK7A 3U7RA 3LT2A 3KAKA 4B4WA 3GGPA 2DCMA 1VGQA 3VO1A 2NZWA 3IAM6 4KNVA 1BWPA 3ZHSA 4KNYA 2QGZA 4WOJA 2WTBA 1MOSA 4GWLA 2JFHA 3VR0A 1JZSA 3GAFA 2E5LB 1C14A 1TWHA 4FZ3A 3I8OA 4NYEA 3IHLA 1FYXA 4TT3A 5EUCA 2H2FA 3DMDA 3SN6A 4IFTA 3D7NA 3B1JA 3W78A 4B3FX 1DRVA 4MVYA 3OOJA 3BCSA 2Q2OA 3BREA 1GT91 1P1BA 3ZNOA 2FQWA 4OKNA 1U99A 1U28C 3HABA 3EVCA 5JMPA 5BQPA 4Q4DA 4EZBA 3R3VA 2O05A 2VDQB 1EB9A 2X6QA 4UBKA 4MQFB 2VIIA 1VB3A 3K8ZA 1KEPA 3ASUA 2R6GA 1KC3A 4EKIA 4RNMA 4PINA 1UJ5A 4D41A 1UC4B 5KYWA 2C2WA 3PUWA 5C1OA 5LM3A 4NEQA 2R7KA 4R6WA 3IQGX 1ABEA 1HDOA 3SQMA 3FTCA 4XARA 2OFXA 1YDEA 2FSFA 3T5MA 2UAGA 4A4DA 2C2BA 3W34A 3HKCA 1YJAA 3CBQA 3OTOB 5JJKA 1JBKA 5JO9A 3C2EA 3CZMA 1WBDA 3CPWH 1GYRA 3KVRA 2Z8YM 2V5AA 2X15A 5IP7G 1T2AA 1W48A 1J0AA 3DT9A 4UHDA 5DX1A 2ODNA 1E3LA 1QGOA 3IOCA 4C76A 2KPOA 1HORA 4I1VA 4RIHA 1AF4A 5D8DA 5F4ZA 3HJFA 1PS8A 1JYEA 2KS6A 3RRYA 1I1OA 3SZLA 5AW4A 3NGLA 1FTSA 4ZVKA 2EEZA 3RVJA 4IG9A 1RM0A 4RVFA 3U3ZA 1SH7A 4ZHQB 3FLAA 1Q0ZA 2A9KA 3O3CA 5GQSA 3RSLA 4G8JA 4C7OA 2ECOA 2VRNA 4A27A 1JAZA 3SF0A 3INRA 2IYNA 5GP1A 1LDEA 2HJHA 3NATA 4WBXC 1JR6A 4M55A 3SVLA 5J40A 4NLLA 4Z3OA 3NYRA 2C5EA 2V4QA 1R9JA 2QPTA 4R51A 1NE2A 3OEHD 4UZFA 2Y1CA 4I6JA 1JZTA 3TXXA 2XIGA 5IM4A 5BR8H 3O3NB 3IUBA 1RQPA 1S4QA 5BV2P 2VUGA 1UXOA 1U5BA 3T12A 3FI0A 4LXQA 4RHXA 1C9EA 1TC2A 2VTBB 1QX3A 3PYMA 3ZCSA 1OW3B 1EGQA 1U3GA 5KTMA 1XI2A 5HRAA 3I3OA 4Y6RA 3I2FA 3AUTA 4IHKA 4BX8A 1QLHA 3TLJA 4QXPA 3W6OA 3ZXUB 5FV4A 4D9EA 3LHKA 3CSDA 1YRYE 1UXJA 3WV4A 1L6RA 1T91A 1RT9A 5AESA 4K7JA 4TVBA 4FGLA 2WV9A 3E35A 1S9HA 2BD0A 2L0XA 1KC8J 2FJUA 2VDVE 2C28A 1WU8A 2VT3A 1TPZA 1VQ4H 2GPYA 1R6UA 4DAEA 1D0SA 3W90A 1Q7BA 2WJGA 3T7SA 3PD7A 3V4OA 4XVHA 2B8NA 2M1XA 4BB5A 3C3YA 3SXJA 2E4UA 1DMRA 1KQNA 1AQJA 4BEBA 1I7PA 4CKEB 3ZXIA 1Q7EA 4AVYA 1GM5A 3OMWA 5BWVA 2NX2A 4MCIA 3BWXA 2PUFA 2EJBA 2IH5A 1M6HA 2JPDA 4PANA 4CIXA 2V7UA 5ICMA 1BKYA 3M6LA 3SZOA 3HCOA 1NU8A 4B9EA 3NWBA 2DECA 2I78A 4ZCTA 4W99A 1NW5A 3EVGA 4O6VA 4S05A 4W5TA 1YFLA 3NRJA 1O95D 3WBFA 4GWGA 1B4DA 4EFEA 2D3TA 3ZV7A 1FYEA 4DIBA 3VVBA 3ZNNA 5FBRB 1VG8A 2J3JA 5BXQC 3HYLA 1Z6PA 3L93A 1RM4A 1KMHA 3DNMA 4CMJA 2O8FA 3QKRA 4NENA 3KE8A 5BOVA 3VPFA 1XQ6A 3N7UA 4INAA 4JI7H 4M1KA 3RIEA 5TJHA 2Y4NA 2QUZA 5LQCA 4JLJA 4F9FA 2WK1A 1QKKA 1ZM4A 4ZOHA 1Z6ZA 1MX1A 3TH5A 4DY4A 3RGGA 5DBHX 2ZKIA 4D45A 2R65A 3VKFA 5SYMA 4JCOA 3EMBA 3CZRA 3FFAA 1VXOA 3DR3A 4YCCA 1AF7A 5KEIA 4IDGA 1FXWF 3GJXC 4WLVA 5J59A 4ZAFA 2W9CA 1NXTA 1Z75A 2BLNA 3PHHA 3LRXA 1EK2A 2O3JA 2JLBA 3GG2A 5T6BA 4EBFA 4A0QA 2EERA 1KDRA 3F49S 1HF3A 1GCAA 3JQGB 4LNAA 3H8JA 5DMXA 2HRQA 3I55H 4NV0A 5JFTA 1D2AA 4P92A 1GQFA 3U48A 3M3DA 1NUSA 3VYVA 2XGSA 4NATA 1NQOA 1ZK1A 1DCFA 4WZZA 3GI1A 4TXJA 3OZEA 3E2IA 3IG0A 5JFOA 1Z8DA 3X1KA 4X64H 4MMYB 2OTLH 3JWPA 4C5CA 4FS8A 2RKBA 4Y2RA 2KI5A 4Z8YA 3WGNA 2W48A 4YUXA 3BXGA 5J5VA 3PFFA 4OLAA 2XB4A 1ZCAA 4LV6A 3BMNB 1GYPA 3DE5X 2RH9B 1L5YA 2PVPA 4FQ8A 5E9JA 1T8PA 1KZ1A 5FORA 5IDWA 4ML3A 2J9ZB 3KHRA 5LQMA 4PRLA 1JDUA 2Q7DA 4Y1RA 4PCVA 3TE7A 4C3VA 2ZCUA 2EJUA 2G8LA 2JH3A 2VQEH 1RYMA 1OSNA 4GKBA 3BWEA 1SVKA 3L8YA 2Z6QA 2COIA 3MS7A 4ZO8A 1N5LA 5CYFA 4RCNA 8GPBA 5J58A 3TLEA 4RDXA 2W8BA 3WO1A 3Q98A 2G7MC 2C2ZA 1TPYA 1Z2AA 2A58A 1D2MA 3KKLA 3UOAB 3DPSA 2G72A 1ZZGA 3R20A 4KPUB 1WBBA 1X77A 1IM8A 4GVXA 1WULS 3H2HA 2XRMA 4ECWA 3C41J 3O26A 2Z09A 3QFCA 2GGSA 4N6GA 2VPWA 4YI3A 5B7PA 4IJKA 2PRKA 2YZKA 3M83A 4E15A 4LZOA 3ABRB 1LX6A 4EGSA 2MOKA 2XB8A 3FZEA 4O2BA 4AWXA 4WEQA 1HYGA 4Y0NA 4J1QA 5KAMA 2IHNA 1Y9DA 3PWSA 2Z4SA 3G89A 5E4JA 5EP2A 1KOJA 3ETCA 3W7VA 2NSLA 4OHMA 1U5AA 4C7XA 1CJMA 1UJNA 3SC2B 1QHHB 1NM5C 1OR8A 1VJTA 3E23A 1XAIA 5LYJF 1YZGA 2FUG1 1NW8A 4TQGA 1D6JA 2BKUA 2Q1UA 1MJFA 4BX0A 2W6QA 3OZCA 4CDGA 4TTQA 2PPVA 3DE3X 3HY6A 4OIFA 2MSEB 1Y8QB 3OP1A 3TLAA 3V48A 4FILA 1R4ZA 1KZ7B 4DV7B 4P2GA 2G71A 3WTCA 3IR7A 4LYHA 3G1TA 1WR8A 1T5BA 2B25A 3JAWB 5LQDA 4J16C 1O97D 4WZBB 2QVGA 4MXDA 3KQKA 1JLRA 3U44A 3U56A 3L46A 4JJKA 4OQXA 4XDGA 4DCMA 1U2GA 3VVCA 3K1ZA 3KLMX 1IBKH 1XTKA 2H1RA 4R5MA 4DFDA 1IBCA 4IEEA 4J4BA 4RW0A 4EUFA 3GRFA 5JADA 4LPSA 3EIFA 2FPWA 1S2IA 4Q24A 1YS4A 4OHWA 3LUPA 1GU7A 3U4GA 4LZLA 1CZKA 4F2GA 3GRCA 2IRWA 4WHXA 3NVKI 1XYYA 2IZZA 2I14A 2W6CX 1N6KA 2RJNA 2VJDA 3DZHA 4B76A 4A3FG 2ODBA 3T7AA 1KRXA 4MYDA 2YBEA 2DH6A 4B3SH 5EAIA 2XUPA 3FYUC 1N3IA 3FCSB 5IW8A 4BGIA 3DZCA 4DV6H 1T9GR 1BGVA 4AF6A 3RBZA 1THGA 5FYDA 3H1BA 4FR0A 4GYJA 1BN6A 2VSQA 3JTMA 1IL0A 3JZ6A 2O8CA 1Q0PA 5FRDA 2B63A 4PLYA 3IBGA 3IVAA 4CV2A 1H6BA 4MPJA 3K0FA 2OGSA 3PVZA 4N03A 4KGDA 1P19A 4QGBA 3F0TA 1XKTA 1GQQA 3MS2A 3ZH9B 2R8PA 4KXVA 2D0DA 3JVVA 3BERA 1TFUA 2VRWA 4C3OB 2MU1A 2A3RA 2J7KA 2HWWA 4EHFA 2V4RA 1HDCA 1VP9A 4D5GA 3QWUA 1J2RA 2KM1A 4M9RA 1KEUA 3QYFA 4AJJA 3PIOJ 4ZVQA 4PNHA 1SBHA 1V3TA 2J4FA 1O03A 4C2BA 4JYAH 2IYFA 2J3LA 4L4RA 4BKQA 2ZS8A 1GTJ1 1TK2A 4PGFA 4X66B 2LIVA 2GN4A 3ENKA 2WHQA 3KQYA 3PQEA 4CG2A 2QGFA 1N2CA 4IIVA 2FZLA 3PIDA 5JWRA 4RZRA 4JLPA 4FEYA 3W06A 2FTKE 2OHGA 2G09A 5F51A 1QDLB 3H2GA 3VNSA 3S1SA 2P9ZA 4O4JF 1VECA 1HE1C 2J33A 4F8YA 1V1RB 1GTMA 1O9BA 1AXRA 3AEQA 1DXQA 3OOSA 2FP3A 3F98A 4K6GA 2J1LA 4ZOQI 3DS8A 3BXXA 3CCVH 1CQJA 1D6NA 3BMOA 3HZOA 1ZXXA 5BW5A 4HH0A 1JDBB 3WL7A 2B6HA 5IZCA 2W9BA 5ITZB 3HL0A 1VCMA 2XJ4A 4E70A 2F1RA 3PXGA 4JEMA 4RETA 3QU5A 1Y0BA 3SLRA 4TL7A 4ENQA 4YV1A 4KMMA 2W5UA 2AX3A 2WINI 4X6UA 2PGDA 3R3XA 5EJ6A 4QPPA 2RGXA 1P4AA 1RXIA 4AY5A 1UZAA 3GFRA 4HATA 2HEGA 2G1AA 4FTWA 4RF4A 3GLQA 5KNCD 1ZVKA 2R7ZA 2QZSA 2Q4DA 3T1QA 1SOMA 3IKTA 3OM9A 2BH9A 1TKRA 1KI7A 4UAJA 4UAVA 4NCXA 4H1UA 2ZTVA 1TJNA 2Q7OE 1V4VA 3LT0A 1C7FA 3QEMB 5CFZA 5F64A 1RP7A 5AXBA 1RZVA 4QODA 1SBQA 4ACBA 1RS0A 3FHLA 1QZZA 4YY3B 1TKCA 1DIKA 4PYMA 4GECA 4LBYA 1UKZA 1VKOA 2G0NA 1NYQA 4YV2A 1N1EA 2ZWMA 1A2BA 1NPTO 4BNYA 5LP6F 3H6GA 5CT8A 3JQBC 4EITA 2HRBA 2AOUB 4PC2A 4DR7B 4ALNA 4GRIA 3Q7QA 2B63G 4TQSA 4EOGA 4DT1A 1XROA 1JQDA 1YS9A 3RB4A 3HUDA 1OLUA 4AJLA 2Y27A 4K87A 2Y0EA 4ZOEA 5I47A 2VJMB 4AZ3A 1W19A 1W49A 2YN0A 1H0RA 4QDUA 4DLAA 4Y2XA 1TM5E 3EQ2A 3I64A 4RNCA 3C87A 3CINA 4TTIA 4HADA 1MC4A 2A0UA 2GPAA 1MVOA 3KO8A 1O9GA 4ASUD 2F3PA 3GA5A 1GRQA 4R8LA 2QVLA 2GRJA 3AKEA 5K3FB 4D6YA 2PRZA 4E14A 1HT2E 4I81A 3D6UA 3UHFA 4OFXA 2VK4A 4YCAA 1SXPA 3IMCA 3RUPA 2FQXA 3B53X 5CHYA 2KSQA 5LYJA 3QVJA 2FSGA 4CG3A 2GM3A 3GX1A 4YMUA 4YMSA 4BNMA 1N2XA 1W5EA 2YJZA 3T61A 4EH1A 2WHRA 1V8BA 4MWTA 4K0RA 1WMAA 1OPXA 1GPKA 2DUUA 3AHCA 2G3YA 1XWFA 3MS4A 4L4XA 1JDZA 2VFAA 1SOVA 5BXYA 5AMXA 2ESRA 1V97A 1KRHA 4L28A 3BT7A 1EA5A 2VHWA 4BKMA 5JO0A 4NQRA 3HR4A 3EG9B 3FR8A 2HM7A 1VOTA 2XNDD 1QKJA 1K68A 3E5RA 3A6PC 2ZAOA 1U4SA 1QSGA 2IUEA 4HB2A 5KQPA 5ALPA 4JHXA 1XDWA 5D85A 2NUBA 5B1DA 2OUKA 5E0KB 2R7ZG 1RE1A 2NO7A 1G6HA 4NCJA 2IU4A 5A62A 1IXKA 2VP2A 1G18A 3Q1LA 2GAJA 1ZJ6A 1TMKA 4G9EA 4B79A 1C41A 3JD2A 1XXHA 1IVNA 1N0IA 3AR6A 4UM9B 4DCVA 5HHTA 1G6OA 3WMRA 4HL6A 1OLOA 1NYRA 3SSNA 2J0SA 4GI7A 3NONA 1TEZA 5LOVF 1B1AA 4KOAA 1PWEA 4KYUA 3GELA 1TTHA 1E8DA 1H3EA 1CF4A 4E30A 4W9MC 3SHVA 1AURA 2JIZA 3OBIA 2DWOA 4OLFA 1Z6AA 2PIDA 2BEWB 4NAVA 1IWBB 4ZC8A 1KH1A 2AX4A 4LXIA 1ZH4A 4QBGB 1ZJ4A 3DPUA 4FKBA 3Q6IA 5MFZA 4E08A 4RPCA 221PA 3HACA 4WZBE 3WKAA 3ZHUA 1T6NA 2ECQA 3LUDA 4GSLA 3DT6A 2IGTA 4N54A 3QLUC 1VE5A 1C3JA 1SIWA 5FWXB 1SD1A 2GVDC 1WMFA 3ZU5A 4WEOA 4B6JA 3OIFA 4EB0A 1UDBA 3SBOA 3TSAA 1QVVA 2WUWE 4O4JA 2ZXUA 5HF8A 3CLKA 3QK7A 3OY7A 2CB0A 4BFLA 1EJ0A 3GFBA 4BQOA 1QCZA 4UM8B 2JFVA 3L6EA 2VJBA 2RKOA 3J7TA 3I01M 1OYOA 3E15A 4CFYA 5TDHA 4BYMA 3WXMA 5BYJA 1E98A 3S5JA 4O2AF 1J2JA 3Q7SA 4KO2S 3LHIA 1N6LA 2BY4A 1VLLA 3ZBUA 3Q2IA 2I4OA 2HIXA 3RANA 4C04A 3BWVA 3HP4A 3C6YA 2ODPA 1U63A 1GAXA 2C5LA 2CLSA 4HHEA 4ARIA 2Z9BA 1HMYA 3PGLA 5ED0A 1GPDG 2HD4A 4LYDA 1VPEA 4Q6BA 3T3PB 2F48A 4P53A 4ZJPA 1AQIA 2HNKA 2RD2A 2VAVA 1V9LA 2UUAH 3NHMA 1TD9A 3U0GA 3QKIA 5FYQA 3IHKA 4LUCA 1G6Q1 4U5XA 5DAAA 3HKDA 3PC2A 2G17A 2FWIA 2VBGA 3ZDCA 1VYVA 2VSNA 4Q39A 3OCYA 1IVYA 2HMSA 4KE9A 3U1TA 3S8EA 2WAYA 1F0PA 4LCBA 3I58A 3AWIA 1NMEA 3WDMA 5AQEA 4GLWA 3N28A 1P74A 1HL7A 1JDVA 3W5HA 1FTNA 5KYTA 2W83A 2PT6A 3ROGA 4FXOA 2CDRA 4P1ZA 3VU1A 3JQGA 3VKGA 3LWNA 1MV5A 1FIUA 4IIXA 4PXYA 3BCUA 2JIQA 2B0JA 3OQBA 3EFBA 3VR2A 2R1UA 1UMBB 5LP6A 3HOYG 1ZPDA 3FNQA 4NZPA 4HI0E 2WM9B 4E1AA 1NT2A 5KYWB 2JK1A 3PITA 4Y2PA 3A2KA 3L05A 4JYMA 2ZAMA 3CCMH 1Q11A 4IXMA 1M5RA 1MOQA 1LBEA 4KAJA 4RX1A 4ZZ0A 1NDHA 1RXCA 3HKCB 5LQUA 1T5HX 1TYEB 2NSHA 4JR2A 1ESNA 3BMNA 1KY4A 3V34A 1IJBA 3FPKA 3G1UA 1EEXB 1YVPA 1MBZA 4RKQA 3ER8A 4ND6A 2NTNA 1EQUA 1TQ8A 3MN1A 2ZYSA 1WH2A 5JQWA 3O0TA 1CY7A 1P6XA 5E6RA 2NYUA 1SELA 1Q86J 3NZEA 1GO2A 4EQ5A 16PKA 1LQTA 3GEIA 5GAEN 2FOLA 3JQFC 4HLQB 4JMPA 4LJ6A 1MAWA 3HYNA 2ICAA 3L9XA 1V3VA 1QK5A 3HRIA 4KXLA 1X74A 5AYXA 4F5ZA 4TVSA 1KI1A 1K6IA 4FGZA 3KJZA 1NOKA 1EVQA 2O7NA 1ORTA 4FHGA 5LZ2A 4KE6A 4HC4A 3DO5A 1MDFA 1OGIA 2EJ3A 4UEWA 4HG2A 3A1DA 4Y0AA 3H7IA 5BR1A 3L7NA 3EXIB 2DWUA 4ZCIA 1N7GA 2CFCA 5KC8A 5KQRA 1G98A 3OCXA 1AUVA 2P4UA 1DPGA 5AXDA 2QN3A 4R71A 5DSZA 4LVNA 5AD1A 3VZSA 1XFDA 4LDZA 4C7ZA 2UVWA 2Q07A 4FN5A 1H2AS 3RW9A 3SKXA 1E4VA 4YAOA 1CDDA 3CUVA 5KFLA 3WC4A 2EGGA 4JT8A 1U5BB 3ASYA 4U0KA 3W2FA 2YASA 1AKQA 4D81A 4AJEA 3AEKA 4NMLA 1K9SA 1HG0A 5L7WA 2E1PA 3BL8A 5KG4A 1ZUWA 3Q0EA 1PGQA 1QHHA 3K6RA 1OZFA 4QXOA 4H1WA 1GGOA 4OYLA 3SAJA 4ZYYA 3OO0A 1PG5A 5BW4A 4EJSA 4A3JG 1Q1AA 1DWOA 1KO4A 3ABZA 4MYTA 1DIRA 5JD5A 1Y8QA 4EBDA 1VJRA 4G36A 1J0BA 2IDMA 2EX1A 5LOVA 1VCOA 4H6XA 3JAWA 4I6EA 5D84A 3GUVA 3HFGA 2ZI6A 4M53A 1GT6A 1UKVY 4X65B 1DQRA 4JUCA 3BX1A 3OMLA 2ETXA 4D9HA 1X8LA 3H2SA 4PU0A 4MHSA 1J97A 4C1BA 4G5OA 2XPCA 3N76A 2UUOA 5HR5A 4A2CA 1QQ5A 4JEUA 1SUIA 3RI3A 4EEXA 4UU7A 3EXFB 1CKOA 2GD1O 5CTAA 4D0GA 4W5JA 2FKNA 4WJKB 3KAJA 3MNFA 3IRVA 1LF0A 2GTIA 3KQSA 4RK1A 3VNNA 4QOJA 2OV1A 1GRRA 1L8XA 4D9KA 2X3YA 4WT7A 1B7GO 3TIVA 4UPVA 4EJ0A 1KS2A 2Z83A 3U4CA 3I04A 2PKEA 2RC5A 4E6PA 1VJ5A 3QVWA 1PYGA 1RI2A 2FFBA 5KFOA 1RWPA 3BFVA 1IUPA 1TRKA 3U7QA 4OOFA 1HZZA 4MRMA 2R5NA 4NDNE 1LS6A 4KG7A 3WVNA 4AKIA 4A1OA 2YFHA 3AZOA 5JD3A 4ETMA 3R4CA 4NZNA 3RUCA 1QZXA 1AHHA 4BEWA 5T7BA 4O2AA 3CLSC 4OBXA 1KMHB 3E05A 2O8FB 2FR8C 4HRXA 5DGCA 3QKRB 2GEUA 1VCHA 3K09C 4K3UA 2OHVA 3P20A 3F6SA 4YJ3F 3WAGA 4CF6A 2OZPA 1OUMA 1ECFA 3KQUA 3WBJA 3KREA 5ALGA 4I3FA 4ER0A 2HRRA 2OXTA 3AJRA 5KU7A 2XB2A 1TQHA 4UBMA 4WECA 2QMUA 4ZO6A 3L43A 1CEYA 5HCNA 2FJPA 3H0EA 1TADA 2EJ0A 2XE7A 3OU2A 1SYXB 1FDIA 3ZZUA 1J8DA 5JCOC 3BJYA 2Q5FA 3PW4A 2XUGA 2W9CB 1PFUA 3OAAD 5CXXA 3FBTA 5K3BA 2OC9A 4ECZA 5FHQA 3GMIA 8ATCA 3DHWC 2O4UX 4E09A 4ENTA 4BBAA 4LPKA 4OYYA 4C4TA 4WMLA 1ZFNA 1EUCB 4XH9B 3RAPR 4IOKA 5K0BA 2CVOA 5ITZA 4MUBA 1W5FA 5T5QA 2RK3A 1P62B 2D54A 3PC3A 5K8UA 1U2RA 1COWD 5M04A 5DRYA 4E07A 2V03A 3ZLUA 4O7WA 3DWGA 2UUCH 3UENA 2DPIA 3FYSA 2AOWA 4B3RB 2PL3A 1DV2A 2Q5QA 3L7AA 1V25A 4MVJE 3EXG1 3EEYA 2XA1A 4G23A 2CXPA 1I2MA 1UP7A 1Q0HA 1IY1A 3FE2A 2QN6A 2ZM5A 3OLWA 4OP3A 4OJNA 4B3MB 1KHHA 3FWNA 3IQHX 4XTCS 1KDTA 4KTTE 2VSYA 1F5NA 1NN0A 4AMYA 2OCXA 3S7ZA 1VBHA 3FR7A 3QEMA 4UM9D 1XRPA 3TECE 4Y1RB 2HCTA 4RUAA 4YDQA 2Z5LA 4GO1A 3B9QA 4JNCA 5TNXA 5H1SO 4TTJA 1B0ZA 3PCRB 4WJLA 2EG5A 3KFXA 4DDTA 3TW6A 1DADA 1VTKA 2W8BB 3GLGA 1U3VA 1HR0B 3VC1A 3R7WB 4PZ9A 2XUDA 4OUKX 4N48A 3SNOA 4PSUA 2HXGA 2IW3A 2H1IA 2LZ0A 4RVDA 2AOUA 1ESCA 1KEZA 3HBNA 2VH2A 3RAFC 4EI9A 1QLWA 1USVA 4ZVSA 4GBGA 2NMVA 3A3OA 2YHAA 3AJAA 1TCUA 3I2IA 5M34A 3O9MA 4KWEA 1EUQA 3TKAA 2WHEA 2YMQA 1MR3F 3IQZA 2XVMA 2Y4RA 2ASLA 3JQ8A 3O4VA 4K2HA 1K8YB 3UPUA 4WCFA 2WYWA 2C03A 3GAAA 3UUGA 4EHIA 4KBYA 4JJZA 5IWAH 1KSHA 2HHLA 4ED7A 3BRSA 4R1OA 5JD4A 3D6TB 3NYWA 4R31A 4EO7A 4BIIA 2FPLA 2AJTA 5K3FA 2H2DA 1G2PA 4OHUA 2I62A 5CH3A 5LNK6 3D54D 4GI3A 3T95A 3R0ZA 5KT5A 3WKDA 5LMNB 1NVVR 1H4QA 4X41A 2VZLA 1Q0QA 4K9MA 5AJXA 1YQXA 1NVJA 4JXJA 2H18A 5HF5A 2WE7A 2KSWA 1AKWA 1OTXA 1ZH2A 1VLQA 3WHLA 1NJ2A 3ZWWA 4HQ6A 3BACA 1YA4A 1KDZA 3PNKA 4OYHA 4BLSA 3OAAA 1JXLA 1U0EA 4YXWA 4PTLA 3UFXA 2GXAA 4N7BA 4KE8A 4OHBA 3ZWYA 1EWYA 1T2FA 2QE6A 1EESA 4HDOB 2YYSA 1WTAA 4DW8A 3GRKA 1NL3A 3U44B 5ANRB 3OF2A 1OH5A 3HMQA 4BZWA 1FUUA 3AESA 4EAFA 3LSTA 4JAVC 1I13A 5BSWA 3OJXA 2O5VA 1OJLA 5BUSA 3TOSA 1NA5A 3A6HA 3CLHA 1COWA 4US8A 3TKLA 3NV9A 4JYPA 2EW1A 1K5PA 4MQEA 1E8NA 1FSFA 4TT3D 1FFUB 4EPYA 3GYBA 3E5NA 2LRHA 4TXMA 2YWXA 4QDJA 3IEKA 4A91A 3X1ZA 2G9NA 1LD3A 2QD5A 4G5RA 2ZJ5A 5E7QA 2X1LA 3ABIA 1Q84A 1ZCBA 3GP5A 1CQIA 3VVMA 3IJRA 4CKXA 4C0XA 1NIJA 3HSSA 4P35A 2IXAA 2PZLA 2QTVA 1YD7A 7ABPA 1KVRA 1VLHA 1QE3A 1QM5A 3JVIA 2JRLA 2YIMA 5LJLA 3O94A 3OJCA 1YCGA 4MDYA 3WGHA 4YQFA 4QOFA 2VWQA 3JYOA 1TGVA 5AVRA 3VX4A 3K0FB 3OCJA 1NOJA 3UV6A 2D7JA 1YA6A 1N2OA 5AI8A 3EAQA 3HBMA 5JZBA 4A6DA 2P6UA 1GFWA 2NZ8A 2BEWA 1WB5A 3MINB 3RHTA 3QRWA 1TFRA 2IPXA 2GHRA 4LF9H 5JMWA 1H6AA 3PEWA 2DG2A 2H59A 1HNWB 2DKFA 3TBHA 5F35A 1UBJS 5BWMA 4OH7A 2WJAA 3PVXA 4YJ3A 2ZSHA 1M10A 4Q3OA 3WRXC 1N34B 4D42A 2WTMA 1HSOA 1A2QA 1JKJB 4E5YA 4L8LA 4IV8A 1OJ7A 1JJIA 3WL6A 1RQNA 1D09A 1OBFO 3C85A 1ZMBA 2YWHA 2HK9A 1XRQA 2GAOA 5KFQA 3H99A 1N2CB 3KTFA 4ZAGA 5IVDA 1L4GA 1PWHA 3LPDA 3EGWA 4BY1G 3ZWXA 1WMEA 1WZ2A 2W11A 5CH8A 4WNYA 3N39C 1FRZA 5L40A 1N8RJ 2NAFA 3ICOA 4MI6A 2BGLA 3AEQB 5C53B 1WSCA 5KOHA 4L07A 1HETA 1CQJB 1CDEA 4BWVA 2IYUA 3BMOB 3KLNA 1E5TA 4C4OA 4RGQA 3FVVA 3CM0A 3CZAA 3K0EA 1M67A 1Y1QA 4FKMA 1G0NA 2W9BB 2I2XB 4C22A 4EFNA 4W9NA 2BFWA 4N1AA 4L4SA 4BATA 3PZBA 1WSAA 3EVAA 4B7UA 3TUIC 3M4ZA 2C58A 2Q5WE 3G5TA 5ICGA 3JQ9A 2RGVA 1KSFX 1G64A 5A7HA 3RJ9A 5NULA 7AT1A 1DKLA 3EGDA 4RTRA 9LDBA 2PVSA 2GZ2A 2YW9A 3EIQA 4ND3A 4RF5A 2V6FA 2C9OA 4EUHA 3MR5A 4RADA 5FOQA 3E2PA 2RGAA 4JJ7A 2MR5A 1TA8A 1YZHA 3ZV5A 5ER6A 5DLYA 5FPQA 4A16A 3ZHQA 1G4HA 1VHDA 3IE2A 2GM5A 3V97A 5EJ2A 1ILWA 1G5RA 4LHYA 2R00A 2WTEA 1W94A 2SNIE 1WOMA 2OT3B 4ED9A 2IYEA 3GRUA 3MRXA 1RPNA 1RM5A 4ZVRA 4Y2HA 2GCPA 1OAAA 4D0SA 3QPWA 1GCIA 3ZWBA 1UMBA 2RGNA 4DLLA 2O2EA 2DJIA 3H9CA 4DT1B 3FTEA 1I80A 4IH9A 4AUEA 4DG5A 4AUNA 1BE8A 3OIGA 1OLUB 2GYWA 3LK7A 3VV2A 2WIJA 2NQ8A 2C4VA 2GH1A 3SR6C 3O03A 4AZ3B 1LNQA 2MWMA 2FA9A 4A9AA 5GJCA 3I6MA 5AHXA 3O8DA 1Y69K 3KJHA 1X0XA 2GPTA 3P0EA 3G7NA 3WIUA 2FZVA 5ALYA 3IAM1 1Z0JA 1UZLA 4BV2A 2BMDA 4N47A 5DM1A 4PWYA 2V55B 3HLKA 5C51B 4M9QA 4JB0A 5KFEA 3LY7A 2AYZA 3FCYA 3FROA 4MA0A 3M1IA 3GZNA 2HF9A 3QEKA 4DREA 1DKOA 2DFPA 1EQ2A 3ENWA 2BISA 5LYJB 3ZQJA 3H86A 3OTHA 3FRIA 8ADHA 5JRZA 4QQRA 2QLFA 5C46F 1YI2H 1ZKDA 1DE0A 1R3UA 2GCNA 4JBNA 3HDJA 4ZRNA 1JG3A 4P08A 4RAYA 4YJDA 2QSZA 2V6BA 5BV0A 3SBEA 1LSOA 3WNDA 1BKDR 3HA5A 5BWOA 3I62A 4C1NA 1Y4UA 3EXIA 1Z29A 4PAWA 4LF6B 1XAHA 5CLQA 1S03G 1M75A 1Y1WG 4HDKA 1PFYA 4K6MA 1E7RA 1NUTA 1FCJA 2DBRA 2OHFA 4PSKA 5EXXA 2BHTA 3LP8A 2NT3A 1ADFA 5AVVA 2FE3A 3PEEA 3RIYA 4MB2A 2CD7A 4IILA 3LF2A 1MIHA 3GRRA 4PNZA 3CY6A 1QMGA 4JFRA 4UU1A 2E37A 1SU4A 1BAPA 4CQMA 4CTOA 2G04A 4MW2A 3T52A 1VJGA 2EX4A 2XRYA 2J30A 3RS8A 1J1ZA 3QU7A 1QQBA 2GF2A 3JYNA 4P2BA 1HE3A 2GN0A 3FMPB 4Y6OA 4J3NA 1XXHB 1JYFA 4RF2A 4N0PA 1S8NA 4LOIA 4DBLE 3KZKA 3T34A 1J2UA 3FTFA 8MHTA 5FFMA 3M0EA 1CIJA 1XAGA 1KZYC 1VBMA 3PLNA 1GAJA 4FHDA 4EGJA 4A3EG 4B2LA 1BMFA 2AE2A 2FUEA 5SICE 4L0DA 1WCMG 1QPRA 5JECA 3UB2A 5HIAA 2PLFA 1T6XA 3SR3A 1IBSA 3CX4A 1EWKA 3CR3C 2JEJA 2GZRA 3KTAA 1KSGA 2BUCA 2D5LA 1ORIA 1K75A 3GTQA 3LUAA 1RYSA 2FWNA 5FJ8G 4BO6A 1JEQA 2B2XA 3G2MA 3EXFA 4CIBA 4DJAA 3M5PA 1KP9A 2OC4A 4QDXA 1KE2A 1JHMA 3SP1A 1IBMH 4GYWA 2VEDA 2Q3BA 3VOBA 4M2LA 4HLDA 1NJFA 2G0TA 1RAFA 2JFBA 1T5SA 5C4IA 2QUAA 4ZCLA 3A4LA 1A7AA 2RB5A 3Q7RA 5EC8A 1MXFA 3LNCA 4EJFA 4O4JB 1KQFA 3T4EA 1FLDA 1FLVA 1ML3A 4IIFA 1VE3A 5B1IA 3K72B 5A71A 1WV0A 3EDCA 1MRNA 2WF6A 3OHSX 4BQNA 4UZSA 2VXYA 4F11A 4OVKA 3OCZA 4L15A 4TMXA 5BSEA 3WAJA 3JRNA 3MTEA 3OQMA 3ELUA 1SUEA 2IDZA 3ESDA 2PVCA 2B34A 2CF5A 4IX9A 3O75A 1VDMA 1DG1G 3ZDQA 1KMNA 4AJPA 4Z54A 2V74B 3P9KA 4C07A 1SIBE 2CZQA 4PR3A 5IKPA 3ESBA 5KFRA 1WPXA 3I5YA 4X62H 3FGOA 1LI7A 1T3GA 2HT6A 6Q21A 4UEOA 3RB3A 4UAUA 3K1TA 3SC3A 1QOZA 1RJQA 2R8EA 4G85A 4EG5A 1KY2A 3WGGA 1YHZA 4FU0A 4IDEA 3HKDB 4FCWA 3EOZA 2L82A 1NUPA 3CWQA 3WGOA 1PFKA 4MQ4A 3LVQE 4Q9KA 5KSWB 4W7HA 4ED2A 2YYYA 2X6RA 2ORYA 3KQTA 3HI4A 2QRGA 4NMXB 4B6GA 5JIBA 4IGEA 5HUQA 1LC3A 1AS2A 1J07A 1N2CE 1WDLA 3DTTA 3BFKA 1FM0E 2WJ4A 1QE5A 4BXOB 3CPHA 5IDVA 3EZYA 3OPYI 4M7OA 4RKEA 1A48A 1EUCA 1G2IA 3E3MA 4W5OA 5LP6B 5AHKA 3ZI4A 4HNQA 4NONA 1ESMA 4KJXA 4H15A 3MLAA 1W5TA 4EY6A 1UBTS 3QX8A 2PGAA 1U7PA 3O92A 2BKXA 2VTDA 4KSCA 5EMMA 1S7GA 4H77A 5ENZA 3N2NA 3IELA 3RIZA 4IOLA 4D0LB 3WXBA 2DVMA 2EZUA 3RJ5A 5E3HA 3L0BA 4YO7A 3HY3A 4YUYA 3B5JA 3FXAA 4HWRA 2XQKA 1QU2A 3ZIDA 1NF9A 4B6SA 1CDZA 2Y0PA 3SHOA 3TRHA 1VSQA 3LLUA 4F1JA 4F5EA 2OZVA 3KHUA 1A97A 2O2IA 3JALA 1C3EA 1UDWA 4YP7A 2HWUA 5E6RB 3FCUB 4YJGA 3J81k 1T0BA 4OXIA 1X1BA 3RC2A 1SEIA 3LKVA 2B1IA 2BMVA 3VR3A 2H00A 2ZYVX 1U1EA 4CM9A 4Y9SA 4CMCA 5TPWA 1ZSVA 1P2DA 1DKRA 3PQ8A 4K8RB 2Q4OA 2ANCA 1GEGA 3R7WA 4PYQA 5TC4A 3ZDEA 3WZ2A 1YA8A 2ZDHA 4J03A 2A5JA 3SMQA 3AOGA 1E20A 3PDWA 1WZCA 3IP1A 1UZUA 3SQWA 2PZMA 1YHYA 4EYGA 1R0RE 5DULA 2XGJA 5EMJA 4YGXB 1N8SA 5C31A 3SS9X 2JLQA 3TIGA 1EK0A 1T4GA 3C15C 5BNFA 4FWBA 3RJMA 4A3KG 3BTOA 4QPDA 2W0SA 3OMXA 3V8BA 2G77B 5IXYA 1QGZA 3AEKB 2OG2A 4KXNA 4W4TA 3BHIA 2CXXA 5A02A 2GWHA 1XCPA 2YMPA 1I2CA 4FBMA 2C9YA 5AW1A 1G42A 2DKOA 2UXDB 3CB2A 1MQAA 4EJSB 2Z3VA 2XR1A 2NW6A 4ECRA 1QZUA 3GFOA 1X9NA 3M9MB 5BWLA 4N3CA 1FYDA 5LOVB 1IQUA 2F8MA 3HCEA 1TD1A 4MVJP 4WZ6A 4QWAA 2BWJA 2QY6A 1X7HA 4OTZA 3GFPA 2ZBFA 1F7UA 2E4AA 2IC5A 2Y0BA 1DAIA 3C3EA 5KPDA 3WLFA 1HDYA 1VE1A 1ZMXA 4KEAA 4G56A 5B4UA 3HOWG 4JBHA 1PJBA 1OBOA 2QUJA 1QAPA 1QB7A 1GQ2A 3SKYA 4HVAA 1KPGA 2B9EA 5KT7A 1E7QA 4OXRA 3MHPA 1SCUA 4LGYA 1XDUA 2I4LA 5FDFA 2PBLA 4MPDA 3AV0B 4BNLA 3NC0C 3ORFA 4AS1A 4EB3A 4ZREA 4RTSA 2JFQA 2JGDA 1D1QA 5CDGA 4X1IA 1PE0A 1USUA 3BULA 4Y30A 2Y8EA 1CZHA 4JB2A 4FHZA 2OCGA 5K20A 3B36A 2Y1WA 3SFVA 3U7QB 5FADA 4MRMB 1ENYA 4XD7A 1TZBA 1S0OA 2X6TA 3V6MA 1GKYA 4Y2QA 4XDHA 3PT5A 2FCRA 3NDJA 1Q7YJ 4PF1A 4O2AB 5TV2A 3MINA 5EL0A 4S0XA 3UWKA 4PX3A 4HRAA 3JWHA 2BCGY 3NFRA 5E1MA 3VJMA 1Y1SA 4V2IA 5CD9A 5F9FA 5CFLA 4X5OA 4UOEA 1N6IA 1X8XA 2QLMA 1JKJA 4KMOA 3ZWNA 4OXNA 1MW9X 3WR5A 3RRXA 4PLVA 5BNIA 2VLIA 4FBLA 4DA9A 1EI9A 2WK6A 4S1PA 2AEFA 4KO4S 1PWZA 1TGYA 2PFGA 3TZBA 5CUQA 4HY3A 4AQYB 1VJ1A 1YE3A 3LCVB 4KBGA 4Z5XA 2FFJA 5HX7A 5JAZA 1RFLA 4P9NA 2IHJA 1K4KA 4RFVA 4OI1A 3CKKA 1J8QA 5JMTA 4CCYA 1FXWA 3N8KA 3GO4A 4CQLA 2V4UA 3L07A 3PW5A 4IUDS 4L5YA 3RJ0A 4FP9A 2ZVJA 4XM2A 1OPRA 3FCXA 5EJ5A 3GEPA 1G8JA 2ZJTA 2GRAA 1V39A 2NPFA 2RAUA 2XW6A 4J49A 4ZQEA 4I99A 4G4GA 2PJDA 4WKBA 4QAJA 5HOEA 3ER9A 3AEXA 2YU9A 2YV4A 3Q7EA 1J06A 4ITRC 2JANA 3I8XA 4AX8A 1H1TA 3IESA 4AP8A 1CUYA 2J9XB 1EGMB 3CLTC 4UXJA 2O8VA 4QEZA 1NY5A 1P5HA 2GUWA 4N3BA 3UUWA 3K70C 3GIIA 2UU9H 2R8YA 2YDXA 2MIIA 3RSOA 4MIEA 1A04A 4L7VA 1BHJA 5A5EA 1ZD1A 4QATA 3VTZA 2P8JA 4DV4B 4LDJA 4HGOA 5DF1A 2P9BA 1P1HA 3JW8A 1HPLA 4DMHA 1PEAA 4XWTA 4KR7A 1ZS9A 1NBEA 5HZGA 4IDFA 3GLIA 4LSAA 2PN1A 1IY9A 1DRJA 1AD2A 2EP8A 1P2GA 4GGPA 3RTBA 3Q8XB 3UM9A 1PJLA 4EBCA 3TZHA 4GPAA 4QLAA 3HVKA 2JIZD 2C2EA 3PIRA 4WVFA 4DMFA 3GLGB 1Y8ZA 1UJMA 5GIOE 3OFSA 1E77A 2GM4A 3A3PA 4OBBA 2FRDA 3I6IA 3RVOA 2V7WA 3MGBA 3GLKA 2NVXA 1T0UA 3PUZA 1PQYA 3KB1A 4I1RA 4ER3A 5CBKA 4DEVA 1U3DA 2ZJYA 2C5AA 3RC1A 5I7HA 1KO8A 1I94H 2JLSA 3A0UA 4R9NA 4XRRA 5E0OA 3JQ8B 4WCFB 2E82A 1TXGA 1R4AA 4LYAA 4L0QA 2WU4A 2VDRB 1JNXX 5CCXA 3DAOA 4FFVA 2BQUA 5T4EA 1NVKA 2W2PA 3S29A 4OJYA 5DM2A 1T10A 3NVAA 4B8ZA 2J4CA 1XMPA 4YQYA 3OTGA 4KPEC 2ZROA 5AYYA 3PXXA 4YP6A 1PHPA 2C42A 4MSUA 5CJ2A 5AVQA 1CV2A 3S0JA 1W4BA 4IMPA 1I6WA 3LP6A 2C83A 4C7BA 3QJGA 1R9MA 3T5KA 3TPCA 3DNPA 3NB0A 4EWLA 4BUZA 4MR7B 4BAGA 4HDRA 3R75A 3UFXB 1PQUA 2BFDA 3WIBA 2YVQA 3CKLA 4LJ4A 3A14A 3NS7A 2RHBA 5KU1A 3LC2O 2B2NA 3AESB 3N2LA 2SHKA 3KT0A 4F3RA 2FXIA 2A0YA 3AP2A 2V9PA 2JKZA 3S28A 1KY5A 2RE8A 3I2JA 4L5JA 1T8TA 5ALKA 1VIDA 1NOIA 1QHYA 4E46A 2P11A 2B1GA 1ESEA 3NTVA 3SBDA 4AXBA 6GPBA 3LQ2A 4MQEB 1GZVA 3KSAC 4DDMA 3QWIA 4GA4A 3MMZA 5P8WA 4FE3A 2XC9A 1T1EA 1B23P 4FJ1A 1ZICA 5ISMA 1KBLA 1CQIB 1WCYA 3ZDYB 4JITA 1M2GA 3MFQA 3VR2D 2QTVB 2P8SA 3WWOA 4PBSA 2RI0A 4QJ5A 5AVTA 1JG2A 1Y5IA 1IRIA 5IH7A 4YPVA 2P30A 1KJJA 4A3BG 2P41A 2IXFA 1QBKC 2JLWA 3W3AH 1CWUA 2PMFA 4X60A 1PQPA 4BO9A 3F46A 1Q77A 1Y5LA 1E0JA 5CHEA 2B78A 3EISA 2AK3A 3QUAA 5ITSA 3SJBA 2RFLA 1NR7A 1SG0A 1E3EA 4YJ3B 1RQ7A 3AC0A 3IKVA 4Z53A 2JBMA 4PYNA 3SDZA 4JUIA 4D3SA 4F60A 1WSWA 4G1VA 3IP8A 2X14A 4WL0A 1SB8A 2H1CA 1ODCA 1L7NA 1Z5NA 3G5MA 1I4LD 2R6AA 2PUCA 3WDSA 1U0LA 1VB5A 2Q5LA 1P4SA 4BWGA 3TLKA 5GAGN 3EH2A 1BD4A 4F4FA 4B3TH 3FCOA 3ZXXA 1PNQA 1ZISA 3VISA 1QIGA 3OFND 2JS7A 2YINC 1K97A 2WRZA 4MV8A 3V6JA 3F6YA 2OXCA 2OYCA 1KWKA 5KOHB 1D8AA 1D4OA 2NXEA 2CHFA 2OQVA 5FKJA 5CYOA 4RPJA 2OCYC 3ZN2A 1CY2A 3EF0A 2DU8A 3ANNA 3BBLA 3EXEB 4GFDA 5KWEA 1GZDA 2EXXA 2JG3A 5KWSA 2ZIAA 1KO5A 3WGJA 3DE4X 4B31A 2FDRA 3N5CA 3KZXA 3TIXB 1SG9A 3EGDB 3GQBA 3NTUA 2DQZA 1BDMA 1E7MA 5HTOA 3OCUA 5EE3A 5T8KA 1NVIE 3LQ1A 5CXQA 1TNDA 3K2IA 1DQSA 3F8TA 3M49A 3R3JA 3C2OA 4RO0A 4GT1A 1P1FA 4M3NA 5JMOA 4DDHA 4LJ5A 5EY3A 1E3QA 4GPIB 3AFMA 1GPH1 1Q0UA 1GGVA 1I9CA 3ZEIA 4Z8XA 1CUGA 1JI3A 4F4DA 3FVRA 3F4BA 4IUCS 4PPYA 1A4XA 5BYBA 5A0VA 3MERA 2PXAA 3GY0A 3PEUA 4LA4A 4BXOA 3B78A 3IAEA 2PEZA 4J6EA 4HAWA 1JKIA 2NUTA 1VL8A 1AO3A 1P1RA 5AVJA 1X9HA 5FFNA 5TRTA 1DG3A 4O3FA 3SX4A 1MB0A 2D4HA 4XI9A 1TRHA 1KI6B 4FB5A 2DUMA 5DK6A 4B3JA 4DCTA 3FPGA 4X93A 5C1IA 4FYMA 2LCFA 4ZCMA 1PT5A 5IC6A 4O7ZA 5JXGA 5FOSA 5KNDH 1EFTA 2OGUA 3Q7IA 2ROQA 2HY7A 3W2HA 3WGQA 1FJGB 3E9ZA 2L17A 3EC2A 1KE1A 4B6QA 4ZQFA 1DMSA 3SVTA 3KYIB 3MMPA 3RYHA 1PL0A 3RHFA 1EFRA 2YJTD 4ZFNA 1V8FA 5A2QA 3ZHBA 2XQJA