3WNZA

Crystal structure of bacillus subtilis ywfe, an l-amino acid ligase, with bound adp-mg-pi
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
465
structure length
465
Chain Sequence
KTVLVIADLGGCPPHMFYKSAAEKYNLVSFIPRPFAITASHAALIEKYSVAVIKDKDYFKSLADFEHPDSIYWAHEDHNKPEEEVVEQIVKVAEMFGADAITTNNELFIAPMAKACERLGLRGAGVQAAENARDKNKMRDAFNKAGVKSIKNKRVTTLEDFRAALEEIGTPLILKPTYLASSIGVTLITDTETAEDEFNRVNDYLKSINVPKAVTFEAPFIAEEFLQGEYGDWYQTEGYSDYISIEGIMADGEYFPIAIHDKTPQIGFTETSHITPSILDEEAKKKIVEAAKKANEGLGLQNCATHTEIKLMKNREPGLIESAARFAGWNMIPNIKKVFGLDMAQLLLDVLCFGKDADLPDGLLDQEPYYVADCHLYPQHFKQNGQIPETAEDLVIEAIDIPDGLLKGDTEIVSFSAAAPGTSVDLTLFEAFNSIAAFELKGSNSQDVAESIRQIQQHAKLTAKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanine-anticapsin ligase BacD
publication title Single Mutation Alters the Substrate Specificity of l-Amino Acid Ligase
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Ligase
total genus 142
structure length 465
sequence length 465
ec nomenclature ec 6.3.2.49: L-alanine--L-anticapsin ligase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13535 ATP-grasp_4 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3wnzA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3wnzA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wnzA01
3.90.1170.60 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Aldehyde Oxidoreductase; domain 3 3wnzA04
1CQIB 4EGQA 3RFCA 2X0SA 3R9RA 5LYJF 2NU6B 5JQGF 3AX6A 4EA8A 2W6ZA 5HBRB 1E4EA 4EG0A 3TW6A 5C8YF 4FFMA 3V4SA 5JVLA 4HNTA 1GLVA 4MV4A 1M6VA 3NUAA 3TINA 4E4TA 3I12A 4O84A 2W70A 4L1KA 4IWYA 1KJQA 2W71A 3R5XA 3ORRA 5JH7F 3TIIA 1W96A 4XX0B 2CNQA 3BG5A 3VPBA 2P0AA 3N8DA 3VPCA 4I55F 3RV3A 5C1PA 4MV1A 2VHEA 4MV9A 4O7ZA 4O4LF 4ME6A 1M0WA 1W93A 4C5CA 1ULZA 5BPHA 4FU0A 1C30A 2CZGA 2PVPA 1GSHA 2V58A 3E5NA 3TIGA 4TUYF 1SCUB 4FFPA 5EZYF 2R6FA 1B6SA 3JZFA 1CE8A 2DIKA 1Z2NX 2R7KA 1CS0A 5CA1F 1KBLA 1DV2A 4GGMX 1JDEA 2R82A 4FFLA 3WO1A 2GPWA 4DIMA 3KREA 4O7WA 1JDBB 4ZI7F 3V4ZA 4HNVA 5I47A 3TQTA 4I4TF 4FGRA 1GSAA 2ZDQA 4O7SA 1JLLB 3JRWA 4EGJA 4O2AF 2YRWA 4FE2A 4XZ3B 1WR2A 2QK4A 1Z2OX 2FPPB 2WYOA 2YZGA 4RZQA 4MV6A 4O7NA 1EZ1A 1KUTA 4YBZB 2PN1A 5H80A 4EA7A 1EHIA 2YZLA 2YZMA 2VR1A 2YW2A 2CNVA 1EUCB 1UC9A 4O83A 2R86A 4O7RA 3LWBA 4EABA 2R7NA 3LP8A 3U55A 1KC7A 2FPGB 2GQRA 5K2MA 5LP6F 2I8CA 1OBGA 2CNUA 3MWDA 4YAKB 2YWVA 2XD4A 3KAKA 3GLKA 2YL2A 1EYZA 3HBLA 2XCLA 1A48A 3ETHA 3KAJA 4FFOA 4O4HF 3K5IA 5HV6A 5JVDF 1GGOA 4O7YA 1BNCA 2NUAB 2IP4A 1T36A 1VKZA 4MV7A 3BSSA 4O81A 4YJ2F 1M0TA 1AUVA 1I7NA 3BFPA 3R23A 4XYMB 5DMXA 1KEEA 3AW8A 1KJJA 2SCUB 4MV8A 2I80A 2FPIB 4C5AA 1B6RA 5D8DA 1DV1A 2DLNA 4DLKA 5FNVF 3KALA 3RUPA 3K3PA 2PBZA 2YYAA 4XYLB 2NU7B 1PX2A 1DIKA 2CQYA 2OLSA 3VMMA 4O4IF 1CQJB 1PK8A 1E4EB 3JRXA 4I50F 3R5FA 2HJWA 2DWCA 4O7TA 4YJ3F 4M9CA 2J9GA 3OUZA 2Z02A 4FFNA 3MWEA 2FB9A 2R87A 3WO0A 3G8DA 1A9XA 2FP4B 2W6MA 3U9TA 2HGSA 4O2BF 5KKNB 3HO8A 4O82A 3MJFA 5IYZF 1KJ9A 2W6PA 2YRXA 4ZHQF 2W6OA 3BSWA 3VOTA 4IZOA 4M9UA 4O7LA 4ZOLF 2YS6A 4IHJF 1GSOA 4HR7A 4MA5A 3G8CA 3RV4A 2R85A 2W6NA 3ORQA 1Z2PX 4MA0A 5CA0F 4MAMA 5GONF 5LA6F 3Q1KA 2NU9B 4EA9A 1IOWA 2C00A 5J2TF 4J6EA 4EAAA 4O86A 3SE7A 4TV9F 5CB4F 2GLTA 5LOVF 2VQDA 2GQSA 3VA7A 5JQWA 4ZQIA 1IOVA 4Y8VB 1JKJB 1KJIA 2I87A 3DF7A 2R84A 4YB8B 1I7LA 4HQ6A 3WNZA 4O7VA 5J2UF 2V59A 2YS7A 2VPQA 4HNUA 2V5AA 1UC8A 3GIDA 4TV8F 3U9SA 5BPFA 2Z04A 3R5HA 1AUXA 4WBNF 2R7MA 4MV3A 1EUDB 2ZDGA 1VBHA 5CAEB 1C3OA 2YZNA 5C1OA 5KX5F 3JZIA 1OBDA 4M99A 3K5HA 2W6QA 1VBGA 3UFXB 3VPDA 4FFRA 4IIJF 4WD3A 4M98A 3ETJA 4NYEA 3N6RA 3U54A 2QF7A 2NPOA 2R7LA 4YAJB 2NU8B 1BXRA 3BSYA 5LXTF 3QFFA 4C5BA 3OUUA 4O4JF 4IWXA 3HB9A 2ZDHA 2GPSA 2DZDA 1KJ8A 4QSHA 5BMVF 3Q2OA
chains in the Genus database with same CATH superfamily
2O2SA 4ZHQA 5KTRA 2FK3A 4GX2A 4QBFA 3EEOA 4IM7A 4MPJA 4Z1MD 4MDEA 8MHTA 1I51A 2Q5LA 1MFPA 3OMLA 2XNDD 1ONNA 2V7EA 3CZ4A 3UWOA 3JQ8B 1FBNA 7ABPA 4F86A 3SC6A 4O0MA 5EE3A 3WGKA 5B4TA 2IYOA 4ZAWA 4MVJF 2IW1A 2VUMA 1MVOA 2Y1KA 5KQLA 3AVVA 2W4IA 2QT0A 4NIMA 4I5IA 1NA5A 3I9V1 1CY6A 4OL9A 1QTIA 1TM3E 5J1SB 3AG5A 3R7FA 1SCUB 1VYUA 1T29A 1R3UA 3IP1A 1F0NA 1Z37A 2ZSAA 4GAEA 13PKA 3MLEA 2QMZA 4K6KA 2PZBA 2B4KA 1M2NA 4D0GA 1IUKA 3PDWA 3FKSA 1IUPA 4MVJG 3TD6A 3V2UA 3ZOKA 4U2CA 4ZDKA 4TPKA 4CEIB 2E3TA 1UEJA 3AKYA 3L6CA 1P31A 4OOEA 2QTLA 1C80A 1E6WA 4KRYA 3IOYA 4U7PB 3D7RA 2YRWA 2AC7A 5DB4A 3F6SA 1NW8A 2Q2WA 5T41A 2CVZA 4N5NA 3VC2A 3WWEA 3V4VB 2EJBA 5LZ8A 4MUIA 4P82A 2OBYA 3BL6A 4I0WB 4GFDA 2QVXX 4WE3A 3RHSA 2H1LA 1U2SA 2FN4A 4CUZA 4O7RA 4QPPA 5LQRA 3LWBA 3ZY4A 1KXJA 4NJMA 5CITA 5EZSA 4IF4A 1Y81A 2DQKA 2NM0A 2PX5A 2QDKA 4NBVA 2DUNA 4WBXC 1K4MA 4LJ9A 1RSZA 4BV2A 2V98A 2JZCA 4AKEA 3BH0A 1BNCA 4C78A 1ONPA 4X3CA 3BVPA 2ECPA 4L5CA 2XCAA 4V1CA 5KG2A 3I72A 1OZHA 3OZFA 1TIKA 2B2CA 3QVOA 1IN7A 4PLGA 3NFRA 3K32A 3SVZA 1Z13A 3TOVA 3GUUA 1SNYA 2UU9H 3VU3A 3TAUA 1VA4A 1D8TA 2AFHE 1E2MA 1PLLA 2OLSA 4F72A 1VHWA 5JFTA 2QTMA 3LC2O 2W6ID 1VIYA 4DZRA 3IV6A 3M6MD 3FBTA 3HYTA 1GRNA 3BJZA 2CCKA 4E7PA 1EU1A 4O4IA 4LF6H 4RK1A 3DWFA 5FI1B 4H7DA 3LCCA 4BBJA 2CXNA 3FCXA 3G1TA 3R76A 3IMCA 4NZZA 4YJHB 4GYKA 2YHUA 4FZJA 2AXEA 3OX4A 4CW7A 3VUFA 4C1NA 2Y0BA 3F3SA 3NBUA 2K2QB 3U5ZB 5MFZA 3OJ0A 2P3SA 2ZUDA 4G1FA 2NO7A 2ZI9A 4RFVA 3NU1A 3C3AA 4Q9LA 4OJYA 3P94A 1WZUA 4HO1X 4UVEA 1T9GR 1Z36A 1MORA 3U7EB 1RM4A 1D2AA 3HY3A 2MCFA 5C4XG 2XVAA 4NG4A 5HKLA 1MQ8B 5HIMA 5HUOA 5HF6A 4F5EA 1SVIA 4OP2A 3CH6A 1BO6A 1II8B 1U3DA 3HG7A 2PJRA 5JMPA 5IT9A 1P1CA 4FDLA 1VZ3A 4J43A 1J42A 3BN3A 2Z04A 2BQ3A 2EL7A 5ARCA 3H3FA 3DHNA 3WIVA 2BN4A 2GR9A 4BWGA 2ZB2A 2MSNA 2VA9A 1ENZA 4B87A 1CUZA 3RO7A 4ANFA 3N2IA 1KSHA 3EDOA 1CKNA 2CLHB 5FHRA 3IKMB 5F2KA 1T4BA 4URXR 4I08A 1YIOA 2O8VA 3WKBA 5ALMA 1RI4A 2R60A 3QFFA 4ECTA 2BKEA 1ISIA 1ZINA 1XTBA 2BGJA 1L9XA 4F0JA 5K6AC 5K5EA 1X3LA 4EZBA 4DC0A 3MFYA 3MELA 3X1JA 4XQGA 1NNUA 2ESRA 3COPA 5BSWA 3KZKA 1EJ6A 1Z6YA 4B73A 3BTUA 3EVFA 4WLNA 3ASYA 5KFAA 5IP9G 3EFOA 2GVZC 2VH2A 1LJLA 2BW0A 4J7CA 4K9RA 3VR4A 2B1IA 2FGJA 1WSBA 2IELA 3VVCA 1NXOA 4E70A 2WQ7A 2X5RA 3A3YA 3TNDA 3R75A 2BM9A 3U3DA 2K4MA 4KQ6A 1M2VA 4EW3A 1XL1A 1FDWA 1E7RA 3F6BX 5AM4A 8AT1A 3GJ5A 4CKWB 1T6XA 1FKAH 1LU9A 3A8TA 3H99A 3IR7A 3GELA 3HR7A 2D6FA 1TVEA 2GA9A 4EY3A 2MHCA 3CR3C 5TQ0A 3SR6C 1P5HA 3GFBA 5LZ4A 1TUBB 4BVJA 1EX7A 4PE5B 2F3TA 3D64A 4PSDA 3KZOA 1H3NA 1U3WA 3O1JC 3T7AA 3MGBA 1QPBA 1Y1WA 1TZKA 3OM1A 3SSOA 3VH4A 5T4FA 1ZI9A 4J0JA 2B21A 5HKKA 4BZWA 5FPKA 1MRSA 4RHUA 2M32A 4TMWA 3DS8A 3INNA 4P4GA 5IDWA 1H6AA 1OF1A 4M4SA 2VR1A 3NGXA 4OFBA 2PRYA 1JQEA 1HR0B 2HDWA 3UFXA 5GAJA 3G0DA 5DCUA 5SYNA 5CFRA 2Y1FA 1PNOA 4Q45A 2HU8A 5E1BA 3MQ4A 2BR3A 2EBUA 5BOSA 1IZ9A 1SM4A 4RVDA 3ZCPA 3DBVO 5ARBA 2G9ZA 3LPCA 2W93A 4MQ5A 5DULA 1ZNXA 5IC4A 3WY9A 5KQRA 3PNSA 1L7DA 3HI4A 4N6GA 5EKDA 3G0GA 3PXUA 1ZJZA 3HYSA 5F78A 3M5DA 3OZBA 2GETA 2DH6A 3I4LA 2IA5A 3VPAA 4KE9A 2VP9A 4EIWA 1N5OX 1NVDA 2JD2A 2QPAA 4JL5A 4TXMA 1U8XX 1KMHB 1MX3A 2AGOA 2FUCA 1L3CA 3O7WA 1G3IA 3B1JA 5FUMA 2W4QA 4WCFB 5AKJA 2J5RA 2HBRA 2XUGA 2Q50A 4DMFA 1NAIA 4JXXA 2OQRA 2C2DA 5AJVB 4CMIB 4XWOA 4YAIA 2FQXA 1SCUA 5LU9A 4ESHA 1BS2A 5KNCH 1XEWY 4YY3B 1XRPA 1ETHA 2OBLA 4N3BA 3VO8A 1QUEA 2Y93A 1FC0A 3BOSA 4HUJA 4ENRA 3D7NA 4CEIA 1VFNA 5DNAA 3Q7EA 4FKBA 5CYGA 1QGYA 5E3IA 3EB9A 3QVJA 5FORA 3DP7A 1ZMTA 2FXIA 3AC0A 2OCGA 4K5QA 3DE7X 5IBRA 2VK1A 1LDNA 1HYQA 2V9WA 3R6DA 2Q8NA 4BAUA 2P41A 2VXCA 4ZVOA 1SIUA 2QTNA 2F55A 2BM8A 3L9WA 3HXKA 5IARA 1NF9A 2XMPA 4QICA 5COAA 4XQEA 5FA6A 4LJSA 2WHQA 3EPGA 4NMWA 5TEVA 5KUTA 3WV5A 1BGWA 3U54A 4HFNA 1MQSA 4BNTA 1Z18A 4FDTA 5E4TA 5LXTF 2V5UA 2QQ5A 1XCGB 2A9PA 5HIJA 4F46A 3C3YA 3QF4B 4RDCA 1YITH 3L8GA 2LR0A 1NUUA 3C87A 4NFYA 4B85A 1AX9A 2NPIA 1D4AA 5C5CA 1N3YA 2QN3A 2V6MA 1FSZA 3RGWS 2IIVA 5SZIA 2X0RA 4DWJA 1ZXIB 3BERA 4M38A 3GLSA 1I2CA 4QIWE 3ESQA 3JQCA 2YWEA 3UG6A 4OI2A 2Q2TA 4ZV9A 3IURA 3GLHB 3W6UA 4BLOA 3G49A 1XPOA 3WL8A 3KAQA 1FP7A 2PAAA 2Q7XA 4DAOA 1RKQA 4PYLA 5JZBA 4ZO6A 2VHQA 3VUEA 4YJHA 4DIOA 3ELWA 1VYTA 4FUQA 3PDUA 4D8VA 5ICFA 1PGOA 1WU7A 3QYAA 3C39A 1M0EA 4BKRA 4JT2A 5LQUA 2KW5A 1XD8A 1XVLA 1KEKA 3CCRH 3ZDXB 3DV2A 3HWRA 2HA6A 3AJDA 1H4TA 2HHCA 4F3RA 4LF4H 2GZ3A 5TJ9A 1Z4MA 4KAAA 1RKUA 4JC4A 2QJWA 5D86A 5DCWA 2HUNA 2NO0A 4LJ7A 2WM2A 1VJ5A 4E51A 2YFQA 1II8A 4A03A 4EHDA 2H52A 4YS6A 4G56A 5GINE 2V9CA 2CFSA 1MAWA 3NHUA 2VF4X 2WFZA 2O8EA 2JW5A 4ND5A 1IFXA 3H40A 1D7OA 1WS6A 5L40A 1Z0AA 2VEDA 3LQKA 3UJCA 3QIVA 3ZN2A 2V3WA 1O8BA 1E1CB 2FDRA 1S2DA 4F9EA 3E7DA 4DSUA 5CM8B 4BZXA 4N18A 4QPZA 1FDRA 1GU7A 1UC5B 5IF3A 4JCCA 5JS6A 3A6JA 2EATA 3U19A 1IOLA 1VKHA 1L5QA 2X23A 1J9ZA 2BMJA 3ZDCA 3JAWB 1IYZA 4MV7A 3OEHD 1P0MA 1P6UA 1DHTA 3E27A 4HTFB 1I14A 1D2NA 2F90A 4OLHA 1TZBA 3FZQA 3RAJA 3EUAA 4MRNA 4DB4A 2A6PA 3I58A 3NTOA 4KE8A 2HVRA 2LZ0A 1VJTA 2Z95A 4B4UA 4CTNA 4CV2A 3PCTA 1UQUA 4RPCA 3BJIC 1QOZA 5IEBA 3KXKA 4D56A 1LDEA 2JD0A 4GE0A 2WSLA 1ADJA 1ND6A 5DGAA 4UAGA 2B1QA 4ZZ3A 2O50A 1V7CA 4A3FG 3FAKA 3D4NA 4LQCA 1T6ZA 4CKWA 2EW1A 1SKBA 1G2IA 4DLUA 2A58A 1JHXA 4DRXB 3HR4A 3BPSA 2HJRA 4EO4A 2WK5A 4ES6A 4JV5B 3U81A 2Q21A 3AHHA 4W5WA 4D43A 2WTUA 4C3ZA 1TUBA 3DMGA 1QIKA 3L4EA 4HYEA 2B0JA 2LV8A 1H0KA 1QFZA 2NSLA 3SE7A 3HLKA 1H4QA 1OXKB 2BH2A 1LSJA 4FEYA 3WDKA 4BP1A 4RVSA 5B58T 4MUGA 2Z5LA 2CNWD 1BFKA 2I87A 1Z25A 2R84A 3PHGA 3AMZA 3ACDA 4CU2A 3CPWH 2PA2A 4TLLB 5FEUA 4F9FA 3EGEA 1QHHB 4FMDF 3G9UA 4CIBA 3KOUA 2I2CA 1GR1A 1QS0A 5IHXA 4JJGA 4UJ3A 3OOSA 5DTJA 4ZN6A 3AF4A 5K0SA 1RM5A 3LECA 1P5JA 4UEQA 5AW4A 3HBNA 1RHJA 3FNQA 4IWNA 3I64A 2CMHA 1U2PA 2YFHA 3H8SA 4WNIA 4BNIA 1L4NA 3ZVNA 3OE7D 3WWIA 3IQIX 4E11A 3RADC 2JBWA 3MWGA 4NPHA 2N3ZA 5J47A 3RIZA 4MLCA 4K88A 3OJCA 2HF2A 3CEAA 2BFBB 3PP8A 1QYXA 4R1TA 3R7BA 1LPOA 3DE4X 1LS1A 4C7JA 1SFRA 2ZFUA 2PA0A 2D1RA 4PG4A 1UADA 4F9GA 3V7FA 2QT1A 5E0OA 1ZGBA 3L0BA 4RMIA 5FJJA 3EOZA 1AD2A 1XIVA 1L7EA 5HUJA 1KMHA 5B3AA 4Z0PA 2PANA 3JATB 2O48X 3LP6A 4WCFA 1GLVA 2FGKA 3OOWA 3AY0A 5KFXA 3C3KA 1O97D 4ZVLA 4AY5A 1U31A 3U39A 1DAKA 3TZHA 2AFVA 4C6SA 3DR3A 5T7BA 3EPLA 4H6VA 1Z7YA 1G8AA 1KC1A 4BNZA 4CMIA 1YRBA 2Z09A 4XLTA 1JI0A 3EA0A 1RTKA 2RE8A 1YRHA 4TYQA 1M0WA 1M73E 2D1YA 4FC7A 5DEOA 4DCCA 4BTLA 1VHQA 4NOLA 3WX0A 2P3LA 4CUJA 4EY7A 2OXCA 4PICA 4B45A 3T5KA 5BSUA 4RL4A 2DKOA 3KETA 1UWCA 1YIJH 2PUTA 1D0VA 3ZBTA 3COYA 2ZRJA 2FE1A 1IQUA 2EQ5A 1DBWA 2EX4A 2BEJA 1IHPA 3WLKX 1PEDA 4QJ3A 1DXYA 5KYWB 5CVVA 1YS1X 2JK0A 2WI8A 4MYCA 1RU3A 4WOPA 3CYFA 3STYA 2Q1UA 1H2BA 3CRMA 4HUQB 3ORFA 2E6KA 2JIOA 3BWVA 4KIUA 3L77A 1JAHA 3EYYA 1ZEMA 1KZ6A 4G9EA 4QYTA 2APJA 1KC8J 4U2DA 1U94A 2VDMB 1RLUA 4B2YA 1DP4A 3A1SA 2Z4TA 3PC8A 2H31A 3Q3VA 2BOVA 1H2RS 1H6BA 4UREA 4RULA 3FUUA 4BNLA 1OI2A 4WZ6A 3ZHUA 3FDIA 3GNTA 4OXIA 2RI1A 1UJ2A 3DUFB 1LLDA 1RVDA 2DFVA 4ZK2A 5I4KA 4F1JA 1Z4JA 2VDVE 4HS9A 1PNTA 1UBUS 1M0TA 3PW5A 4YV7A 4C7YA 4LWZA 1E5LA 1TQ4A 3WMXA 2GO1A 3WLIA 2OCKA 3F6YA 3LT0A 2Q2VA 4BB6A 1UKVY 3DCYA 1KD1J 4N47A 3M3PA 3MWKA 1WM1A 3GLHA 2NU7B 2K5UA 2MR6A 1SCAA 4IG9A 3W9BA 2FP3A 4QNRA 4OBXA 4NECA 4YHHH 1I7DA 1CIPA 3R0QA 1E59A 4WZBE 4CMGA 2OD2A 3V33A 1MX9A 3Q72A 3OSZA 1ZPDA 1AXRA 3ZHVA 3KB6A 2XTJA 3AB3A 4GW3A 4G4IA 3F8TA 4U3JA 2O8CA 1JXAA 4G5SA 5JT1A 2QWXA 1VIMA 2YWGA 1ZONA 4PAOA 3RYFA 4J0FA 5U4QA 1VRWA 1SA0B 1JIXA 4HQ0A 5GP1A 4ALLA 2FW7A 4MRRA 3LWDA 1DRKA 3G0OA 4HEQA 1JG3A 2HWXA 4DVGA 3KL4A 4YP1A 4WCVA 1R64A 1TTHA 4PLFA 1Z8DA 4XCVA 3VA7A 1OAKA 5ICMA 5THKA 1PS9A 3AEKB 4C3VA 2HXSA 3GTKA 4HPXB 4XD7A 4UHFA 5CTAA 4U02A 2ZVDA 4ZOEA 2VWQA 2R2AA 1O89A 3U7RA 1Y4AE 3CCFA 3EULA 5CDFA 1IBKH 2AXPA 1KRHA 2YVUA 2I03A 2HQ1A 3W79A 3ADDA 3TO5A 1E1CA 1G8YA 2IH5A 1IEWA 2J3DA 3CISA 2C4KA 3ROZA 3IC5A 4MB0A 5B1DA 3M9MB 4ED7A 1FFYA 1XF1A 4JR2A 3DPSA 1DG3A 3AZPA 3D3NA 2JI8A 3SEFA 3ZD9A 3NBKA 2W6QA 2VEOA 1E6CA 1ZRSA 2QRUA 4WOKA 2TS1A 2BL4A 3BQ0A 1ADFA 5G1PA 1AGYA 3NNSA 3G0IA 3JAWA 1F6DA 4ECWA 2V4QA 4JLUA 3RPEA 1VXOA 4F4ZA 1JHDA 3EXG2 2DZDA 5J5CA 4HV4A 1GUBA 4IGKA 3HDTA 3ANNA 3WMWA 4MKZA 4S05A 2X0KA 2D2IA 4HY3A 4ZZ0A 2WWHA 4FUTA 1P1BA 1ML3A 4NMHA 1U3UA 2BR0A 4F9TA 4AZ3A 4KKVA 2ZOSA 4B0PA 1JEDA 2WF9A 2J6UA 4Y2HA 3AP3A 3KUKA 2RONA 1JIJA 4GLFA 3AXSA 1Z15A 2DSTA 4XIJA 3B6IA 3EVAA 4ZYXA 3OZCA 3IP5A 4DNFA 1XHFA 3K1TA 3GHYA 1U9IC 2WLSA 2DABA 1ZQ1A 2X41A 1SQSA 4DLPA 4FILA 4B75A 1IE3A 4HNQA 2QIOA 4OU4A 1GAXA 1Z4QA 3MFHA 4R5MA 3TSWA 3ZWQA 5LUAA 2WA1A 1M6NA 3E0QA 3GVHA 4ND1A 2IU0A 3NWOA 1PJZA 1E1DA 1EIWA 4Y1RB 5C44G 4W9MC 4J9KA 1ZM7A 2XNSA 2J45A 2JIZA 1O57A 4WVLA 1QHHA 5EXDA 3I6MA 3IQDB 2NP7A 3L0IB 4NE7A 1AIPA 2O8DB 2IBMA 2BGTA 5GONB 4EYIB 3DAFA 5I7OA 4WAUA 1JIIA 1IXSB 1XTPA 3IB3A 3NHBA 4E07A 4XM1A 1COWD 3OH8A 1PTJC 1J09A 2YWXA 4O4HB 3UWMA 3BTOA 1U0OC 2Z5FA 2OGSA 3I2HA 4NYIR 2R1ZA 2VDWA 4IDEA 3PQFA 2YTZA 2IYUA 1EE2A 3R0IA 4BBPA 3CEBA 2PU5A 1PJBA 3R2JA 3H3JA 3EIOA 3FDXA 4NBWA 3HVIA 2E2HA 5CCDA 3UMRA 3VTFA 5JD3A 5JU6A 4JWKA 3KTMA 3O2NA 2V0NA 3FUCA 4QD3A 1D1QA 1YOBA 2BFBA 4PLHA 4HFMA 1FFDA 3AVOA 2Z83A 5ITSA 2PQMA 1O2DA 1TEXA 1ZVKA 1EA7A 1UFRA 1CF2O 4K05A 5BSFA 1YI0A 1QR6A 1WKCA 4LCEA 3EMKA 3IKJA 5GM1A 3P45A 5KEIA 4Q4DA 2OAP1 3KEOA 3JATA 1T34A 2BY4A 1Y1LA 3VPXA 3VZDA 5JAHA 4XYLB 2IHKA 4W5JA 1KMNA 1FF9A 3I5MA 4JVLA 1A9QA 2WHYA 1H6CA 4IDCA 1DMRA 4BMPB 1EFKA 3WBKA 1KZ4A 4RGVA 4I4NA 4O2BF 2R92G 1N6NA 3L8ZA 5U9CA 3WBJA 2O7SA 3HCEA 4PCUA 4S1OA 3BK7A 2N9UA 2OL4A 4PPFA 2FVXA 4L8VA 3GZNB 2IQIA 3U0BA 4J7UA 3WWZA 2JA8G 3RV4A 5KYUA 2QJOA 4RPLA 3AG6A 5HF8A 2L2QA 2CLKB 1BXKA 4M86A 1T4MA 1CXZA 2P35A 2GILA 1KORA 2BGGA 3KSAC 4M7OA 3HFGA 4X62H 2BF7A 1Y6FA 4HFJA 5KYWA 4W7IA 1RWWA 3L4BC 1XYGA 3FHCB 3WYNA 1MD9A 2OXFA 3NUGA 4O2RA 2IYWA 1VBKA 2XITA 3QU7A 1LA2A 1J9EA 3SOPA 1QZTA 1P4JA 2ZYHA 4FFWA 4WKPA 1VQ1A 4WZAE 3KB8A 4NL4H 2WRZA 2ZYDA 1OFHA 2FUNB 3UMFA 5CNJA 2HCRA 2GEFA 1EE1A 4JT9A 2YHIB 4P34A 1DPFA 4Q0YA 1QHNA 1EUDB 2H7VA 4FE3A 4S1PA 2CFCA 1VHJA 2PRIA 1AV6A 1ICIA 1E2IA 1Y34E 3D4OA 3V7WA 4A23A 4KFRA 3PVSA 4R0VA 3QPAA 3DUFA 3I30X 2IPOA 1MEEA 3MB8A 3B1ZA 4N65A 2P69A 1DIRA 4XUEA 3AF0A 2HGZA 3KAPA 3AY7A 4OHPA 2R8EA 4WERA 4YR7A 3HEAA 1M6EX 1RMYA 4RKFA 2AJTA 5CYOA 2ZUCA 1KJ8A 5BMVF 3GJXB 5LDGA 3GV8B 1QO0A 3UGKA 2YC4C 4NAHA 4R98A 3EGXB 3RLFA 5AHKA 2PMZE 3W3AH 1J1IA 3WHPA 4CQMD 3I4NG 2HZBA 2NU7A 3WL4A 2PWYA 1LRJA 4MVJE 5BNZA 1EK5A 4BNUA 2IV3A 3EN0A 5AKXA 2PX4A 2XGJA 2AYXA 1VQ4H 4HLUC 3HLYA 3IAXA 2Y1CA 1DWPA 4TRMA 4HGOA 1QZZA 3UNXA 5BN1A 3LGSA 2HMWA 2VHEA 2GD0A 2YXPX 3TE6A 3WYGA 3W8DA 4ME6A 1FP2A 1ULHA 2GEDA 1CFJA 3GRVA 4IOJA 1QKKA 1U2QA 3BB1A 3ZLVA 1SA0A 3E1SA 3QLVA 4Q3AA 3HB0A 5BWBA 1KYQA 1V7ZA 5LZ2A 4WASA 3ULKA 4YNBA 1JFVA 4F4CA 4UBIA 3QMMA 3FWNA 2PSHA 2DWUA 3PUYA 2CLSA 3DEZA 4BNVA 3AEKA 1CHNA 1RWVA 3WYBA 5EWMB 3VNRA 1ZP6A 3N2LA 1CDEA 1T0JB 4PZPA 5DYTA 4YAWA 3C74A 3LCVB 4R31A 1W52X 4DWVA 1Y6JA 3MGKA 5KNCA 3AUYA 4QTXA 3TECE 2W37A 2O6HA 3WQRA 1Q1EA 4ZYVA 4ND7A 2PGIA 3IHKA 1W49A 4UHHA 1WPGA 4D79A 4AKIA 1XMIA 3PK0A 3JXEA 1JW9B 2NTYC 2DPHA 3BA8A 3NHZA 3GNQA 1Y3BE 4OHZA 4DCOA 1JJAA 3LFHA 1W5FA 4M1KA 2QD4A 2XD4A 1R37A 3IR6A 5EXPA 2LW7A 3BWBA 3DXFA 4ZTBA 4UU8A 1CDZA 3UZBA 2PJDA 2R751 1L5SA 5JVDF 4DNPA 1BXRB 5FA5A 3RAPR 4GVXA 3HRHA 3J81W 2CXPA 1A50B 4B3XA 2VUMG 2FPIB 1E2UA 4MUAA 3TLGB 3G1WA 5FLXW 3T7RA 5EJGA 4GZMA 3IIMA 2XYQA 5TGZA 1HE3A 5A4DA 1SRRA 1VDVA 4E1AA 1AQ6A 2QPTA 2GHTA 1T2NA 1Y6RA 3JRXA 2I5PO 4PZCA 4X8OA 3BIJA 4JXUA 5L1LA 2J0SA 3ZDAA 2QHXA 4JB0A 1NG9A 3WO0A 2F67A 2FZ5A 1EAMA 2BUBA 2J3MA 5F3DA 3HO8A 4N41A 1RAHA 3KFLA 4FXPA 4C76A 1ZN9A 3QZUA 2Y1GA 1ZGHA 3P0HA 1L7PA 3RUHA 3EPPA 1NFFA 3HE3A 1COZA 4QU8A 4QQ8A 1ECLA 1FMCA 3SQNA 4AC9A 4PQRA 4FGKA 3ONDA 4YIHA 3OFVA 1MNAA 2VYVD 1NURA 3OUTA 2O59A 4Y1RA 5JDIA 4F6RB 5JSFA 4L6AA 4U7TB 3FMOB 3H4DA 2JRCA 1Y33E 1FRFS 5GONA 1W36D 4YCLA 3AT1A 4MQFB 1BMDA 2Y2VA 3OPYI 3ZUPA 5K8LA 3C8HA 3OZWA 3S2GA 4AS1A 4GMGA 1A9YA 2EYQA 4O4HA 3ZWYA 3GCWA 2OFOA 1X8JA 5I01A 3O5AA 2I66A 3PWKA 2XV1A 1BKDR 1Z2AA 1IOZA 5E9JA 4RD6A 1ETUA 3WA6A 4CKEB 4RDHA 1AN9A 4RUCA 1CNFA 3VZQA 2Q5QA 3FGNA 1XTVA 1W9MA 2JASA 3S2FA 2I7XA 3DOCA 4PSCA 4UNIA 1CR2A 3OJOA 1G7TA 1DNPA 1JX6A 2ZU0C 2GZ1A 3TUIC 1HR0H 5EIFA 4D0RA 3DKRA 3RVSA 3NI2A 4INJA 1KU6A 4EEQA 1NZFA 5JASA 2C9BA 4C5BA 4BX3A 2JLSA 5BUQA 2FR0A 1IBKB 3R7AA 4OX9Y 4DLLA 1RABA 1YJNH 5C35A 2XBUA 3UOGA 3U3KA 3KTAB 1I8TA 3PITA 2Z6AA 3O4RA 1P4GA 5KOIA 3PYXA 1SOAA 4XYLA 5EIBD 4OXYA 3FAHA 1OAOC 4WLFA 3VO2A 3ZWVA 5D3MB 5DN6D 1BJTA 2V7GA 1K5DA 1M5TA 3AZOA 4M37A 5KFDA 1M1NB 5LCXA 3PO2G 3PNBA 1MFZA 4X7RA 3EJWA 2AI2A 3PJGA 3UK6A 5E7JA 2D1QA 1M2HA 2YYYA 3B8EA 4D6PA 4Z7NB 1ULZA 3EXG1 1Q44A 2DBYA 1YASA 3OEED 2DTEA 1DCTA 1TA0A 4EJMA 2GB4A 1I24A 3I53A 4TVOA 2XMQA 2IMWP 4DQKA 3U4QB 1SKAA 3GLFE 3QHQA 2HPHA 4YY3H 4BGVA 3HMQA 4HKTA 4Y6GB 4NE9A 3TIFA 5JSKA 3T4UA 1EX9A 3P9RA 3AXTA 1WLSA 2ZBQA 2V7XA 4AJEA 4P4NA 1WB6A 4DBLE 3VV3A 1XZIA 1EDEA 1W4AA 2WUWE 2YHIA 3ZS8A 1EUDA 3S7TA 4BNDB 4OHCA 2GBCA 1B1AA 4EMSA 4B32A 4U6SA 1AZTA 1NN5A 3BX1A 1LPAB 2X6QA 1F9EA 2VOBA 4IIEA 1O4WA 3V8BA 1OH5A 3I6IA 3DLLJ 4MMXB 1RQPA 3QRWA 3BF8A 3CM0A 1PT6A 2IYTA 1J8DA 4LZLA 1VLMA 1F5SA 1JPUA 1QQBA 5AVVA 2WILA 1B8UA 2QAIA 4R1OA 4AXBA 2D00A 1V1MB 1L6IA 1Y9AA 3EGXA 2EZ4A 2IFTA 4CN9A 1TA9A 1NE2A 3FCYA 5BUCA 5CFLA 2BFMA 1Z7EA 4BBAA 3I5XA 3G9ZA 5JLAA 4CM6A 2VHZA 4Y7CA 1NX9A 4FZVA 2YY6A 2BFDA 2P4SA 3EY4A 2Z2ZA 1I33A 4YRNA 1R0SA 3I55H 2XOXA 5MHTA 4B48A 2DWCA 4ITUA 4L51A 3EASA 2QLBA 3KBBA 2REQB 3OBBA 3K0FB 3G8DA 4D9IA 2OV2A 4NEGA 1Y1VA 4Q3CA 4IILA 4FS1A 5AOBA 3ZDZB 1Y6GA 3PA8A 2LD4A 1NW3A 2D2XA 3WBFA 3KOMA 5E4FA 1Y1WG 4NNPA 1PJSA 2UYQA 1KH1A 2J85A 4Y6SA 3QPCA 1AMOA 3SAJA 3EYWA 3GP3A 4K26A 1T94A 2AQHA 3VU1A 5FJ8G 1ZISA 1PNRA 3TPFA 1C3VA 3DW3X 3SEZA 4X45A 2FPSA 2WWIA 1R8XA 4N9WA 4KGVA 3QXHA 4J6FA 1A5ZA 2WFLA 5DCYA 4LXIA 2CNOA 3RSHA 1J8FA 2DPJA 4MQEB 4NK5A 2QUZA 2QD2A 5J2UF 1JFTA 2VF5X 4RHTA 4CVNA 2JLAA 2YH2A 2B8JA 1NC1A 1QP8A 3IAUA 1QIDA 3FVVA 2DCMA 3BRWD 5EQFA 1J9GA 2P2LA 1RAFA 2IY7A 3WYEA 4MIOA 3CF5J 3AYZB 4ARVA 4X62B 5TPWB 2XCUA 4FDMA 3VR3D 1Y42X 3TE7A 5TDHA 4KI0A 4HYKA 4B3JA 1KAGA 3ER9A 3D0OA 3D5QA 1V3TA 2JA7G 1AB5A 1WW8A 2EX0A 1BXRA 1YTKA 4C7MA 2ZRAA 4IWXA 4MS1A 1PQPA 4A8TA 4YC7A 3L1HA 2JKVA 2FPIA 4ZGWA 5ADVA 4KXYA 3TLGA 4HL6A 4EYGA 5BQXA 3IPCA 3CZQA 2J6SA 2BCEA 3CXUA 3QHAA 3GCGA 5JS8A 2QRLA 4KITB 1JMKC 3RYCB 5BNIA 3OPQA 2Y4OA 2WICA 3OF2A 1XNJA 3IDZA 1TKCA 4NZNA 3OA2A 1DHRA 1X7DA 3GEHA 4D4MA 3BQ2A 4PCLA 4XWKA 4PZUA 1G8SA 4V0RA 4RNNA 2VQ6A 3KQUA 2JHPA 1ZK1A 1KDZA 5F9MA 2IT1A 4I4TB 2OGUA 3BAFA 3V00A 1G1MA 2C7GA 3SVTA 1QR2A 4FBTA 5A2QW 3MTGA 4GS5A 3WWHA 2R7KA 1EHCA 3W0LB 4P93A 2VTVA 4EF4A 4UHKA 4F6RA 1GLGA 1PR5A 3PIIA 4JV5H 1RRMA 3GFQA 5A9TA 2J5XA 2JHGA 2GCNA 4MQFA 4FR0A 4FCCA 2X1LA 4N5DA 4KO8A 4OPMA 4FGRA 1PWEA 3FLAA 5G3YA 2C2BA 1CRWG 1E3EA 2Q6TA 3RS7A 3F5DA 4G0PA 2WYOA 1RXEA 1L5GB 4DHWA 2W2MA 5H59A 2ZBPA 2EKQA 3BM5A 5JHGB 1MX1A 4IH9A 2W2XA 1WB5A 4CKEA 3KOZA 4BVLA 4RIIA 1PGNA 1GG2A 1OLSA 4OXKA 3RHTA 4YV2A 1H23A 3N86A 3UXMA 3O91A 3U1BA 3O1LA 1UKCA 3NVZC 4AP8A 1WBDA 1UOUA 1NRXA 1SG9A 4MW0A 4FCWA 4A4DA 2WTXA 4QDJA 4M21A 1P80A 3KB2A 4NYJQ 4U6PA 1E9EA 4XJSA 4CQLB 4C4SA 3DFKA 5CFOA 3KTAA 4M89A 5ILOA 5HW0A 4YA6A 4FCTA 1SU4A 2I80A 1H2YA 1WMDA 4RSHA 3AFIA 1J33A 3CVJA 5D3MA 2GASA 1N0HA 4Z7QB 5GGYA 1B14A 2QM3A 3C7DB 1Z6XA 3GY0A 4ZCPA 4MHSA 3G0BA 1M1NA 1Q91A 3SHTA 1YQWA 3RS2A 3DH0A 3D6VA 2J9GA 3TX2A 3IBSA 5DTRA 2CXHA 1SXQA 4LFBB 2YRXA 2NX2A 4BEWA 4YALA 4LYEA 4NAVA 4DUZB 1SHZA 3AIIA 4Q1BA 1DUSA 1UODA 3U4QA 3UZOA 1NPYA 3KSZO 1N7JA 2DQZA 3FJOA 3N0WA 3RQIA 4LHYA 2PHZA 5CD1A 4WGFA 3PFBA 5EMNA 2MT9A 3TH5A 1ST2A 2VRCA 5FCDA 3MOGA 4TM5A 4WOCA 1PTKA 2NQTA 3CWQA 4EVQA 3KFVA 2ATIA 3K9BA 4PGGA 2B7NA 2OHXA 3M0EA 4FZ5A 2F3UA 3CC8A 1DQZA 4I9GA 4BNDA 1WQ1R 4JU9A 3E03A 2G17A 2BC9A 5BQOA 9LDBA 5I48A 4J2HA 3OFNA 3R4CA 5AUQA 2QVZX 1LK7A 3E8XA 1OGIA 4EPXA 4LDPA 1P8LA 3T41A 1NVKA 5I5WA 1VBHA 3BF7A 2HG8A 5K05A 1NKVA 4TL9A 5M34A 1PFGA 3B1FA 4B9EA 2FSUA 2XY4A 3F2IA 4QRHA 1BDIA 2HGWA 3HJNA 3JAMW 4AUKA 2Q27A 1RYDA 5ERYA 3MRSA 3C8ZA 1A72A 3TLMA 4MZXA 2RIRA 1GTL1 3KELA 4OA8A 3G02A 3C8DA 1PZMA 2H08A 2PGNA 4I9HA 5AHXA 4KQ9A 1IY9A 3K2EA 5LLTA 4GZ3A 1GDHA 2XYGA 3VNVA 4YUVA 3L01A 3JS5A 3LQ4A 1S1CA 4IO1A 1W34A 4ZA2A 1X8KA 5HZKA 2REQA 1U4OA 3PTZA 3K0FA 1ADCA 1N1MA 1ZN2A 3GFTA 2VTBB 4CDRA 3GJZA 2FRXA 2WIJA 2XCOA 1RC0A 2R5NA 4I66A 4RV4A 3E4DA 2IU3A 4ILEA 2HRQA 3Q4GA 3S7ZA 3TDNA 5M5BA 1SVWA 5ALOA 4RK5A 1MRZA 4RD0A 3T06B 3SSMA 2CL7X 3UH0A 3LLUA 2VSOA 3HWWA 3BC1A 3FVTA 2R82A 5IZ4A 4P2GA 3G2JA 1P1HA 3GDGA 3EQZA 5JOQA 2C88A 3JQ8A 4ZI7F 5KFKA 3PEWA 3MTEA 3GBVA 4KIFA 1IN4A 3N58A 1GKLA 4PRYA 1ZCZA 5KU1A 1LDYA 1CY7A 3KYIB 2GJ4A 1DJLA 4RMHA 4IJ5A 2JFYA 3R6LA 1BVHA 4BQEA 2ZJOA 1W4RA 3U4GA 4M0PA 2B6NA 1U0FA 3TEJA 4NFSA 1YVDA 2V54A 3GFRA 3KIPA 5TPWA 1QGDA 5CT6A 2QM8A 3R3JA 4OLJA 3AOEA 2Y9MB 1SCJA 2X58A 2R7NA 3PIRA 1GPBA 2AF4C 3BRSA 2ZYWX 2WU1A 3IGFA 4TV8B 2EEPA 5L1KA 2JVJA 1XVIA 4DCGA 4XR9A 4QKQA 3L1IA 3QFHA 4J94A 2QDXA 3U3MA 4ENWA 4R2KA 5B1SA 3R7LA 5D87A 4FOSA 4FS8A 3KQSA 2GPJA 4MDHA 4O1HA 2O2GA 1PT7A 3TM4A 2E4UA 3CGGA 3RBAA 4PZ8A 1VRVA 2NNLD 1C8BA 2AA3A 1QHGA 3QM1A 5TMBA 1NR1A 1GGKA 4PX3A 1RRCA 2I14A 4GC9A 4LRWA 5IX8A 1KVSA 4EM6A 5TF4A 1U0BB 1CEXA 5L53A 4YHBA 4DGSA 1WOYA 4EFLA 3PNOA 1CQJB 5M04A 1E18A 3G5TA 5C1DA 5DCLA 1P0IA 3G5AA 5CA0B 4M1YA 2R4TA 4E0BA 5I8WA 5JDCC 1A4RA 1MJGM 4C7ZA 4I4TA 5C8YB 3QVUA 3W3AA 3LT5A 3VHQA 1SVUA 1E2GA 4LWOA 4KQHA 4JJEA 3MJVA 3R41A 1MB9A 2IZOA 2QU7A 2PMBA 3RGXA 3WNDA 3SBXA 3SU8A 3FGZA 1C9NA 2P5TB 3NHJA 6Q21A 4KLNA 4F7DA 3K09A 1SB9A 3MTIA 4KHPH 2FKNA 4KPYA 4BO5A 4LF7B 5IU6A 5FOWA 3U09A 1ZG3A 3OAAA 4HQ6A 5DP1A 5KFGA 3PEEA 1BW9B 2WNIA 2YS7A 4BJ5A 3BH6A 1NFQA 1MF7A 2H1SA 4HQOA 2O7QA 4D9NA 3L7DA 2DHRA 4IICA 2VO1A 3SS9X 4B83A 4DUYB 4O5AA 3ELUA 2DERA 3U3JA 4C0BA 4Q37A 4BIIA 3B82A 1UXJA 2HLHA 3K7EA 4CC5A 3DBOB 4H7IA 3CNLA 3HJTA 4G3IA 1OKKD 1ZAUA 2W2NA 3HXTA 3QF7A 3VR5D 1ORRA 4CQLA 2QG9A 4Y2PA 2ZYRA 1VOTA 4ZJYA 5MN6A 2BQRA 4C2AA 1TUEA 2AR7A 1J00A 1HNXB 1CW2B 1RACA 1RYEA 2Q8PA 2WQ6A 4JKOA 1PSZA 2Q46A 4ZTUB 2C1ZA 5JI2E 3SCZA 4WJZA 2EXXA 2AOXA 1CR6A 2HNKA 5B4VA 2QTAA 1W4CA 3SC2B 4CLOB 1C7QA 3UA3A 4C7OB 3LL7A 2WB1A 3SNOA 4KGXA 5I9NA 3BSFA 3QVGB 1PWZA 2FHSA 2ZRPA 1ZWLA 4LC1A 2Z4RA 1YUBA 3HDVA 5J5VA 5TIIA 4H3KB 3ETGA 1ZK4A 3TIIA 4EZIA 5LM3A 3QBDA 1TF5A 5C1PA 3RWOA 4MGKR 1NDHA 4MQMA 4OM7A 2XZPA 4ECQA 1XLUA 4N3NA 4CG1A 1YTDA 1ZW6A 2VPZA 3QE3A 4J9MA 2OXEA 3B9RA 3I4FA 2AGVA 3GEIA 4HADA 2AR0A 3M3HA 1GPAA 4IAOA 3KJXA 1ESNA 4N7MA 1WDKA 5B1YA 3PNKA 2AI1A 3ZV4A 1UFQA 3ZJUA 4R4JA 3O2SB 3ZQ4A 4DM7A 3SJBA 3AJEA 4ZOHA 4MDFA 2OORC 3U3RA 5HEKA 3UWSA 2NAFA 3C6ZA 2B6HA 3DEJA 1UOOA 1N2OA 1XXLA 2VYND 1ACMA 4B9AA 4GI2A 4WT7A 2REXB 3NFYA 1F2UB 1U0NA 2GN4A 3TLCA 2C98A 3KHUA 4RPGA 2GTHA 4FYVA 3T1OA 4FDAA 4NDAA 4CLRB 4YTEA 4JXKA 5ALZA 3RFVA 2Y1XA 5DISB 3V2HA 2JGLA 3NH9A 1G7CA 1HG0A 3NM5A 3KJFA 2JEZA 1B16A 2NZXA 1QGZA 2FWRA 5DX0A 3UG7A 5HVNA 3C3EA 4KN6A 1G8JA 1XJCA 4EHHA 3RHZA 3TQQA 5D3KA 5L9XA 2KHZA 1GQYA 3LT4A 1XCMA 3AUJB 2ZE8A 5C5EA 1XVAA 4P1ZA 3TQRA 2J8ZA 5EHGA 3A4VA 4UTPA 3UW1A 3WLJA 3LA8A 1NJ5A 2HA2A 2VTBA 5EJIA 3ZLUA 4NMLA 3HCOA 2DPMA 4PDBA 5AVJA 4NEQA 1BHO1 4GBED 2WUGA 3T61A 1XMPA 1ZH2A 4MUFA 2MYUA 1VQOH 3KJZA 4DMUB 4GKJB 3KBOA 4M7PA 4TL8A 4YQEA 3CPEA 1F0KA 4W6QA 4US9A 2F3QA 3AETB 1VPEA 2PWPA 1U0EA 1DAHA 4EJFA 3A7DA 4Q9JA 4WEQA 4CM4B 3V9AA 3Q40A 1RAAA 4RHYA 1GT6A 1HDXA 2CXXA 4YCSA 5DGDA 3ZI0A 2P8SA 5A4MS 3GRCA 1P29A 2W9XA 1QGAA 4IMIB 5DK6A 4Q66C 3HL0A 4OD0A 4BXXG 3EEBA 3K9WA 1IXKA 1JDBC 2IBKA 3HA5A 5BSRA 4I8DA 1VQ6H 1K86A 3SEAA 1YJCA 5ELMA 1YK1A 4IIJB 4TWBA 3ZZUA 2FQQA 1XTTA 4C0SA 4EEYA 4DQXA 5JCJA 2G9UA 4YAEA 2R11A 4C6RA 1THTA 1ULUA 5INTA 2ERCA 4LTMA 1RRKA 4FB5A 3IQEA 1PHPA 4TV8A 3N0TA 1V6AA 2VJDA 1ZIYA 1ODSA 3A1DA 1MC4A 1O9GA 3G6VA 2H00A 3K0AB 3S2ZA 2ASEA 4Q34A 5AVUA 3UF0A 2WDZA 2PZGA 3VAAA 3RC2A 2AHOA 1N32H 5TB5A 3QPUA 4ED2A 3R0VA 4RSRA 3FRIA 3UWKA 3ICPA 4CLEA 3BHJA 1D0IA 3JWGA 1Z7BA 3RFUA 4KXXA 1FFEA 4WK4B 3UB4A 3PFGA 1T1IA 3R9KA 1CQJA 1YAJA 4W9RA 5A62A 4ZQBA 1Z0ZA 2GN1A 3H4TA 3HU1A 1FFXB 5CA0A 4MHTA 4QELA 5IDYA 3ROFA 3MTQA 2JFVA 3B36A 4NC9A 1K27A 2I4LA 2XYRA 5C8YA 3DGFC 5C46F 1WR8A 3HABA 2B30A 3QF4A 3C41J 4GU5A 2FN9A 5L7TA 4O4LF 1TCUA 3F5SA 1RYFA 2ZI3A 1LJ8A 5TMPA 4QVKA 3M6FA 2H9AA 1R9MA 3NTQA 4G8DA 4CXMA 3QZ8A 3LUAA 3VYVA 5DLGA 3HEBA 3P96A 3SGLA 4RHFA 2BDEA 4RTPA 2QU8A 2M6SA 2VJMB 2OA0A 3RK4A 4YQYA 1E69A 1J70A 3KQKA 2VXYA 3M9LA 2X8LA 1ZITA 4AJ2A 3QA3E 3LHSA 2O05A 4QDOA 3IUMA 3SGIA 2EJCA 3NORA 1TCAA 2IUSA 2DTXA 1BW9A 2Q4DA 1CERA 3RRXA 3JX9A 1LXCA 4ZQHA 1IWOA 2EFHB 5E9WA 3UMYA 2W0SA 2QTVB 1T9GS 3DOIA 3VSAA 4JEMA 1Z6ZA 4DA4A 4N4AA 4MV0A 4JAVC 1HA3A 4NU0A 4QVIA 3IDOA 1EP9A 1E98A 1Q15A 5FYDA 1UDAA 4FR2A 4I1YA 4ZCQA 2W5UA 1QFMA 3LVRE 1TYEB 3I76A 1OBGA 1QNLA 1XAGA 2BHLA 3P2JA 3B3JA 3VJMA 1IBSA 5CH5A 1WUKS 1OHHD 3FTPA 1JDVA 3T5DA 5FNVB 4P7FA 5HE8A 2PGAA 4TXNA 4B09A 2CC2A 1K3UB 5CDUA 3H2IA 5KTTA 4G85A 3LZ6A 3U48A 4B3BA 4EZEA 4ZAFA 2GO7A 3P26A 4XFDA 1E3IA 2MTBA 1F14A 2Q9UA 5B6JA 5CDGA 2XKAA 5DMXA 4AYXA 1M7BA 2GK6A 3CQZA 3TD9A 4XDZA 4H7KA 3SC2A 3DO8A 4CLOA 2BH9A 3G88A 4A3DG 1D6MA 3PNPA 2ISQA 2V6FA 4HDNB 4RZIA 5A1TA 4M9CA 2J30A 1L8AA 4TRJA 2CF6A 3RLIA 4EDHA 4JLSA 3OOEA 3SYKA 3X1KA 4NNJA 2PKXA 3Q2IA 2C82A 3WDSA 3T15A 3AEYA 2HAEA 5HTOA 1F20A 4NLLA 4FHEA 1YA6A 1OPRA 2PXCA 3HB1A 4ZEXA 1FBTA 1F5NA 4HTFA 3DZCA 2OTCA 3TSYA 3J7TA 3L7IA 2ACWA 1JZQA 5EP1A 1KSGA 2PIDA 4J9OA 1IM5A 5BR7A 4D9KA 4IJQA 1YJ8A 1HYHA 3SP1A 1UBJS 1TC1A 4BB5A 2QMYA 2OXIA 4EF5A 1I94B 3GTLA 1PBNA 4HDSB 1VG0B 1XE3A 3NWEA 2QRKA 3VHLB 5GOTA 3ZHQA 4RTQA 4R54A 2B4AA 2B5WA 3AI1A 3TCXB 1XD2B 4DRXA 4F2GA 4C20A 3CUEF 1F2UA 1G5QA 3TXAA 1JWAB 3E7XA 4DMKA 3NNDA 4O3RA 3UXHA 4CLRA 1QYIA 4KHPB 3LUFA 2W2TA 1Y9JA 3BWDD 3K5HA 3AUSA 3H1TA 4F6LA 2XVXA 4CMJA 3ZWDA 5KFLA 4X64B 3VH1A 3QTTA 3IFSA 3M34A 1KHHA 1T15A 4N3CA 3PZPA 2P2GA 5ECYA 4ZZ2A 2I6QA 1WMBA 3H0CA 3PA6A 3RANA 1GTSA 3HB9A 5DXJA 4DHEA 4D3ZA 1SBHA 3K0CA 3FYSA 1E1LA 5JATA 1WUHS 3M7IA 3B7WA 3IT3A 1WETA 3HCDA 1RYBA 4KVZA 3PNLA 3FM9A 3R7WB 4QUHA 3WLHA 2VJNA 4B6FA 4EHIA 1NV9A 1KFBB 3LDAA 3AX6A 5IFLA 3FCUB 4Y7DA 1N9ZA 1L2ZA 4Z1MA 2XUIA 1A0IA 1NIJA 4TRRA 4Q6WA 4NULA 3RIHA 3ECSA 1C3EA 2QP3A 3I6ZA 1TYDE 1NNLA 3AETA 4I9NA 3K73O 4DCMA 2A9VA 2HCJB 3I92A 5CTJA 1AUPA 4LBWA 2UYGA 4CM4A 2GJ8A 1RYMA 3PEFA 3UVEA 2RD2A 2FMIA 2DQ4A 4BO3A 3OPYB 1BE1A 3ZQJA 1KIAA 2DIKA 5BVGB 3TW8B 5E4JA 4D5GA 1R0CA 4RYDA 3WO1A 2ZVQX 4Z6KA 4PVCA 5LUBA 2PV0A 2CHUA 1TD1A 3IUSA 2D0OB 1E2KA 4Q4CA 1DC5A 2BZ0A 4V2UA 4DSAA 3E6AA 1QP4A 5H16A 1OXMA 1W5AA 4IIJA 4P98A 1ABFA 2J09A 2EKPA 4P7KA 3ONWA 4J0MA 4RIHA 3V4LA 2PMWB 1DJOA 1YJQA 3O0TA 1RADA 5TMEA 3DD1A 1KNXA 1KSFX 1Q0ZA 3LSYA 2G8NA 5JXIA 2A14A 3VZRA 4FP9A 4GP6A 2O07A 3QVLA 2RJ3A 1R9JA 3HR8A 3WRYA 1SHKA 1Z6PA 2A0KA 1G59A 3Q9NA 1HDYA 3H1BA 3OP1A 2J67A 3K0AA 2Q2NA 4MTCA 1FNNA 1PI3A 4X41A 4AYTA 1CF9A 4DUGD 2GM3A 1EK1A 1P7PA 4YT4A 3RS9A 1OX4B 2WT4A 1JEOA 3RDPA 5SY9A 4EPYA 4TTAA 2OHVA 4HUQA 1HG1A 3JQ9A 3HQ4O 1Y8QB 4UQOA 2FCAA 4AQ7A 4M1ZA 4CI0B 3LU1A 5BWLA 1BMFD 5JCPA 2C2XA 2P2ZA 1A2QA 1T91A 2OYSA 4UVIA 3DNFA 3FJ1A 3O3NB 1FFXA 3CCCA 5E95A 2Q6IA 1AKYA 2G83A 1E4EB 1KIFA 4ETIA 1HV8A 2IV7A 3FW1A 2QQEA 3H8VA 1R18A 1F4VA 3OC0A 4F97A 5H7XA 2W6IA 5F12A 2HRZA 4PC2A 2WB2A 5IYZF 2BGRA 3KR9A 2FWAA 4FFBB 4K6GA 4OHWA 5JSYA 1V5WA 1N62B 2VJCA 1TB4A 3ABZA 4JJKA 3G79A 2VJMA 3UT6A 4OYRA 3DFZA 4NLGA 1OLUB 1X86B 4QJ4A 2C2GA 1P5ZB 5EHIA 4AS2A 2XUPA 1QOPB 3G5UA 4UFZA 5AVWA 1H66A 1STOA 3PHHA 1HURA 4ZQFA 3OECA 1MZPA 1KC3A 5T14A 1PJ3A 4WHXA 1W4LA 3KXPA 2QTVA 1RTTA 3RAQA 2H54A 2Z43A 4ZYTA 4B2IA 1HNZB 4RABA 2I54A 2N46A 2DRIA 2C5LA 3ISJA 2BWJA 3FR7A 3A6GA 1U0LA 5LWQA 1EM6A 1U5AA 1H3EA 2AJDA 5FLKA 3F6PA 3WSTA 1Y37A 4RM2A 4BGIA 4GRAA 5FNVA 3ZHTA 3FZNA 3RKSA 4B35A 5D3QA 2ZIAA 4Z2YA 3L7AA 1JR3E 4D0NA 5EJ5A 2AMFA 1SGWA 4DR1H 1RQXA 4TKVB 1F51E 4ZCLA 2YVQA 3BABA 5JMTA 1JRLA 4RSMA 2CGEA 4D8TA 1MO2A 3GHHA 4FKZA 3SEQA 4DG9A 4UM7A 4ID3A 4G4SO 1ZHOA 4BMSA 3AM4A 1Y1VG 2CW5A 4KWCA 4GVLA 2PBFA 1WQ3A 4HDNA 4BGUA 1K8QA 2JEYA 4A36A 1TJ5A 3CONA 4G84A 4MVCA 4GF5A 4F4WA 4RAOA 2GFHA 3DL2A 1KU0A 1UIRA 4F3YA 2GBLA 1N32B 4OI0A 4PGAA 4LE2A 2GCGA 2GCOB 1F6BA 1MT3A 4KQCA 1UPXA 1YFKA 5HUHA 4LNUB 2XJ9A 4UCRA 1AXEA 3MR5A 3MS7A 3EDMA 4LFBH 2HSZA 2R6FA 4JBWA 2F43B 5DYWA 3GL9A 4DUZH 1Q7EA 2OKCA 3NIBA 3JQDA 3LNCA 4NI5A 1RE1A 2W2OA 3RH0A 4NJEB 4IHJB 4YQWA 4I9AA 1NT4A 1MW9X 2FWJA 1MA0A 1TEHA 3WA7A 1CUYA 4DYHA 2BP7B 1INLA 5CHYA 3JSXA 1PJQA 3M1YA 3IN5A 2HSDA 2RF4A 1XD2A 3Q0EA 4RVCA 3WWDA 3CH7A 1JBKA 1EK0A 4EL5A 4JLNA 2GAFA 1SK9A 5EPEA 4Q03A 3WKAA 5F7OA 1XZJA 3HOYG 3IHTA 2Z8YA 3IV9A 2XWPA 4E21A 5HK8A 3N5CA 4PHTA 3SZLA 1W8DA 2XWQA 2OGTA 4EGSA 1R9TA 4L57A 4U8HA 5C81A 5IXSA 1WXWA 2O8DA 1Y98A 5BWVA 1X7HA 3CEHA 1E0SA 3FDZB 4J9RA 4QDUA 1NW9B 4P4SB 1L5VA 1WP9A 4PLWA 5F2EA 3R7WA 5IH7A 4B2LA 2O2HA 2XQFA 4UBJA 2JJYA 1CQZA 2OYCA 4GP9A 4YFYA 1L5OA 1JU4A 1LC0A 1Z0SA 2F17A 3UATA 3X1XA 3FDJA 3C1UA 5CM2Z 3NYWA 2OHOA 2PX6A 4MICA 4XR5A 1MCZA 1FX0B 4O4IF 2HFKA 2QYHA 4RD1A 2HJWA 4E15A 4B44A 3F9RA 4HMPA 1DKUA 3AL2A 3I39X 1GDDA 2EFCB 5JZOA 4C01A 1P17A 2H92A 2B25A 5CBKA 3C8MA 2X0JA 3OPYA 3O8NA 1CP2A 2HJGA 3REOA 5FI0B 4ISBA 3R8FA 2BTOA 1K8XB 1R0RE 2WHRA 3WJ7A 3TW8A 3CSUA 2ZB8A 4FOOA 3V2IA 3O82A 3S68A 3WK4A 5JIBA 3BHNA 2R7AA 4RF4A 4OIFA 1AQNA 4IKOA 1CDDA 1OFGA 5KTPA 2NMVA 2CUZA 3LCUA 2NLOA 3PC8C 4YASA 5L45A 2JHAA 2O2CA 1ZX1A 1V9SA 1G1AA 1ILEA 1B7GO 2CT8A 3ZXXA 4MJ3A 4OHXA 3SG0A 5J59A 1ZZGA 2CY0A 4G5XA 3KOXA 1RK5A 3RTDA 4PIMA 4BFZA 3GZNA 3UK1A 3VV2A 4MDYA 1LI7A 5L9AA 5TSDA 5JBQA 2CW8A 4DEYA 1G8HA 4LJ4A 3RASA 3OLQA 1JAYA 1RZUA 3HZRA 3E35A 1OIVA 4J1QA 1OX4A 5EAIA 1WDTA 1CKOA 2YMLA 1SOWA 1FVFA 3PJDA 3CMMA 3SKXA 2I29A 3B89A 3AR5A 1PD0A 3FUXA 1YQQA 4LY9A 5FPSA 4US8A 4MZDA 1U7UA 1Y8QA 4ZJPA 4IR7A 3AQ4A 2JBHA 5FAXA 3IAS1 1GRCA 5ITWA 3EIWA 5CVCA 4QATA 3L46A 1RZ3A 2ZDHA 1YS6A 1FYVA 4D42A 4RVHA 3TF5A 4ZU1X 2QZZA 1DRWA 1R8SA 1BC5A 3V9PA 4QLOA 3LOPA 2N1MA 5DJ5A 4C0KA 4N7RA 3HKDB 3CUUA 3FAZA 3U7JA 5LZ5A 2AIRA 3JPYA 1S4MA 4DABA 1HLGA 3NDRA 2X7JA 3F5QA 1E4EA 1ZGCA 4PQGA 3PT9A 2DR0A 3L3BA 3D3JA 4E4TA 2X6TA 1UBCA 1L4FA 1CYEA 3MW8A 2ZUSA 1WRVA 2WYVA 1RAEA 1ZUD1 1YT5A 2DSNA 2HRDA 4FFBA 9GPBA 3V1TC 3LIPA 3LA6A 3TSOA 4PWZA 2NVWA 1XGKA 3UJ6A 1R5OA 3UTCA 3R3SA 2I9KA 5ULLA 4BWFB 5H9WA 1OLUA 4LJYA 3QWFA 3HBMA 4BFUA 3JZFA 1OI3A 3B7PA 4EI9A 2NADA 3WIOA 4UW9A 3CUTA 2PLAA 1KP9A 4R9VA 4ROTA 4G0VA 2WJ3A 3T5MA 4O7WA 3UBMA 1K8ZB 1TEVA 3ETDA 2XGSA 3TKYA 1L7RA 2ZTMA 2DFLA 3D8SA 3FE2A 5T5QA 2ZJRJ 2I4NA 5ESWA 2G36A 3LBFA 4LF7H 1OROA 1H2ZA 2JLWA 3WB9A 5I4IA 4H7HA 4BJ6A 4AKTA 3FTFA 2ANCA 2ZRFA 4P4LA 4OQFA 4DUYH 2GQRA 4BNHA 1UBRS 1CIJA 1ESEA 3FWKA 3E5HA 3IR5A 2FK1A 5EWMA 2E5WA 3K9FC 2KBEA 2IE0A 4KFTA 1WXEA 4TKVA 1QH0A 1P33A 4EVSA 1GIAA 4YAUA 2AOWA 3O9MA 5CFMA 2XQGA 4WXEA 2FW1A 1YE8A 3IE2A 5CJJA 4PXAA 3OEHA 3EE6A 5ESRA 4CEHB 3D6FA 1FSSA 5JUWA 1KMIY 4BASA 1C1XB 3GO4A 1HNXH 1VIAA 1YCGA 1DG1G 1GKUB 1HRDA 3GZTB 5DXFA 1ZN7A 2HN9A 1OYWA 2X3UA 3N8KA 4KMRA 3KKZA 3QK7A 4ZVKA 5LD2C 2H5IA 3C6KA 5EY5B 4RS4A 3EEQA 2GCOA 1RRPA 1KAQA 3CLVA 4FGSA 3T1TA 1PE0A 3G6XA 3IRUA 1S9FA 5DW0A 3WMFA 4LNUA 4QEKA 4NHOA 2C07A 1DFIA 1VYVA 2A0XA 2RSLA 2ZK7A 4MUEA 2NTJA 1KJ9A 3WGVA 3KWJA 4UATA 3ZIAD 1E0DA 3T0FA 2F43A 3A6LA 2MSKA 1DLJA 4EUFA 2CXSA 2BMEA 4QUEA 4XVCA 4PS1A 521PA 5H81A 1E4OA 4MA0A 1R6UA 4L4RA 4NJEA 3KQNA 2GNAA 4IHJA 1DVRA 1UPBA 2B69A 4CMEA 1BH2A 3UWDA 3D3QA 2Y0EA 5AIAA 4HGYA 3PT5A 1HDCA 3T6KA 1I7PA 4AJHA 2CNWA 2SBTA 3LM8A 3DLIA 3MJDA 1HX7A 1RJQA 1PK7A 2HMSA 2PYZA 2XHEA 3ELDA 4P33A 4EB0A 2JD1A 5EIWA 1H05A 2C1XA 1VI6A 5I4BA 4REMA 4KHZA 2P11A 1N3IA 4PNZA 5LL6b 4A5SA 2CV1A 3MJHA 3MT8A 5EJ2A 3QQMA 1UCFA 1L3IA 1S2MA 3WGJA 1CRZA 1WB9A 1TAUA 3SF8B 4Y18A 3FHTA 4S1WA 3BTSA 4GWKA 3VXKA 3OE7A 4Q4HB 3FDZA 4I6GA 3EPKA 3AW9A 3PUHA 2Y67A 4P4SA 3L8MA 4QU9A 2QIPA 2AUTA 2X8WA 3C5EA 1Z26A 2C0PA 2X0NA 4WK2B 3UHOA 2H1CA 1AGNA 3JYNA 4QOEA 1VA5A 1MV5A 5FA8A 3GCDA 4GOKA 1A9TA 4JL8A 3PQ2A 1E4YA 4GR5A 2CDRA 4Z7OB 1QB7A 4DG8A 5EP8A 1F17A 4BDSA 2Q1WA 1KI3A 3ZWKA 1OA1A 3V4SA 1E9AA 5JVLA 3PR2B 4RH3A 3PKZA 5TGTA 5JY6A 3EC7A 4OH7A 1UP7A 3NTLA 3WNVA 1O08A 2CCJA 4DR1B 4MTLA 2JH8A 3REGA 3C5CA 2DPYA 2FPWA 3I0MA 5DNEA 2X1MA 1SXJD 1ZH4A 4AY2A 1F2VA 1M1ZA 4CM7A 4GECA 1QPNA 3DV0B 1JA9A 1OFVA 4GKJH 2AJCA 2Q3DA 3JQQA 4YRGA 1SUCA 4QWWA 1QRRA 3FETA 2JCBA 2KJQA 4JJIA 4UUAA 5TR9A 4PIPA 2Y1WA 3L79A 4BFWA 2EARA 5K4HA 1NBMD 2PY6A 4XPIB 2O2EA 2HU2A 3RU2A 3NOOA 4F2DA 2CBXA 2X2FA 4YRKA 1BXGB 1GPUA 2QLNA 3DHWC 4MLDA 2CB9A 2DHEA 5MDHA 1XTIA 4I2NA 3NH6A 4DR7B 1VCMA 1YCDA 1TQHA 3HJUA 1WCV1 2RK4A 2RHRA 4N8DA 1QM5A 3ZVLA 3LQFA 6REQB 4H17A 5CJPA 1V16B 3AONB 1WH2A 1NVIE 1TZJA 2DVMA 5TGDA 4RMJA 3DBIA 4KUEA 1SWVA 2W48A 1NG1A 3O7MA 1XZCA 4OHYA 3U16A 2I7TA 4RAYA 4EAQA 1O95D 3CF6R 4DY6A 1Z47A 1TAQA 2OG2A 4J0DA 3UJNA 1SOVA 3HCBA 2ZPUA 4UC0A 3SZRA 4YRSA 2WDTA 1E1YA 4YRQA 3ZZMA 4KBYA 1L2TA 1IQRA 2ZZMA 4KR3A 3HKDA 2NZUG 5IUJC 2VHWA 4LXUA 5EIXA 2W2KB 3I9MA 2R8GA 2VJYA 3VO1A 3HL4A 4RJ2A 2VCEA 4E5UA 3I9KA 4JXJA 1F8GA 3LQ1A 3EGDB 3QLVC 3I73A 3INYA 1YZUA 2YQ5A 5TARA 4CQMB 4FLEA 1VHTA 4PAQA 3AR6A 2DY0A 2AH5A 2HYDA 1CZUA 1BQ3A 4DW8A 2DQSA 5AUPB 5MFPA 1AXGA 5MLCO 3VYTB 1LNSA 2JEGA 1P9NA 3BFVA 4KFSA 1V1MA 5K3DA 4BATA 4NABA 1B43A 5HULA 3INGA 3NHAA 4KODA 4OM8A 5BYBA 2V0CA 3C6MA 1G38A 1HTBA 4B80A 2VSQA 2HBYA 3SIRA 1VCOA 3R0JA 3MGAA 2ZAGA 3OO0A 5JNTA 2JVIA 3HSKA 1A1VA 1VFPA 3NDBB 2QM7A 2JAOA 4M36A 1H2FA 3VVMA 3NR2A 4M0DA 1NI3A 2HPAA 4MX8A 2XD9A 3DF7A 2XT0A 4E3ZA 3OG9A 1A5SB 2I8LA 5EL0A 2UVPB 1H8HD 3LXMA 1O94C 2FZEA 1OD6A 1IHDA 3TN7A 4F45A 5FTMA 2WM9B 4DCTA 4O4JB 1S3IA 1EXDA 1TKAA 2A59A 4JSTA 2AGPA 1AQLA 3F4BA 4FGWA 5DNWA 2HHJA 4NRDA 4V0QA 1KFCB 4L3WA 2ZTHA 2IU6A 4JI0B 121PA 1RD4A 4QAQA 5JYEA 1NHWA 3W4IA 2FEMA 5B2EA 2E89A 2Y4RA 3BSYA 3A6HA 4MQEA 1RPAA 4MYTA 3CVOA 1DAPA 3QXXA 5I45A 5KAPA 1UWLA 1JQLB 1SN7A 5DWDA 4CEHA 4GO1A 1KI8A 1A82A 4LV5B 2WAOA 3RJMA 1QO9A 3TOXA 1S8FA 3JYQA 4UAJA 1AS2A 5DH9A 4NE2A 1C8LA 3V7YA 4M0CA 4JC0A 5M29A 3X1WA 3ZOZA 5JW6A 2FDXA 3T7DA 1TA4A 1FFSA 4RHXA 4S2EA 4P7BA 5KWIA 1CB7A 3DEFA 1K92A 1I1KA 3ZH2A 2VQSA 2HJVA 3T9FA 1I4EB 4LSGA 4I50B 1DKMA 2VWGA 3OOYA 1MQAA 2AEMA 5JC8A 1RQLA 4OUDB 3VGPA 3EODA 2PKWA 2CKZB 3BWYA 3L7YA 2QB5A 5GJCA 2FFRA 3PQ5A 3RYCA 4A1FA 1CEQA 2C9OA 1C4OA 5JARA 3ZY5A 4O7SA 4JD5A 3KQQA 1YL5A 1ZBDA 2OMEA 2A7QA 3AINA 5LA6B 1KDRA 2AGQA 3TM5A 1I94H 1W36B 10MHA 3LKBA 2DWOA 4MV6A 2QTBA 4PLPA 3CZCA 4CV1A 1COWA 1PFYA 4TT8A 4N82A 4DY4A 4EY4A 2X42A 4BKMA 4OU5A 2DPGA 2DF8A 2QRGA 3EJ6A 3LP8A 5EEHA 2BHSA 3THOA 4LZOA 3SF8A 3P19A 1U90A 4Q4HA 2PM8A 5KYNA 1ECJA 4MCIA 3L7BA 5D7BA 4ER5A 1NF2A 2WWGA 4YP7A 1A97A 4EVIA 2B20A 3PDIB 1VQKH 3EPHA 3FPSA 4KREA 3RK1A 3UEOA 1LKZA 3GOHA 2C31A 2LUOA 4X64H 2O6LA 5U1PA 3PXDA 4MKIA 4R7TA 5JD5A 5JD4A 4MW4A 5EGNA 1E6EA 2C8LA 3NHWA 4DN6A 5A3JA 1C1YA 2J3HA 4A8JB 2EP7A 2YRFA 2QTCA 4HLCA 3JSNA 1RYZA 2QJTA 2EWVA 1X19A 2Q9BA 1U4NA 1RIIA 4EQ5A 2AG8A 1W48A 4KUGA 2RB4A 2CMDA 2PXAA 5FTWA 1CT9A 2GEBA 5AD1A 2BGNA 1WTAA 3G9TA 3CX8A 5JAMA 1PIWA 3EVEA 3QEMB 3BQ1A 1Q7GA 2QY9A 4YJ3F 1NNEA 2JGRA 5FL7D 1T0BA 3Q0TA 4LXQA 2JG3A 3LLCA 1ZNZA 2W6MA 4QDXA 3S8YA 4LK3A 3DV0A 1YQEA 3TQSA 1Z39A 3C3JA 3FZYA 3J81A 2EZ9A 4ZODA 2VHCA 4MKFA 4RPIA 1PWHA 1GFZA 2WNHA 1I1HA 1ENYA 2FCRA 3K20A 1E2QA 3GNLA 3EXAA 3OMXA 4Q8EA 5FLXA 4L6CA 4TYMA 1N2CB 4JOBA 4NF2A 5E0KB 5FYQA 4CCWA 4WY5A 4LF8H 4HB4A 4EAAA 1Q0QA 4XPIA 2BUAA 4ZOCA 3FVRA 3GAMA 5EZYB 3SZOA 3V8PA 3KR0A 2Q4BA 1BXGA 2ZAMA 1ESCA 4AKHA 2C2WA 4OLBA 4FR5A 3GCXA 1MXHA 2PSDA 2KX7A 1QHSA 2VNSA 4EELA 6REQA 1WPXA 3WAKA 1V16A 1ZLYA 4JWTA 4QHSA 3I32A 3ANYB 3N87A 2QRVB 4PZLA 2HA3A 2ZEJA 3GJXC 4GKBA 4JODA 3A4YA 2YY5A 4BAZA 1A5AB 2RHJA 1XZQA 4S35A 1CB0A 1RCUA 4JLPA 2PLRA 4YACA 1F3LA 4PHGA 1VKNA 5ALUA 5KOYA 3ACBA 5DHUA 4XTCS 1XTQA 1X13A 4E12A 3C4QA 4BUJA 3MVEA 4ND4A 2GS9A 4KXVA 4PO3X 2ABWA 2QLTA 4ETMA 4NPAA 5CFNA 5A03A 2VOEA 5KT3A 4GL4A 2W2KA 1VKRA 4MWGA 2O1EA 1XRSB 2PVCA 1T0HB 3EGDA 2EDCA 2PBRA 4CQMA 5FBRB 2H57A 4BE9A 1GADO 4TTJA 3M9WA 3TXYA 1X1BA 1ULTA 5FWDA 3D59A 4DIEA 3IQXA 5KYXB 3ZXYA 1D4OA 3GLQA 3TY8A 1EDZA 1QGED 2WSSD 5DHSA 1K68A 2H4FA 4GLJA 1TCVA 1UBTS 4ZT5A 5NLLA 3TVDA 1QG6A 2O4CA 3IDFA 1MEJA 5L1JA 2F8TA 1YVUA 3WGLA 2QAGB 1ZI8A 3H4IA 6ABPA 3B3QA 2V58A 1R0LA 3TRHA 1ZZEA 1RZVA 1F4LA 5LQMA 2V96A 2XMSA 1GTG1 3TL2A 1ORVA 1XJ0A 4D3YA 4YCDA 2BELA 5B2FA 5FTLA 1Z8NA 1ZW1A 1K06A 3UXEA 2XZOA 4XXHA 1Z06A 3R0XA 5BQPA 3FI0A 3W2HA 4NV1A 3QY0A 2MYPA 3NVKI 1YQGA 4X6XA 2PYIA 3PHJA 4YYYA 5L3RA 2UVPA 4HX2A 5HIIA 1VQNH 4XZ3B 1WR2A 2P4HX 4B3MB 4C05A 2WWYA 1QPOA 1M74A 2WIFA 2SKEA 4W5RA 3EQ7A 4O7NA 4O4JA 2B1JA 5EDWA 1NVVQ 1NHGA 4ERNA 1P72A 3VR5H 1HNZH 5SZKB 3ZXUB 1EUCB 1M76A 2ISCA 3EWAA 1DGQA 2QYZA 1MO4A 3A70A 2JAQA 1NATA 2GN6A 4K9QA 2XI4A 4IV0A 5AK4A 4XOUA 5LQDA 2GWHA 3AF3A 1XQ1A 1ZHSA 2Q4EA 4XVRA 4NKRA 2D1TA 3U44B 1K3TA 4KU4A 3SXPA 2XDQB 4L27A 1DKLA 4H6PA 2VPPA 1VB5A 3SHWA 5ADWA 2G4CA 1YACA 1V9PA 2ZR0A 1WW3A 3A4TA 1SVKA 4WL0A 3LVBA 1I7NA 5JNWA 3G8YA 4XYMB 3HXOA 4EG6A 3L6UA 4M8SA 4R3UC 2HRRA 3KKQA 4RAZA 1ZM4A 3IDQA 4P80A 1SBNE 2FPOA 1UBNA 2FU5C 4RNDB 1LI5A 3OTHA 4ZVVA 4BQQA 1T5HX 5B1HA 5J9FA 3SF0A 3TL6A 5DLQC 1ESDA 5A0TA 3U60B 4DV6B 1AB6A 2FK7A 1U7DA 2XSZD 4X54A 4ZVQA 2RHTA 1SBYA 3V34A 4FS2A 5AQEA 3TJRA 4P35A 1EFLA 2GEUA 4AYBA 4KV7A 4I50A 3I4CA 1PYOA 2OLJA 2GPTA 1M8FA 4OUDA 3JQPA 2RKBA 3SMVA 1EDBA 4PX5A 4F91B 5IKEA 3ENNA 1BKYA 1CVIA 1PZEA 1X74A 5G1NA 2RHOA 1KTVA 3F9IA 5AJWA 2IX9A 1ZO8A 4ZAYA 2ZGIA 1P18A 2PIAA 3FDFA 3WHIA 2BTEA 5LA6A 3ZYCA 3UOWA 2FV8A 3NAQA 3LT2A 4DYVA 5CCXA 2J33A 1UL1X 2TRSB 3Q6NA 1I3CA 2BEVB 5I51A 1XEAA 4CMHA 3EDYA 2O3SA 2GGSA 1OZAA 1EWTA 1U28A 4M1SA 4PX9A 2PUHA 1G6OA 4WTOA 1TM1E 3HOUG 5GMOA 5EJMA 1A8PA 1DCMA 1GO2A 4DDVA 5H70A 2B3TA 4EW1A 1YHYA 2GZRA 2CB0A 1KR2A 4WA8A 3S99A 3OVMA 1AT1A 5FTKA 1MJNA 2VDQB 2X3FA 4PAWA 5IZCA 5KNBD 2PMCA 1Y5IA 3GPIA 4PINA 4YLGA 5DM4A 3ENWA 3QNUA 2IY8A 4XWWA 3ZVRA 4Y6LA 4U2KA 1YTUA 1YB1A 1ORIA 4A8JA 4DWOA 2XB9A 3BE4A 4OGLA 5DGCA 3P2EA 1G5PA 3T5BA 3A2NA 2I1OA 1KEEB 5C80A 3PFFA 2IDZA 3D7MA 5FWXB 4C7XA 5F2NA 2MR5A 4G2TA 5IBCA 3QEMA 3UZUA 4KW7A 3GROA 4QGFA 2IVZA 3WXBA 5DN6A 3WHKA 8OHMA 2DHQA 3OU6A 2AKEA 5EPUA 4ICIA 1H65A 3G6KA 2G70A 1T9KA 1NMQA 4ZOQI 5I5EA 3Q11A 4C5CA 1P8AA 2ANBA 4ND6A 3CZ5A 2VDPB 3BFXA 3SIPA 5ESDA 4G5OA 3RVDA 3WLAA 4LGCA 2EFJA 3JYLA 4INOA 4K6MA 3K70D 2FE3A 3VR1A 5DHRA 4JYZA 2YNMD 1N2CA 3W8NA 1G8KA 1V5GA 4QGHA 5BN4B 4C7OA 3R0ZA 2FPUA 1WHTB 5EZYA 5CPFA 3QVGA 5KG6A 1J25A 2NQ2C 3HB4X 2EYUA 1LGYA 4C0WA 4AMGA 4BLVA 3PR3A 2VDNB 3QG5A 4F4JA 1N8KA 3USCS 1G55A 2OZKA 1IPHA 1MC8A 4L0QA 1I01A 1XDBA 2Y0CA 3R7DA 2A5FA 1MUUA 4L73A 5FPRA 2QRVA 4NFHA 4JI2B 3ESZA 4JOCA 1PZGA 2EJWA 5A2QA 2FX2A 3Q7IA 4P38A 2C2RA 2C03A 3QLTA 5DNYB 4AWXA 5DBEX 2LDBA 4Y2UA 1DMSA 5KFOA 5KG0A 2ABJA 2HIGA 4DMRA 3EH2A 2ODWA 3C7KA 3T35A 2FWPA 1H2XA 3SYNA 1MXFA 4NMXB 1FYDA 5HFNA 1TJYA 3M6VA 4U6NA 4ZI5A 1JYFA 4LBZA 2C5EA 2Q62A 2FF7A 4URWR 3CUVA 1K6MA 1FP6A 1JKMA 5KC9A 3V6MA 5EXXA 5BMOA 3UJHA 1TO2E 1YI8A 4HX9A 4U7DA 5JJLA 3RUPA 1TLLA 5KYXA 3WGOA 2AZXA 2ZAIA 5DIZA 3DE3X 1UMCB 3CMAH 3RHFA 3QZ7A 4DLAA 4JT8A 5FTNA 2WZQA 5L3ZA 1JX4A 2PUGA 1TJ3A 5JECA 4R9RA 3IS3A 2IUEA 1UMKA 1QTNA 4Y9RA 2WOOA 3CJRA 1V8FA 4GYYA 2PEZA 4XB6B 3VOTA 2I7DA 3F5MA 3QU9A 4IXMA 1QLJA 3ET4A 1W7AA 4MPRA 4Y2VA 3CU5A 3GMDA 4OMFG 4XGQA 5HPYB 1UBKS 5GONF 2EIXA 2CJXA 1R8JA 3DGEC 2EIHA 2C8JA 3DZDA 1ISGA 3DTVD 2QEXH 1ZNQO 3AOEC 2XNDA 1GQSA 4XZ3A 5FX2A 2VK4A 2GKSA 4OYHA 4P3KA 1QYDA 2XVMA 1I7LA 3A9CA 1BFUA 5CK4A 1ZOLA 3EIQA 5LMNH 1RJDA 3OX2A 4IF6A 2G9RA 1LD3A 3AVTA 4UULA 1KY5A 3H9GA 5FUVA 3OETA 3K0EA 3TD2A 1EUCA 5IS2A 3JARB 2YXLA 4Q9DA 1L4KA 1Y6ZA 2IYPA 3BRWA 4RF5A 2YUTA 4RV9A 4IMPA 1PG5A 1P4SA 4LF8B 5I5YA 3RVLA 4I9FA 2F8MA 1PV4A 1UOPA 1F8FA 3K92A 3VR3A 3A6KA 3FMGA 4BVEA 4IL5A 1T1EA 1UPTA 2KPOA 3GYBA 2E2IA 2ZB4A 4BY7G 1NC3A 2XDQA 4N7JA 4PYNA 5FJIA 5FOQA 5JNUA 4Z4IA 2IHJA 4B74A 5LP6B 5FLEX 2LDXA 2OILA 4Q9NA 2R8OA 4XYMA 1MVLA 3P9KA 1DOZA 1PYGA 1RJ9B 3T4EA 4QTYA 3HJCA 3OTWA 4UHEA 4BFCA 3L43A 4R1LA 2J41A 2WJ4A 1EGHA 4LHEA 5DTEA 1THZA 1P0QA 3L5KA 2P2YA 1LSOA 2RBKA 1K88A 2A5YB 2JPDA 3K71B 3E7PA 2A0FA 2GPBA 1VDMA 2JGMA 3DXXA 3HCFA 3NHKA 3K09C 2HZ7A 5B4UA 3JAMA 2MIIA 1A3GA 3AESB 4X7PA 5AKZA 3F2VA 1DS6A 3TFOA 5C7IO 1E3QA 1DIOB 5KFCA 2X7XA 3DAHA 3IAS6 2ZRIA 3QTBA 3U4IA 1N48A 5JADA 1EPUA 3X1DA 2LVBA 1GUYA 2I1LA 2WAMA 3NP7A 3FVQA 1W2WB 3ZGLA 1JDEA 4KLZA 4DR2B 3JW8A 3A04A 2POCA 3MXOA 3B51X 4F11A 3EVGA 4KWEA 1GSAA 3WI7A 2UVRA 2Q3CA 4MOWA 1BOOA 1JLRA 5BYKA 3WJAA 3I4MG 1X1TA 1H0SA 1L1FA 1YRLA 3G59A 1XZPA 4MRMB 2QYOA 5KBYA 1SEPA 4L75A 3ANSA 4QWAA 3O75A 2ZVPX 4G9GA 1IZ7A 3PGLA 3L8DA 1ID8A 4AY3A 4YBRA 4YGYA 2BGIA 3CE6A 4KMMA 3DNMA 1T2FA 1R0ZA 4YRLA 1LPSA 3P20A 1QV9A 1EKXA 1WKBA 5I7EA 4R71A 1TQ6A 4AM8A 4KAJA 3OPMA 4D99A 2IDJA 2IP4A 5TPZD 1XVTA 3S1AB 3SZ3A 1PG2A 1Q0TA 4J07A 1KEEA 3A1VA 5FWXA 1E58A 4KDCA 1DQNA 2O3TA 1F0PA 4EGFA 3TTUA 1G60A 3GLTA 3BAAA 5L6LB 3L4PA 2C5FA 4ZOBA 4EKNB 4Q7KA 4AJNA 5IT4A 4ACBA 2VAVA 3BQMB 2EX1A 5ALSA 3V3KA 3WXMA 4PTZA 3I2GA 1SWWA 3TZQA 4II7A 1H8ED 2F3SA 1ZIPA 1UKEA 4E33A 5KKCA 4E6NA 4ZHQF 2HXGA 3WAJA 4RU1A 4JP1A 4BX2A 2PX2A 5KTSA 5BN4A 4WJKB 1WHTA 3OZVA 3MOIA 3ZEAA 1RQRA 5DLPA 4F8EA 1FQKA 1LLCA 3NT2A 3VMFA 4KQJA 2J9FB 1A9OA 3N2EA 3RS3A 4LTDA 4RJIA 2J5KA 1N6KA 4FHDA 5DBIA 5CXUA 1BHQ1 2Q7OE 2WPDD 4P5EA 5BQFA 4LV8B 1CRLA 2OR3A 4CU5A 3D8RA 2IYRA 3CY6A 4RNMA 1XZAA 4PN7A 1KO5A 4DQLA 2FR8A 3HPQA 4DR7H 1JRPB 4BBRG 5K0FA 4G2NA 2ZWMA 3S2UA 1RP1A 3D6MA 2X2EA 2UDPA 2H29A 4EG1A 4WZZA 3D0KA 3CF2A 1MJHA 5A3SA 1PL6A 4HDSA 4BO9A 3SQOA 2IS1A 4B6QA 3JQGB 4TS9A 2ODBA 2WKQA 5HILA 1ESZA 5AW5A 3AJRA 2QRZA 4JUBA 1L5MA 2ZRBA 2I2AA 3AUXA 1Y5MA 3WLTA 1OXBB 1WKIA 4HVLA 2WVJA 1A95A 1A04A 4EBBA 1SIOA 1ZOPA 3UC9A 4C89A 1UMCA 1WXDA 1L5FA 5JAQA 1VGQA 2RAUA