3WNZA

Crystal structure of bacillus subtilis ywfe, an l-amino acid ligase, with bound adp-mg-pi
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
465
structure length
465
Chain Sequence
b'KTVLVIADLGGCPPHMFYKSAAEKYNLVSFIPRPFAITASHAALIEKYSVAVIKDKDYFKSLADFEHPDSIYWAHEDHNKPEEEVVEQIVKVAEMFGADAITTNNELFIAPMAKACERLGLRGAGVQAAENARDKNKMRDAFNKAGVKSIKNKRVTTLEDFRAALEEIGTPLILKPTYLASSIGVTLITDTETAEDEFNRVNDYLKSINVPKAVTFEAPFIAEEFLQGEYGDWYQTEGYSDYISIEGIMADGEYFPIAIHDKTPQIGFTETSHITPSILDEEAKKKIVEAAKKANEGLGLQNCATHTEIKLMKNREPGLIESAARFAGWNMIPNIKKVFGLDMAQLLLDVLCFGKDADLPDGLLDQEPYYVADCHLYPQHFKQNGQIPETAEDLVIEAIDIPDGLLKGDTEIVSFSAAAPGTSVDLTLFEAFNSIAAFELKGSNSQDVAESIRQIQQHAKLTAKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanine-anticapsin ligase BacD
publication title Single Mutation Alters the Substrate Specificity of l-Amino Acid Ligase
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Ligase
total genus 142
structure length 465
sequence length 465
ec nomenclature ec 6.3.2.49: L-alanine--L-anticapsin ligase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13535 ATP-grasp_4 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3wnzA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3wnzA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wnzA01
3.90.1170.60 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Aldehyde Oxidoreductase; domain 3 3wnzA04
1B6SA 1IOVA 4HNUA 1AUVA 2HJWA 2VQDA 2R6FA 1EUDB 2ZDQA 4FFLA 2NPOA 1GLVA 3VPDA 3G8DA 2YZNA 2SCUB 4MA0A 2CNQA 3BG5A 2R87A 1EUCB 3KAKA 5JQGF 2NU6B 2R7LA 3UFXB 4IIJF 4WBNF 2YWVA 2I8CA 1JKJB 1OBGA 5I47A 3OUUA 4EAAA 1I7LA 1Z2OX 2PBZA 3BSYA 3AX6A 3OUZA 4C5BA 2XD4A 1Z2NX 2YZGA 1T36A 3ETHA 4O4LF 3SE7A 3R5XA 3Q2OA 4ME6A 4O7NA 2W6QA 1KC7A 4YAJB 1KEEA 3E5NA 1EHIA 2ZDHA 2CNVA 5LA6F 4YBZB 3KREA 1A48A 2W6NA 4IWYA 3R5FA 5EZYF 4O4JF 4TUYF 3DF7A 2CZGA 1M0TA 2YL2A 4O7ZA 4MV4A 3U54A 3K3PA 2DLNA 2FPPB 4FE2A 4O2AF 5GONF 1EYZA 5IYZF 2R86A 5C8YF 5BMVF 1KJIA 5JVDF 4HNTA 2Z02A 4HR7A 1JDEA 3RV3A 5C1PA 1W93A 4FFOA 4O7YA 3HBLA 2R82A 5FNVF 4EA7A 4O7RA 4TV8F 5BPFA 4XX0B 4WD3A 3V4SA 2FPIB 4M9CA 3WO0A 5KX5F 4FFNA 2NUAB 1UC9A 4ZHQF 5H80A 5K2MA 1Z2PX 3ETJA 4O81A 3KALA 5CB4F 1CQIB 1GSOA 2PVPA 1KJQA 2GPSA 4MV3A 3BFPA 4QSHA 2R85A 2WYOA 1CQJB 3BSWA 2YS7A 3U9SA 3KAJA 3VA7A 4MV7A 5CAEB 3VOTA 4DIMA 4MV8A 1E4EB 2P0AA 2I87A 4MV9A 4MA5A 5DMXA 3Q1KA 4O7TA 4ZQIA 4ZOLF 1SCUB 1M0WA 2W6ZA 5LXTF 3U9TA 1ULZA 3ORQA 4FFPA 5C1OA 5LYJF 1KJJA 1M6VA 2YRWA 4O4HF 4YAKB 4I4TF 4I55F 3LWBA 3VMMA 2VR1A 1DIKA 4L1KA 4IZOA 4EA8A 4XYLB 4GGMX 4O4IF 5JQWA 4IWXA 4YJ3F 2IP4A 4O83A 3R9RA 4O2BF 2YZLA 3TQTA 2HGSA 2R7MA 4O7SA 3JRWA 2QK4A 5HBRB 5J2UF 1C30A 4O7WA 4I50F 3HO8A 1CE8A 3R23A 1KUTA 3MJFA 4J6EA 4NYEA 5D8DA 4E4TA 3JZIA 1EZ1A 1I7NA 2FP4B 2DWCA 3R5HA 2YW2A 3JZFA 2V58A 1E4EA 1GSAA 5JH7F 3MWDA 2PN1A 2V5AA 4M9UA 1JLLB 4O84A 3GIDA 3JRXA 2NU9B 4Y8VB 4EA9A 3N8DA 2ZDGA 1OBDA 3MWEA 4C5AA 3TIGA 5LP6F 1AUXA 1C3OA 3RUPA 3BSSA 1VBHA 2X0SA 4HNVA 3LP8A 3TW6A 2YYAA 4XYMB 3WO1A 2GPWA 4FFMA 5LOVF 3V4ZA 1GGOA 4O7VA 1JDBB 1KJ9A 4FGRA 4EABA 4YB8B 3K5IA 2YZMA 4EGJA 4O82A 4EG0A 2W70A 4C5CA 3QFFA 1IOWA 3RV4A 3AW8A 4HQ6A 2Z04A 3TIIA 4MAMA 4IHJF 4RZQA 3RFCA 2DZDA 5CA0F 4M99A 1DV1A 4M98A 2R7NA 3GLKA 4MV6A 3U55A 1KJ8A 2DIKA 1PK8A 3K5HA 4O86A 4FFRA 1BXRA 4O7LA 2V59A 2W6OA 2YRXA 4FU0A 2CNUA 4ZI7F 2GQRA 1VBGA 3VPCA 1UC8A 2XCLA 4MV1A 2W71A 2VPQA 1WR2A 2NU7B 1BNCA 3I12A 2W6PA 4EGQA 4YJ2F 1VKZA 3N6RA 3NUAA 1DV2A 5J2TF 1W96A 1CS0A 3WNZA 2R84A 3G8CA 2NU8B 2FPGB 2QF7A 2VHEA 5JVLA 2C00A 1PX2A 2YS6A 5CA1F 5BPHA 2I80A 2OLSA 4TV9F 1KBLA 3VPBA 1GSHA 2FB9A 2GLTA 5HV6A 2R7KA 5KKNB 1B6RA 2CQYA 1A9XA 2W6MA 4XZ3B 3HB9A 3TINA 4DLKA 3ORRA 2J9GA 2GQSA
chains in the Genus database with same CATH superfamily
1A8SA 5CLQA 3RB6A 2QE7D 4LDNA 4BBAA 2ATXA 2AVDA 2C7RA 2HLHA 4GBMA 1GLVA 2FMKA 2NXJA 4UNSA 3HJGA 2B25A 1ZQ9A 3UK6A 1W581 1PK9A 2MMCA 1T6NA 3ENWA 1CU1A 3QX8A 5LLSA 3E6AA 3IBCA 4U2FA 5ABPA 2GSDA 2IRWA 1VCNA 3A0RB 1R5NA 4CWAA 2FXVA 3AG5A 1CFZA 3LA8A 1D2AA 1V26A 2Z4SA 2QN2A 2JVJA 1P7VA 4PSCA 4O7NA 5EWMA 3CUTA 4CFSA 3ZI4A 1LBIA 3OKPA 4WEOA 4R9VA 2VQ3A 3RAXA 4EPVA 4J0HA 3IFSA 2G83A 4G8DA 5JPDA 1QH0A 2C5GA 2EQAA 1ZIOA 2CZGA 1GPNA 5FB3A 1K9MJ 1P45A 3CY6A 3LX4A 3R76A 3WFIA 1XZLA 2JGNA 2Z6UA 1NULA 4J2OA 2ZB8A 4F3TA 2VCEA 2YVKA 1Z13A 4HKTA 3DMPA 1M8GA 5JSHA 1RI3A 1VBFA 3GEPA 2PVSA 3L7KA 5EMHA 1GVNB 4GA4A 4HXEB 4J0IA 4LHVA 3WAKA 1XN1A 3D7SA 4C6HA 1AIPA 3VR0A 3GLVA 2XQVA 4C0SA 2WWTA 2ZIWB 2Z5GA 3AU9A 4HCJA 2IT1A 1I0LA 5BMVB 4CMIA 3G2OA 1XELA 4PN3A 3H5LA 4R98A 1I5RA 4HUJA 3PTZA 3OZGA 5LYJF 3OZ7A 2X8AA 4CQLB 1ZM9A 1TB4A 3H04A 2ZBDA 1EKXA 3OMXA 4MUBA 1UBFA 2HHJA 4CMEC 1UEJA 4U2EA 3RUEA 1QGZA 2IPNA 5IWCA 1DKUA 1GAQA 1FF9A 5HDBB 3A1DA 3OJXA 3A1NA 3M5WA 3GBVA 3PFHA 5HFJA 5FWXA 2AMYA 3WRWA 2AHRA 4DV3H 4ID3A 5CFPA 2C7VA 3RIZA 2IUTA 3Q3HA 4ZZ0A 1I3LA 4LC0A 2BFDA 5K6AC 2FW9A 1Y7IA 2Z98A 1YJ9H 3G5LA 1T25A 3AFNA 2QG6A 1OHHA 4LISA 1QV7A 3T1VA 2EW2A 4WK0B 4FSDA 3FTFA 1W36D 2Z57A 1BE8A 1ZUIA 3FJYA 1M74A 4GMFA 4DZZA 4HGQA 4RS3A 2DLCX 4FMCB 4YAOA 4R3WA 3T38A 3H4DA 1V9LA 4ZYZA 3AFMA 4GKAA 2WK5A 4UBOA 5IANA 5IDXA 2ZAYA 1AN7A 2YQZA 2BFOA 4BUCA 4JLNA 1GT91 1Z34A 4GD3Q 2CLEB 3TIIA 4YUAA 4BY7G 3CB4A 2AC4A 4IO9J 5CG2A 4KTVE 4PC7A 4MS3B 4CL8A 5KX5B 1N1EA 2IY7A 3VZQA 4MV6A 1MC4A 3DMGA 4HDAA 4KQ2A 3PDWA 2CVPA 1DAGA 2QUAA 3M9NB 4K9NA 4BC0A 5HP4A 2IY9A 5JU6A 1YTKA 3L4BA 3LRTA 1JPUA 3G8YA 1KP9A 2RH9B 1MJNA 3OLVA 4DWVA 4DLWA 3CQZA 4L27A 2EZUA 4F45A 1G21E 2L18A 2VYND 3KEGA 4W1RA 1II8A 3IVAA 4JLKA 4QEZA 1XQYA 3C5HA 4PGGA 4ZK6A 4RJJA 4IHKA 2JZNA 4PNPA 1W5EA 3JQBA 1N25A 2FVYA 4DNPA 1E2LA 2FPUA 1Q81J 2VNAA 3GTPA 4X3CA 3WWPA 1UBJS 3Q0EA 4EYKA 4OUDA 2P5TB 1H2EA 3E3NA 4FR5A 2Q8QA 2HZ7A 2XYPA 4P7JA 5ECGC 1I7DA 1CRLA 3R3VA 4BBZA 4QO7A 1CJBA 2UXCB 3JYLA 1EUDB 1KRWA 1QFZA 4I9AA 1U1EA 2AMJA 3OMWA 4ZYXA 4J94A 4Q8EA 1DQPA 4FN5A 2D8AA 1BX0A 4K2AA 2R68A 5KFCA 1QOQB 1XKQA 1GYFA 1JFVA 5KFDA 4JYAB 4CG1A 1RXYA 4AY2A 1HG1A 1D2CA 1MTOA 1RABA 5AW1A 1U94A 1X8KA 4EPTA 4QPPA 4EVSA 3OZBA 5LL6P 1NYLA 2JVIA 3R6WA 3LBHA 1PJSA 2NSYA 3UAYA 2CNVA 2AXPA 3AF3A 4BNDA 2BHTA 2B8NA 3B38A 3AIIA 1ABFA 1HWYA 2EV9A 2V6MA 3GOQA 3SBEA 3G2QA 2GM9A 3SQOA 4UVEA 4DJ5X 2GVZC 2PL9A 1A27A 4DR2B 1YBHA 4LY0A 4A9AA 3OX1A 5EIOA 4X20A 1VQ5H 1P33A 2GXUA 1C7JA 1NQUA 2JRLA 4Z3KA 5IKEA 4H3SA 1D3AA 4JQYA 3EDRA 1X86B 3F2VA 3O8RA 1IZ7A 3HP4A 2HA7A 1TAHA 4V03A 3D6AA 3LYLA 2JI8A 5KT4A 4DV6B 2HAEA 3MTIA 5JWHA 5JIBA 1WU8A 4HPXB 1JKIA 3F8SA 2EHJA 4OAQA 1EVEA 1TPYA 1AS2A 3P0IA 3PG5A 5F98A 2OBNA 3ENQA 1NAHA 3RTBA 3LT5A 2V7UA 2OV4A 2V7BA 1VQ7H 4G89A 4URFA 5KDDA 3D3KA 3NZEA 2FN3A 2HD4A 4OATA 4YP9A 1Q7EA 1VFPA 3U7EB 1LJ8A 3KUXA 3EXG1 1HZZC 1Z45A 1QFXA 5D3MB 2XB2A 4YYYA 1MH9A 5CBPA 4KG7A 2V7VA 2ADOA 3TQTA 3BMCA 4LFAB 4I50F 3VU1A 3R3UA 1LUAA 5FCDA 4E94A 1E6EA 5MGBA 3QRWA 2NT4A 1EZ1A 2Q27A 2BEVA 1BCSB 1PWEA 3O1LA 4ABYA 5LNK6 4BO9A 1T4GA 1PFWA 3EBOA 4HNRA 4OAOA 1RAAA 1ZH0A 5K0TA 2JCGA 3FCUB 2C22A 1OWMA 3PRJA 4BFXA 4LXHA 4A8TA 5DISC 2Z3WA 3RVSA 1VJCA 3WMEA 3ZI7A 5EWGA 4E11A 5CMLA 2PM8A 3C7TA 4MLDA 4J07A 1SMKA 4Q3CA 4YMIA 4LI0A 2AZMA 3BA6A 1C3LA 4YPFA 1W5FA 4DSZA 2XIJA 3B70A 3BMQB 1FRZA 3VZRA 3GXOA 3UEOA 1DAMA 3G02A 4INOA 1K98A 1QDUA 3LDAA 3ONNA 4LFBB 3EZXA 1CIPA 1LEHA 4ZQCB 1XQ6A 1FLNA 2EJUA 4E2XA 5BWMA 1MO2A 1GO3E 1W5TA 3NIGB 1M54A 3JQAD 5DG9A 2O2EA 1E2MA 2QV7A 4MUIA 1YDFA 2P79A 5HGJA 3AF1A 5JUMA 2B3TA 5ITZA 3LY5A 2AOXA 1ECGA 3QU7A 5KNCH 2XB8A 1EXVA 3GDFA 4O6VA 2ZUTA 2N9UA 4H7IA 5G0UA 1QZZA 4QOGA 5HNEA 2PX2A 5JARA 5JS7A 2QV0A 4G24A 4EG6A 5EGNA 2OM2A 3CR3C 5D6OA 1G3RA 5F2OA 3RHZA 5DI9A 3GQBB 2XQJA 3NOVA 4LE2A 1NJIJ 1CT9A 1CNMA 5G1PA 3H1PA 1XTUA 5ELXA 2VDUE 4PHGA 2V7PA 3E8MA 4M38A 4KLNA 2JFFA 2ONZA 4Q34A 3QTBA 1FMAE 2HEGA 3UGKA 3CT4A 3ZH2A 4OQNA 1S68A 3TLBA 2IQIA 1YRLA 4KXQA 3PXDA 3NR2A 3RKSA 1A9RA 4E2FA 1KTIA 1MB4A 1EUYA 3PL1A 2LCQA 5FA6A 3A2NA 1ZIXA 1LVUA 3HUFA 4UU0A 5TF4A 4X85A 3QJYA 1PLLA 1U04A 3ETNA 1NXWA 3OAAA 3T61A 1QHFA 4XGIA 3WG9A 3OWOA 1O4WA 3KT0A 4HB0A 3Q2OA 3IVGA 5A7FA 3UHOA 3FMGA 4DARA 3QXCA 1OC4A 4RMHA 1Y1TA 1QRRA 4WPGA 1VHJA 2IHNA 2IDMA 2C5BA 2H2IA 3RTXA 4A3EG 4LVUA 3WL8A 1QP0A 5GY7A 3SKYA 1WPQA 3EDOA 4RNCA 4GA5A 4X60A 3R20A 3WA7A 1XV5A 4I4IA 4QJ5A 3F5SA 5FYDA 1FU7A 1YDEA 2UUAH 1U2ZA 5HS4A 1CUWA 1P7WA 3C0KA 1U0JA 3HJFA 1MVNA 2PT9A 3U4DA 3AM9A 2PKEA 2XA1A 1AHHA 1KSGA 4ZHQF 3E5HA 4O4JB 2Z8YM 2WKSA 4I5FA 1Z6YA 3RGWS 5DN6A 5EWJA 2GBFA 3DT9A 1RMYA 2E2IA 4PLPA 1O9HA 1TF2A 5THQA 2VK4A 2JFXA 1V41E 3MJEA 3AJDA 4UXJA 2AIRA 2UVDA 2L69A 2EZ9A 3W2IA 1NM5C 3LBIA 2BE9A 4I3GA 3HJUA 1FS4A 4EX7A 4EGSA 1D1TA 2D2VA 1EAMA 1JKMA 5HE9A 4DLLA 1WKIA 2C84A 4O7WA 1ZSNA 3GFQA 5CLJA 1U4OA 1CKEA 5BYBA 3ZJYA 1QP8A 2FP4B 4EW3A 4U2KA 2IYUA 2JJMA 2OB1A 3QF4B 4GL4A 1IZ0A 3X1ZA 3N5KA 3GJ0A 4A36A 1VHLA 2BKAA 3FZGA 4C1NA 4IRKA 2PUVA 3O0TA 2WA2A 1S0MA 5ERXA 4M89A 4OHPA 2XGQA 3FTEA 3PUHA 3BH0A 3GH3A 1INLA 3NEJA 1YZ3A 1MO4A 1WAMA 5IZ4A 2QAJA 5TQ0A 1B14A 3UAZA 2HFKA 4J7UA 4ZVQA 3M6AA 3GV8B 2X7XA 3DE7X 3N41B 1ADYA 5CM9C 2W2NA 1RYMA 3IHLA 3FNGA 5LMNH 5I9SA 1AGPA 1W0KD 1UADA 5L6LB 3U0VA 2I78A 2FFJA 3MWYW 4L8WB 3BREA 4DCPA 1DBQA 4DR6B 1U7UA 1MNAA 2RGEA 4OXRA 8MHTA 1SZDA 4JK3A 1D0SA 3E03A 3KYHC 5I01A 3QW4B 4MICA 3AQ4A 2COUA 1T8PA 3I37X 1H5NA 3VZPA 4QUKA 1WMAA 2NLOA 5BMVA 4YAUA 5F9LA 2FSUA 4OYHA 3VKGA 4G1BA 3FH0A 2Q1XA 3G9ZA 4U0JA 4S04A 1PZNA 4CQLA 2Q3JA 3SYRA 2G4VA 2AF4C 5K3DA 3S6JA 2W2MA 4P92A 3VU9B 2N3ZA 1KMHA 1PS8A 3ASZA 2WM3A 3ROZA 4LNUB 3TEJA 4HLDA 4GA6A 1SWWA 4XW2A 4PWQA 4EH1A 3ZHSA 2D7CA 5JEEA 5H8WA 3WAGA 4CMEA 1EFPB 4F8YA 4Q16A 2B5VA 1XOIA 5C7LO 4HNUA 1XTJA 4XKJA 2PUCA 1HMYA 1IBLB 4CM9A 5L3VA 2X1HA 1T4DA 5F7OA 3V7WA 1F8GA 3KHRA 4OYRA 4QZVA 1IRXA 2Q4EA 4UAUA 3K9GA 1N8SA 4AUKA 2VUIB 5K6AA 2XV1A 5LMCA 4J75A 4YDHB 3C97A 1P1JA 3MWEB 3CGWA 4UFNA 3KEOA 4B8ZA 2G0TA 2OXEA 4J9MA 1YS1X 3F4KA 3SE7A 2FF5A 3W1VA 1XMSA 4QQRA 4IV8A 1H9AA 1ZD5A 3FGNA 4M1MA 1SKAA 1E3IA 5FQOA 5KFEA 4BEBA 1ULBA 4Y0NA 3W8RA 3O8OB 4YP5A 3ROTA 4TUYF 4U3JA 5L9XA 1MKYA 3ONEA 3K3PA 3VO2A 3GMTA 3W6OA 5GJBA 1M66A 2IXFA 3S5JA 4PIPA 3W5AA 4MS3A 1ZOOA 4L75A 4N5LA 1XDDA 3COSA 1RRMA 1T3ZA 4POAA 2MSKA 4CEIB 4M21A 1H3EA 3HHPA 4F2PA 1XNQB 1UIMA 2PMZE 2XUQA 1FY2A 1RXEA 3WGJA 2VHCA 5E25A 5A9TA 2AJLI 1N57A 4KJXA 4EUNA 3L04A 5C3MA 4E14A 2GFQA 3BGSA 4AU1A 2XA2A 3KVYA 5IVPA 4BXOB 4A0HA 1OROA 3TF5A 4UEJA 2W58A 1QJCA 1YI1A 4ARSA 3G2LA 3ZHRA 1MIHA 5K6TA 1M6HA 4MQBA 3MCWA 5CT6A 4KU4A 4ZTBA 1FIQC 3ENKA 4WECA 2QIEA 4YIKA 3NAQA 2IYEA 4RS4A 3DWEX 1F17A 3C6MA 1ZOPA 1EWRA 2JLBA 4HWTA 4E7OA 5LKAA 4CKBB 3LBNA 1EUDA 4QT0A 2WMNB 4MVJD 1KPHA 4RY8A 1JPJA 4WXYB 2JBMA 4GPBA 1ITZA 2WJYA 4LKOA 4TLLB 3ZTTA 1AQNA 4WFBJ 5A4DA 1G8SA 2RDMA 2FUCA 4JI8H 1NLFA 3T4PA 1OE0A 3QPUA 2WF7A 3BWCA 1TA8A 4Q9HA 1N5DA 2OWDA 3M1LA 1F4LA 3PW4A 2EXXA 2Z4RA 3QX7A 1V7ZA 3K1AB 5DHQA 1I80A 3ER8A 1C1HA 4A7PA 1KO8A 1MXFA 4PLTA 1M2VA 4TLEA 1QFSA 3VV2A 3ZD7A 4D9NA 3W2GA 4HQFA 1VG0B 2VF5X 5FTWA 4YDRA 2UZAA 1SR8A 4BMZA 1N3YA 1X0VA 3PE4A 4HVAA 2E4VA 2HADA 4NIMA 4F5ZA 3FPLA 4E3ZA 2COIA 2P9HA 3IOEA 2JASA 5E95A 4P0PB 3IUPA 4LRTB 4DL2A 1QBKC 4ASUA 5E9JA 1H4SA 4AYTA 3T4EA 5AM1A 4A0FA 4M8NE 2JI4A 2NZJA 3DL4A 4CM3A 6AT1A 3B9RA 2ODWA 2R6JA 2HTEA 1UWLA 5JANA 3SQMA 3FHLA 3N8NA 1QZUA 4ZEWA 1LWOA 1OT5A 3BXXA 2I6XA 5TMDA 1HA3A 2AR7A 4WFNJ 3WGZA 4LFCH 2PJDA 2ZROA 4OBBA 4MS1B 2AG5A 3TOCA 1F2DA 4RYLA 2ZE8A 3WMFA 3AZQA 3GRPA 5HBGA 2JZOA 3ANLA 1PSDA 3IUQA 1HYBA 5FOSA 5IKOA 1GQ2A 4MUFA 3GJ3A 3A27A 2DR2A 2HCJB 1QONA 5JRJA 3A1TA 3LQ4A 4BNFA 5ICFA 2JK1A 2PO7A 4XD7D 3WL3A 2AOVA 1PL7A 2EZ4A 1YVEI 1WS6A 1HZZA 4M0JA 1DDIA 1F8XA 1UBKS 2YC4C 1T35A 1U9YA 3MAJA 2H4YA 4UDNA 3OX3A 2WZQA 1UIRA 1QU2A 2I2FA 3FJOA 1N0UA 3PCTA 3QXXA 3SM9A 3KQPA 4MWSA 2HA0A 1OGYA 2K2WA 3Q9NA 4ISCA 4JI4B 4P4GA 3WK7A 3IO5A 3C3DA 3B6MA 3LUPA 1QH8B 4XVCA 2Q3LA 3QQMA 5KREA 2CDNA 2C9MA 3MHPA 1UXIA 3LS2A 3AKZA 4M1OA 4P3OA 4XTRA 4RSMA 4G0OA 5DWDA 5CD1A 3QEMA 1KE2A 4RBNA 1JIXA 4QOJA 2RHRA 3U4QA 2YZGA 5FRDA 1ISGA 5AOBA 1FVFA 2Y05A 2GM4A 1XNHA 4NMWA 2Z5FA 3V1UA 4MPJA 5K0SA 2AMLA 4J0JA 2XCOA 2ZJ0A 1T9AA 3BMQA 1RXUA 1R6XA 5FOQA 1L8OA 2O2HA 2ZT6A 1MR3F 3UXYA 1TD9A 3BWDD 1S3FA 4EKIA 4WV3A 3SDBA 3HVKA 5IXYA 1THZA 3BIIE 4ZEMA 4YRNA 4C0JA 3FYHA 4O4LB 1WUIS 2BGMA 4DRYA 1QPNA 1W1WA 3OQPA 2YMMA 3MS2A 5LBUA 5FOTA 2QM3A 2Y0PA 2J4CA 3KALA 1UEXC 3K32A 2X2FA 3NHMA 2W8LA 2Q3FA 3FTQA 4H4CA 3GLUA 4S1NA 4EYEA 1B7GO 3WMXA 2XITA 4OO3A 3EXAA 5C5IA 3GQBA 2R8YA 3P20A 2HM7A 3L8GA 3MD0A 4KO4S 2YHSA 2BGJA 1ML4A 4US9A 4UUQA 2VK8A 2QD2A 1WDTA 3T9EA 4CKEB 4B2LA 1TIKA 4UUBA 1NJSA 2I03A 3QEJA 4YRPA 5AKYA 1EK2A 4DB2A 1J8DA 3P9PA 3ENVA 3CG4A 4XIIA 3WB2A 2MTBA 3QKTA 2QS9A 1IBSA 1CUBA 5IKXA 2FLNA 4E1AA 2Y0DA 3T5AA 2O1XA 3GLIA 4B2YA 2WJAA 3KJIA 4F04A 1Q84A 4M1TA 2AZ4A 1IIRA 1KK0A 2V7WA 4XE5A 1FFAA 3R0JA 5DK4A 2BC9A 3EPPA 5TVGA 2HIGA 2JCYA 3P9CA 3NNNA 1U7DA 3MGAA 3R8CA 5KOHB 5M7EA 2P91A 3R5JA 5ARDA 3FVWA 1DO8A 4MHOA 1Q6YA 3OJOA 4EB0A 3VR6A 2QSJA 3GIMA 2FLPA 4WBNA 3ESQA 4XVQA 3DAAA 3D7KA 3CISA 5KT2A 4H9GA 1D07A 1Z8FA 3QVGB 2CUZA 3THOA 2Y66A 3AR4A 3UHAA 4IR9A 3AEUA 4LC9A 3CLVA 4EHAA 1Z4NA 3O26A 2B35A 2UV8A 5B1IA 5CFMA 1DKRA 5A4MS 1MH1A 1GR1A 5EWLA 4IUDS 4RPIA 4XLLA 3GIKA 3QPWA 4BLTA 4RHXA 1O6CA 4F3RA 4O4JA 1B3BA 1ACJA 3ZDAA 3KU4A 5AICA 4OK6A 4E15A 5DIZA 4R7GA 3AN1A 4KP7A 5FL7D 2XUGA 3T94A 3WX0A 5IC4A 1BNCA 3PDCA 3PFKA 1W75A 2DUMA 4K28A 1HMPA 4W5HA 5CR9A 3EIEA 4I55B 4L5JA 3C2RA 3H97A 2B94A 3TR6A 4QU9A 4DV2H 4GI2A 1GRRA 3WDSA 2PX3A 1P9LA 2Z2IA 4CEHA 1Z0FA 3W8EA 1OGIA 4HXYA 1C14A 4ZT3A 1F9AA 5EXTA 2PGLA 1CEYA 4WJKB 1YCDA 3OPYB 2CMKA 3ZGLA 1D1PA 3TFWA 1IMOA 3HUEA 1NM5A 2FP4A 3P8ZA 3TKYA 4BIIA 1IQRA 3QF4A 1Z5WA 2HJWA 1RLOA 3RJ0A 2I4IA 2JGRA 2NPOA 2VJOA 1VLHA 3ETGA 2HF7A 1PWZA 4MCJA 5KYTA 3Q5DA 1X7YB 2GK4A 1QBGA 3QLTA 4G0QA 1EQUA 2H0AA 3V7YA 4KIGA 4I3HA 3C0FB 1NXSA 3ZVKA 3KOWA 3JARB 2X5OA 3A1EA 2GCIA 1JNYA 4QQNA 4C4OA 4BYGA 3GV7B 3BCUA 2DCUA 3NHPA 3B6IA 4NLLA 2AA3A 1YR7A 1J5EB 1X2BA 5JSZA 4C04A 2WG1A 1W1UA 3NBQA 5T57A 3D3EA 3LP5A 1J09A 4K3VA 1PHRA 2X23A 2P2NA 3SIWA 4W4TA 4PCAA 3IS3A 1FNSA 2C1XA 2A0WA 5KOIA 1T8SA 2OVFA 5JAOA 3AETA 4XDHA 1XQXA 1PW5A 1V3TA 3VAYA 2OLKA 1G7TA 3BXOA 4C1BA 1AK2A 3O9ZA 3V32A 2GK3A 4FDLA 3TKAA 1SIWA 1CJKC 3TLEA 3R2JA 2EYUA 3UANA 4DDUA 4X62B 2IU3A 1XLVA 4AN0A 5ICGA 4WFJA 3CNOA 2IUUA 2QSYA 5K0CA 4R2JA 4HY3A 1L6IA 4CGYA 1O58A 1CQJB 1H9CA 1SKQA 2BDTA 2BTOA 5FOXA 1Q5PA 2A84A 2UZIR 4UTOA 2PSHA 3S70A 3VU9A 2IK8A 1DXHA 3LZ6A 2VWQA 3A0UA 2V6FA 4EI2A 3LI2A 3CVUA 4LNUA 4WBSA 5JJBA 5AP9A 4DMGA 4KH0A 4M7OA 4NENA 4MKXA 1RAHA 2QTWB 2H5JA 1Y9DA 1WO8A 3RARA 3RREA 4BE9A 1NMXA 4N0QA 1TM2A 3M6UA 3K1TA 2ESRA 2XMSA 2FR1A 5CYOA 1H2YA 2RKOA 1Z6TA 2J9XB 2I7CA 1PYDA 1DQZA 4GOOD 5H1SO 3U4HA 3CF0A 1FVOA 3D2LA 4NYIR 4D92A 3T7KA 4AP8A 5M3BA 3N2ZB 5C35A 2PANA 4CM8B 3KQLA 4GT1A 2AHOA 4U2CA 1R4MB 1P7CA 2Q3DA 3MWEA 4TWRA 3RR5A 4Q44A 3AP3A 3NOQA 5LQDA 1IVYA 1RBYA 2I7VA 3NHFA 4NY1A 3THWB 3NH6A 4PZUA 4HUQA 3HO1A 2XDQB 5TSDA 1V95A 3CNHA 2VOEA 1MABB 4BNWA 4JB0A 2QG9A 4LOIA 1AUQA 3B89A 3W8DA 3B52X 5LPNA 3CNLA 3OT1A 5KFPA 2QUKA 3C6KA 4UJ5A 3ADPA 4MJ7A 1NU6A 1W6UA 1Y80A 3WGHA 5DMHA 3DLAA 3STWA 5KQPA 1E1NA 2XY4A 1TEVA 4HDRB 1PDVA 1HXHA 4FYVA 4X6LA 4EQ5A 3MGGA 1FFGA 2G76A 2FUG1 2BD0A 2DKOA 2B61A 4UE3S 2R79A 1PBNA 3TW8B 2LPMA 1NX9A 4IRXA 4FHEA 1SHUX 2O03A 3L6DA 3H75A 3L02A 2GEJA 4XYMA 4GBJA 3QNMA 4PDBA 1ZVQA 4F6CA 2M98A 1M34A 2A94A 4BXOA 2JFOA 1UM8A 2VYQA 1Y5LA 2Q4BA 4LHZA 4O0LA 4YJ2F 4ZT4A 2UYOA 3GLFE 2FHPA 2JI7A 1T4CA 1ZN7A 1T15A 1A97A 3A9TA 1YR3A 4K7JA 4WZBB 1Y5MA 3AB3A 1YRBA 2WU3A 1XCPA 2DOKA 2VO1A 2VA2A 3ZEIA 4UHJA 4IBOA 4KYIB 1NSYA 3RUDA 1N2ZA 3ZR4B 1PQWA 1D7AA 1YJCA 1ZRSA 3MVEA 1A9XA 4CKBA 3O9MA 1R0RE 4KR7A 2FSSA 3KZVA 2R3SA 5EE9A 2JB9A 4JJAA 1GN9A 4QULA 3H1AA 3DOOA 5AXAA 2JCSA 5LXTA 3KG2A 3AI7A 4P3XA 2E9SA 3AHCA 3MTAA 3A6JA 4C7VA 4V38A 3BMOA 1EUCB 1UKBA 2Q46A 2SHKA 1X3SA 3QLUC 1I4OA 3IB3A 5KFNA 2Z8YA 3EULA 3SLRA 2C5AA 1EXDA 5KVCA 1GCAA 3K1AA 5BSHA 5KTPA 1ECCA 3RHSA 3VI4B 2BKVA 3VOAA 1IH8A 4FI3C 3I3SR 2GXSA 3DBLB 5AXBA 3KVRA 1YACA 4DLZA 1QC5A 4J3JA 4IJWA 5EP4A 2HN9A 3OO1A 1PS0A 1BG6A 5EZ5A 1U8XX 2P5UA 3D7RA 1DX6A 3CE9A 5D00A 1AHPA 1DKMA 1K4KA 4ZZ3A 1F60A 3PQFA 3RRBA 4TYNA 1XMPA 4FCVA 4Q3EA 3QZUA 2CUNA 1I3OA 1XZBA 1VB3A 1J70A 1VQNH 4WZAA 5JS1A 1ZS9A 5FD6A 2YZ7A 2QMEA 4KYTA 1IBRA 4E5MA 5AI5A 2ASEA 3GJZA 1E4YA 2G8LA 2CHFA 2Q4OA 3TX6A 4M0CA 3A6EA 3NMUF 1SOWA 3AL3A 3ZV4A 4LEIA 4A91A 2WAQE 2GKGA 5BR8B 1UFKA 2B5WA 4WCFC 1Q0SA 1U5CA 4MS1A 2PZMA 3TDNA 4XH9B 4OI1A 2QEXH 4P93A 5ALWA 2VF8A 2RHBA 1IFXA 4WCFB 4DHWA 1U4SA 4C14A 3U31A 1U8CB 4MUKA 1X9GA 1JWAB 1RPTA 4HLNA 4HX9A 1B43A 4RZUA 3PSAA 1JQJC 2WK6A 2CNDA 1VE1A 2R751 1S89A 1T24A 4JNKA 1NVTA 1T8RA 4E5UA 2WYUA 3K2EA 3NTXA 4IWXA 2VDVE 3WGQA 4MWEA 1JVNA 3BDIA 1U0LA 3F3MA 4J4HA 2E2HA 1L3CA 5BWTA 4MUXA 3B20A 3QU5A 3JQFC 1DAPA 1E4VA 5DQIA 4LF7H 4O3OA 3O4HA 5CA1A 2FEAA 3HBMA 1K6EA 3BILA 1P2VA 2IEGA 5MN6A 3QWUA 2O5RA 5IJ0B 3KSUA 2PRJA 2VH2A 3IRUA 2NU9B 1GZ7A 2QX6A 2XADA 1TYAE 4YMVA 1OBVA 3HC7A 2VFAA 1J0CA 2PKYX 1G5TA 1PI3A 5A02A 3PNOA 1GDHA 7YASA 5DBOA 3DE2X 2Q2VA 4X65B 4E09A 5GOTA 4MNTA 5BT9A 2DF8A 2HU8A 4F8JA 2UXDB 1X7WA 3GLGB 7GPBA 3VR2A 4RTQA 3K16A 3J7TA 3FPFA 3G2IA 5C7OO 3DS8A 1P39A 3OZIA 4I1UA 5JECA 3G6WA 2V0GA 5EI5A 1A9ZA 4GL2A 3E9EA 4B2PA 3RFCA 3B12A 4NBLA 2DZDA 3BWEA 4O4LA 4FTWA 1H6BA 4AFNA 3I8OA 3T7IA 5J1SB 4TGLA 2X1MA 1NONA 3AV0B 4G07A 3LSTA 4ZZ1A 4NPAA 4RU9A 2W8KA 1NR7A 2JG3A 5DYTA 4LA4A 1XK5A 2CLHB 2WK1A 2PZFA 4FZJA 3DKIA 1C7QA 3NNDA 4Z5XA 3K9WA 3GWZA 1XHFA 1LBEA 3FI0A 1ZNQO 2XCUA 3I5YA 1E8NA 4EF6A 1APBA 1UDBA 2NZXA 2QLFA 4CKEA 3MTGA 2PZJA 3DZ8A 4UZSA 1O8CA 2J5RA 2KSQA 2GJ9A 3ZVRA 4U2GA 4GSLA 4ACBA 4HTFA 4ZMBA 1IBKH 1KF0A 3EXHC 2A35A 4A3GG 2QN9A 1LI5A 3EVNA 1NZJA 3DF9A 1PR1A 3ND9A 1IEVA 4BKPA 2NVWA 1QKKA 3GGSA 4J1SA 1NJGA 2CW8A 3IP7A 2BGKA 1KC3A 3QVXA 3EXHB 4LXTA 4BQFA 2I6GA 4ER6A 4L8LA 3Q0TA 4GH5A 3ZZUA 1FS6A 4WY2A 5HCIA 3BJIC 2GO7A 3K72B 4BQQA 4ALJA 1ZH8A 5KOHA 4FMPA 2GCGA 4BTLA 2EX1A 4MW6A 1S2DA 1CUHA 4BU1A 1KRXA 1KSHA 3LK7A 2B4YA 5SYAA 4M55A 4FQ8A 3TCKA 3DGEC 2HGXA 1IEXA 2HPVA 4V0SA 5KTKA 3EHDA 1U1CA 3UUGA 4RF4A 5I8PA 2XMZA 2I99A 3LWNA 3QVGA 5E8JA 3IAUA 4MPRA 3T4XA 1A8IA 1PJ8A 3U54A 4ECVA 4PG5A 5A3SA 2ILVA 1Z25A 1JA1A 1SCKA 5T41A 1A5BB 1T9ZA 5AVOA 3VNQA 3HBLA 3T1OA 1QXSA 2RHGB 5AW0A 3B9QA 3F1LA 3QXJA 1UPCA 4B84A 4FS2A 3DDWA 1KEKA 4AKIA 4N12A 3M4YA 3AB7A 421PA 1YK0A 2VDWB 4UMVA 3K70D 1D03A 3L7IA 1P2BA 4P4UA 3JQDA 4YLEA 1EK1A 4YRZA 2QVLA 2VT2A 5D3ZA 3LHKA 1GPWB 1X7ZB 2BP7B 2ZTMA 3OF5A 1RNLA 2JJQA 4JSTA 3I72A 4D9IA 3MB8A 5B1SA 3PFNA 2OZPA 1PWHA 2C2ZA 1C3OB 2AK2A 2AN4A 1RZUA 3AWDA 2NVYA 5DGIA 2X14A 3P9SA 3VGPA 3TRFA 3U37A 1OAOC 1P75A 3PNPA 4J1TC 1RJQA 1KU6A 2QD3A 4M8LA 3ZJTA 5KNDH 4LY9A 4NZ9A 2PKWA 5EJIA 3UJ7A 3C3KA 1I7NA 1KZ1A 2VIIA 2C2GA 4QOHA 2HIHA 1Z0AA 4LOLA 1X7YA 2PUHA 3L49A 1JUDA 2OOKA 1P8LA 2IA6A 4WN9B 4U6QA 1D6NA 3U3OA 1N4DA 3WK8A 1OPRA 3VC1A 2P40A 1HT2E 2VJDA 4HDSB 1TUEA 1BA2A 4LJKA 2G88A 3WGKA 2J87A 4GMGA 3GNTA 2NSLA 3GNLA 2FCRA 3N2KB 3V4ZA 1AKTA 3LRXA 3OHSX 3DUFB 2Y0SA 3C98A 3K5IA 5AM2A 5LC1A 5DH9A 3MJCA 3H1EA 3VGJA 2VHJA 1UH5A 4TMWA 4LF5B 5K6RA 2C03A 1GG8A 3TQHA 2I3DA 4KLRA 4B3JA 3PVXA 4DEVA 1YNOA 3FVTA 2GBCA 3F8WA 3NLLA 4N5IX 3RUFA 2VHTA 1N62B 2GYYA 3ER6A 5AW5A 4B3RH 3GLKA 2O05A 5EINA 2OCPA 2HRDA 1MC5A 3PRHA 2ROQA 4DV7H 1K3FA 2SNIE 5TX7A 3BAZA 1L7XA 1NSTA 1PNTA 1YHYA 3DCNA 5HUHA 3COZA 4D8YA 1A2KC 1QR6A 1L5LA 1LA2A 1TYDE 1MPTA 3IC5A 2DFDA 3I5MA 5KYUB 2W00A 5JVHJ 1KEUA 4H3HB 2WU8A 3O90A 4P5DA 4N7JA 5B2EA 5HF8A 5IJZA 3HT5A 1RI1A 1MEJA 2NZVG 3UIEA 4HLCA 1TXGA 3L9WA 1JEOA 1QE5A 4BMSA 1CKMA 1QVGH 4M1EA 2V7EA 1WM1A 2AD1A 1G5RA 3P96A 4GG1A 4LC1A 5JFOA 4OQFA 5ED0A 1VC2A 2HDWA 3CRNA 4DV5B 2HQ1A 1B74A 1LZLA 2DMRA 2J3JA 4IOCJ 1M2FA 1JAXA 3PPVA 2W6JA 3R7WA 2YZNA 4IV5A 1NDUA 3PUWA 3HB4X 4ZYUA 4CM8A 3TQFA 3ZDCA 2CXOA 1V39A 2NU6B 3S1LA 4NARA 2Z08A 1Z4QA 1OAAA 3FOAA 1TE2A 1G20E 3THWA 3G89A 2J3DA 2UVPB 3HDVA 4QBHA 2FWPA 3QMVA 4N6OA 2GPAA 3AUJB 5CP8A 4C5BA 1Y6RA 1RCFA 1DIRA 3NAZA 1NI4B 4X97A 1SVLA 2Z43A 1DFHA 3W3AD 5JPCA 3PLAE 4BZXA 5EYPB 4FYXA 1F5NA 4XASA 2OC9A 3OEYA 3HWX1 1IM8A 1YZGA 3Q6IA 4QE3A 3GJSA 4J0DA 3OKFA 1M7BA 3KSRA 3TRHA 4BBSG 1L5RA 4F6RB 4LHYA 3TW8A 3A1CA 1EP2B 4JJGA 2DUUA 2E3JA 2CFCA 2AUMA 4NBUA 1XRNA 2BRUC 1CTQA 1OR8A 1JHVA 3D0RA 3G0IA 5FWYB 4IDAA 3GILA 2FZWA 3DA8A 2A2ZA 1NQ5A 1T4MA 3OHMA 1Z2PX 5CFLA 3AM4A 1GSOA 4JH0A 2QL9A 2XCQA 5EIWA 4TVSA 4HRVA 1F0PA 3DE5X 4M0KA 4C0QC 1R4ZA 2FA9A 3REOA 5IF9A 1GGJA 5GZ6A 4OXIA 3H9QA 5I9BA 4GRDA 2GJSA 2JCBA 5LZ8A 3ZW8A 3LGSA 3H3FA 1ZMTA 2XMDA 3ZWCA 1Z5GA 3OA0A 3NC0B 3OZSA 3B1WA 1VJDA 3SHWA 9LDTA 4KE8A 3OCJA 3WB9A 3R9RA 2HBYA 4A6PA 4KNVA 5DKFA 1GZSA 1PJ4A 1VQLH 2EKBA 2FFQA 2NTYC 1AD2A 4PYMA 2K4MA 4S1WA 5KDLA 2RGAA 1YOVB 2CNOA 3R23A 1GILA 2B83A 2D0OB 4DNOA 3PXBA 2OBFA 3HG7A 4TRRA 4X95A 2IOYA 3ZHOA 4IIJB 4B44A 1KAEA 1FLVA 3KJHA 1M0SA 4TV9A 1UJMA 3GIDA 4FSHA 4BVJA 4U2DA 4YS6A 4L16A 1KORA 2QTVA 5F3RA 3QLUA 3N40P 4JSYA 3S2SA 1E3EA 3RYHB 4PO8A 1GGOA 1JTFA 1P60A 1BRWA 2QZ4A 2WY2D 4KQIA 5AJWA 3U40A 2OOSA 3CWCA 4AJ1A 4QOSA 3UPTA 2HVSA 2FEKA 4NR0A 3HNRA 4J8PA 1EJ0A 2F8TA 3LNTA 3C3AA 3HB0A 4L22A 5H82A 1MIOB 4Z0NA 4P3NA 5IP5A 1BRMA 1Q0PA 4WFQA 1G2WA 3FOFC 5HILA 5L45A 3FX2A 4IL5A 3ZHCA 1Q95A 1US8A 5A4KA 4CMJA 2WUFA 4CKYA 4YCCA 5BN3A 1H2FA 3D9QX 2C7PA 4N5MA 2J0EA 1UR5A 5EA2A 1GUZA 1GG2A 4WCFA 2C2XA 1NVMB 1T5SA 1C7FA 5L95A 2X9VA 5GJCA 1M5RA 4TMTA 4C4PA 1UQUA 4BZPA 3ZKWA 5FPQA 1JVBA 1LDNA 1X13A 3QYAA 1CEXA 4AZ0A 3MOSA 2A59A 1XEXA 2GO1A 3MJ4A 5A9RA 3D6TB 2A88A 3WZ2A 5BV7A 2HMYB 1A8HA 3CEPB 5KVQA 1KI2A 3DO5A 4FONA 1Y6JA 4NCHA 1KO7A 4O25A 5J4VA 4RLHA 3STVA 2HMSA 3O3OB 2BW0A 5IJ0A 3JQFA 5AW3A 1K7XB 2NU9A 1U65A 1OH7A 4BV2A 5I45A 2GD0A 4L5AA 2M1XA 1C29B 4YMTA 2A1UB 4K2HA 5D1NA 3C3BA 3HE3A 2PV0A 1VL1A 5FA5A 5TLSA 3BF8A 1OUMA 3EJWA 4OB8A 5T4HA 3GVCA 1CEEA 2ZK7A 4UM7A 1E3WB 3GLGA 3GFRA 3R74A 4B8YA 1A48A 3MXTA 4IZHA 1IOZA 3G6XA 3SZGA 6YASA 5AM3A 2CV2A 2OQIA 4FEYA 5EJ7A 3OZVA 3QTTA 3ZE0B 5JBQA 2E82A 4X7RA 1CDOA 4B85A 2FNAA 4FT4A 2VZ0A 3BQ9A 5JROA 1W52X 4JLPA 4EL5A 1FFBA 3VSBA 3NT2A 4CU2A 1SUAA 4ESEA 5BMVF 5E4TA 4UFPA 1IM5A 2IOHA 3H4VA 2FWMX 1W93A 2GN9A 3IUMA 3WHLA 1JR2A 2DABA 3U3ZA 3VZBA 1QYIA 4E6PA 4HAYA 4EM6A 1AGXA 4RPKA 1B6TA 3KZNA 4RHTA 2BMDA 5AW8A 1OIWA 2VJCA 3GA0A 5CFZA 3UA3A 4D0LB 4YQYA 3FNRA 2PX6A 2CF6A 3H1BA 4R8MA 3PC2A 2FDXA 5K3BA 3NKFA 1IK4A 4NKRA 2IXDA 2BMWA 2Y93A 2J07A 4EFEA 4LGMA 3MXOA 1WXFA 5CLFA 3EOBI 3VR4D 4ER3A 5CK5A 4FOPA 3SC4A 2RC6A 1TLTA 3QKIA 2WM8A 1GPYA 2FGKA 3PR5B 1XROA 4OA5A 1S5PA 2C42A 3WA6A 4HH4A 4HGZA 1AQUA 3A9RA 1GWNA 3RF7A 2P9BA 1TZCA 4Y9TA 2PX0A 4FMCF 5L3SB 2DWQA 2NXNA 5JQGB 2HRQA 3DTVD 2DWCA 3EXHA 4P2BA 4PYIA 3L0ZA 1SB9A 4Z9YA 4JX9A 1CRPA 3QVLA 3TQVA 1Z0JA 5CB0A 4M9SA 2PRKA 2RSLA 4OJKA 2OHIA 1ZUWA 1M8FA 4MRMB 4ZT7A 4R0VA 1JN0A 1O03A 1CUEA 1L6RA 3TW6A 2OSVA 4HQ0A 1JAZA 3BK1A 2EJ0A 2FZGA 4DA4A 2YYSA 3GNNA 4IDBA 4CCSA 1UANA 3LU1A 4V0ME 4EG0A 2DHEA 3HK2A 2F3TA 1T1EA 1HV8A 3CNBA 1LLUA 1L3IA 2EJBA 1HNNA 1E2QA 5G40A 4LW8A 5DAAA 3ADDA 4LXYA 2ONCA 1EDZA 4JOSA 3ORSA 1TYCA 3BT7A 1CZOA 3DVQX 3IDAA 1A76A 4HDKB 2V6BA 1GPMA 4IIDA 1FQJA 1K75A 4QOFA 1XCLA 1XDWA 4FFRA 5D1OB 1DBVO 1B8PA 4F2DA 2W2QA 1FIUA 5ESXA 2XT0A 3C3YA 4ECWA 1QFJA 2MR5A 3INGA 3UPUA 3DQQA 4D41A 4X8LA 2VAPA 2AMFA 3WKDA 3JALB 1NQXA 2EBHX 3SSOA 3UHPA 4HZUB 5JSUA 2OBXA 5IZCC 4JUZA 4OY3A 3SYMA 3P32A 4DS3A 4LF4B 4YJ3B 2O2YA 1VP3A 1AA6A 5KX5A 4D4GA 3H3JA 3FFBA 1E9VA 4D4IA 2ZSHA 1C5KA 5HV6A 4EBCA 2GJ4A 3AC0A 3PPYA 3W7VA 2IHTA 2DHRA 2FSGA 1SVOA 3HACA 3VXKA 3IA2A 2XRZA 3I52A 1OAOA 4J1TA 4CM7A 4DTIA 3PPXA 4G1CA 5DHAA 5CTJA 4NBRA 2A9QA 4R41A 2WOJA 3JWPA 5BV0A 4WN9A 3EPHA 1O96B 1QE0A 3DFZA 3L0YA 4HDSA 1IG3A 4QXAA 4CKCB 4GOMD 2QNBA 5KIAA 2B98A 3EBPA 1DEKA 4Q7EA 4RTJA 3LX5A 3N2KA 1CYEA 3VYTB 2ERYA 3ZN2A 4QTUB 3CLSC 4ARIA 1FX0B 1Z8DA 4TN5A 1TM5E 1ZNYA 3AUSA 4OXXA 1AZWA 3KREA 1H6DA 1ONBA 4XPIB 4BEVA 4M2LA 1O3YA 1M5TA 1QO7A 5JCJA 4D6XA 2C0CA 4HX5A 4H7HA 4WCEJ 3T1YH 3BQ0A 4ECEA 3ZOKA 1FYEA 2HA3A 3G49A 3V1YA 2BZ1A 1KYWA 3M82A 5AKHA 2YWRA 2WG2A 5C1PA 2G3YA 2QMYA 1AQ6A 4YP6A 1IDOA 3GCGA 3UWSA 3LX6A 4OAPA 3K4HA 3DAYA 5DI3B 2H4XA 4U9IS 5KYUA 1PR6A 1JNXX 2IZ1A 4BV8A 4FGLA 5K4GA 2CL6X 3Q7QA 2Q2TA 3RDPA 1U5BB 2PXHA 1TZMA 1WJGA 2UUCB 3E4CA 2XTZA 4MEAA 4YASA 5HIIA 4MA5A 3CZCA 4OX9Y 1R9NA 1ULZA 3U3MA 4KBFA 3F3YA 3TGPA 1LSOA 1VE5A 4YR0A 4ATNA 4MZXA 1SKYB 4H59A 4G3IA 4US1R 5ENDA 3EB9A 3TPFA 3LQ1A 1DO2A 1RJPA 4LQLA 3TH5A 3EFHA 4F1JA 3ZDBA 5DSXA 4ZDIA 5TEWA 1XTKA 1MRNA 2PXXA 3GV5B 1UKZA 2NU6A 3HYCA 1CV2A 1NMEA 2N46A 2W43A 1J21A 1QVVA 3A9WA 5TDHA 2GBLC 1XU4A 1SJ9A 2UVPA 2YXDA 3LLCA 2WTMA 5D3MA 3LUJA 2E5FA 3HO6A 3Q7RA 5I9LA 5DGAA 1NI4A 2C5EA 4GKJH 2BM9A 5FT9A 3L6CA 2R8XA 2FX3A 3NTQA 1SQGA 3ZZTA 3CPEA 5LQUA 2XDYA 2AJDA 2QLJA 1S72H 2DPLA 1S8NA 3SDZA 4LJSA 5JZMA 2EKQA 1QGDA 2HHFB 3DDCA 2C8VA 1BCSA 3B7GA 1W73A 4MXDA 3CB2A 3R7AA 4MCAA 2PBFA 5EFOA 4KO3S 2ID4A 3DFFA 2V4QA 5D84A 2YJZA 2DT5A 4HB3A 3E9CA 1K97A 4GC6A 3MYRA 4AS1A 5B12A 1HDXA 3PFBA 5A3JA 3FB4A 2PQ0A 4DCNA 2AKEA 1C1DB 2BRUA 1PSZA 3EZNA 4EI7A 2BH2A 4JEHA 5IAEA 2B1QA 3FWHA 1QHSA 3PC6A 2B92A 3HYTA 2A0KA 3GDEA 1TZBA 1QB8A 5B1YA 1YTLA 6LDHA 3CUWA 2GZ3A 1UFOA 4LOKA 1T0JB 4QVGA 3WADA 8LDHA 1I01A 2AKAB 4UU7A 2W4MA 3ZGVA 1DUSA 3L1IA 2OQ2A 5I4IA 4YRLA 4D3ZA 3PUXA 4YECA 4KR2A 2I80A 2A0UA 2HDNB 5KJEA 3WGOA 2E4YA 3A32A 2WMYA 521PA 3VPBA 4ZO9A 3TNFA 4BLRA 2QYHA 1XZNA 5I5XA 1RJEA 1E59A 5J5CA 3FG9A 3TZCA 2WP0A 3IMCA 4OFXA 1LVGA 3C85A 3LGAA 4M88A 3QITA 3LO5A 5TV2A 1KEEB 1CJUC 5F9FA 1NF8A 5JZOA 1XHEA 4BWVA 2PDAA 1J07A 1LFAA 2V4UA 4R8KA 4PGFA 4Q05A 3KLNA 3A9VA 2UUOA 5JJ5A 1QP7A 1J99A 2Y0CA 4XUEA 2C2RA 3CG0A 4WBNF 2H7XA 1E5LA 4IF6A 2IEYA 3DWGA 5T3UA 1ZC4A 2I8CA 1Q1BA 2XQKA 4BFCA 4N65A 5DJ5A 3OEWA 2VSXA 3QPCA 4U7FA 1MOZA 1MAAA 3IAM6 1VP9A 1MGOA 3F90A 4D3XA 1YL5A 2P4HX 3KQHA 3KQVA 4FGSA 3WTCA 4O4JF 1FP6A 4I19A 3IMEA 1AVTA 3NUZA 1AN9A 1RC1A 4FLEA 5SV2A 2V7GA 4L6AA 1GUAA 4FE2A 4RFLA 1EZ4A 1KK2A 1MIOA 3QUSA 4UULA 4YGXB 3TL6A 3L46A 3NWPA 4C0LA 4NL4H 1MTZA 4H16A 2RK6A 1SN7A 3PE6A 1J49A 3P4XA 4F97A 5FR1A 2CV0A 5U4QA 3EF3A 5BSRA 1OLXB 3AT1A 4CG0A 2W48A 4LYFA 4D1YA 5K8JB 1WKCA 1SCAA 2LUOA 3RS5A 2CKZB 4GI3A 3K2IA 1J23A 2QA4H 3LUBA 1HNWH 4CG2A 3UZOA 2W2XA 3ZV6A 2O2XA 3BL5A 4BGIA 4BLQA 2BPOA 5JSQA 5KTRA 5CNMA 2C61A 4DDKA 3KM0A 3OJEA 3AONB 1BH2A 3ER9A 2WYWA 1P1BA 5C1OA 1DEAA 1FJHA 5FNVB 2JNWA 3BD7A 2X77A 4JSRA 3DTYA 1ZYUA 1TCUA 5KT5A 1SO8A 4K9QA 3GN2A 4DIEA 3VTAA 3HXTA 4HB2A 4WL0A 2B8EA 5K51A 4KQWA 2YOFA 5FYQA 4M83A 2WSLA 2RCYA 2XNDD 2I62A 3LUDA 3GA5A 1H8EA 2AX4A 1HE1C 2WE6A 5GV7A 5KAMA 4AY3A 4O4HB 2XHEA 3QE3A 4CLOB 1Y1WA 4NCKA 1PDWA 1I3CA 5MLCO 3T3GA 2J0UB 4IJ6A 5BVGB 3MMSA 1I3QA 3CLRC 5GPBA 2CLOB 1Y14B 1CZRA 4D8TA 2IOFK 4QUDA 4IVQA 3R09A 1E92A 4ZI5A 4DLRA 5THXA 2AN5A 2VSQA 5U4XA 2O7QA 1DJNA 2AX3A 5GONB 4TKVB 2OYRA 3HEAA 4INAA 4R83A 3AO0B 1XTZA 5IAJA 1Y1WG 4KR3A 4MW7A 3O3CA 2JEIA 2JLAA 1K5HA 3RFTA 4QPJC 1IXYA 4UAJA 1NYQA 1E3LA 4ZI2A 1C9EA 1UXHA 4LF8H 1J5PA 3E2MA 2AOTB 3GP8A 1LX6A 3VJKA 2H16A 4UCOA 1YQGA 5A6SB 1ZGZA 2W6OA 2ANCA 4DJFC 1H4QA 4PYRA 5I5WA 1W49A 2AF3C 5BOSB 4FFBB 5AW7A 2XCLA 3F8NA 4IUBS 1R6TA 4GI5A 1JGTA 1G59A 1XDGA 1A4RA 2AJCA 1MGPA 3UT5B 1M6WA 4JUCA 3NWOA 1XGKA 4PZ7A 3RF2A 3JSAA 2PA2A 3WGMA 3S81A 1Y7PA 5AOVA 1PP4A 1TAUA 2J6IA 1FLDA 1J8YF 1QYDA 1Z8HA 1DBPA 4B81A 2O4UX 4OX9H 2XUJA 3GF4A 4NI5A 4I1RA 2QUZA 2C8JA 1SVKA 3PGJA 3V8EA 1TQ4A 2I4NA 3C3CA 1UK6A 3HABA 2L2QA 4WT7A 5IJAA 2QRPA 3QFRA 1ZH6A 1GUBA 4E4RA 1G8JA 5L3SA 5AK3A 1SU8A 1CS4C 4U00A 4BMYA 4HYKA 2B9VA 1RQ7A 2P1ZA 4KXYA 1MOQA 1RRKA 4TZTA 2MSLA 4LN1A 3LJKA 3RC3A 2C3MA 1Z6XA 1SC3A 4BCDA 3MFYA 4IDCA 1V1RB 3CZQA 1HT3A 2A4KA 4GE0A 5ERYA 3EODA 4LYEA 3Q87B 4UVHA 2E1RA 4DQKA 2LR0A 1XRQA 4YP1A 4IXDA 5THKA 4Z1MD 5DDIP 4YV0A 3RSSA 3SZOA 3W6NA 4BP8A 4DLAA 3PFGA 4KQXA 2QQ0A 2DR3A 1EFPA 3P9RA 3ZU5A 3OOSA 3EFBA 2EKZA 2GFHA 5K3EA 1TTHA 2VYFA 2F1KA 3RVDA 2YWGA 4H1HA 1R6UA 4MVWA 1SB8A 2DLNA 4E21A 2WWXA 5EP8A 1VLJA 2C95A 4FGWA 1UP6A 4NOLA 3NTRA 1Q2XA 1OJLA 3SY8A 5KKCA 3EWAA 3HRIA 3VRHA 1JX6A 1MOPA 3RV3A 5EHGA 4X1IB 3UMSA 1CULC 3DV2A 4N3BA 1RAIA 3SXPA 2YOGA 4AF7A 1VQ4H 5GM1A 3JALA 2D5IA 3O8OA 1N8KA 3K9FC 4B09A 3GRZA 2CNWA 4UE2A 2XKBA 3DD1A 2DH5A 4HXFB 3DV9A 3U44B 1FFDA 3I1JA 1DUVG 2GD2A 4QYWA 5LXTF 2BF7A 1E2EA 5IZCA 3A4LA 2IE0A 4CEIA 1Z33A 3EY9A 4PXYA 1U98A 1EG2A 1CVIA 1NDQA 2XUZA 5F5LA 5ALNA 3CRW1 3SCZA 3D1JA 4P82A 1YFJA 5DCWA 4IVRA 4Q6BA 3NVYC 2CLLB 4OI0A 1D2NA 5ALOA 2BCGY 2OAGA 3EPGA 1E1YA 1O96A 1ZFNA 3CU5A 4LRXA 1DMRA 2Y76A 4PYJA 4J6FA 4CKCA 1UMBB 4B7AA 3CUVA 3IIKA 1VHDA 3MB5A 2PKQP 121PA 4X71A 4MLCA 1N2GA 2GS9A 3E48A 3TVDA 4BUJA 3UOAB 5IASA 1VBHA 4YRRA 3JQRA 5JLAA 4PLGA 2QWXA 4DUYH 2XLBA 5I7OA 4BOYA 3HXKA 3NHRA 2R7ZA 3EGDB 4Q4HB 1UFQA 2EL9A 3Q85A 3KQTA 5CH3A 2F64A 3OZCA 2CXUA 3KTMA 4A15A 5HYVA 1ACMA 1GDDA 5CXXA 2J30A 1UOEA 4FNOA 1V9SA 1KOGA 4P3YA 1GCIA 4GC7A 3PW2A 2TMYA 4PSKA 1YL7A 3U55A 1PYOA 2G07A 1P4HA 1N6KA 4N47A 5DI3A 3ZY5A 3UBMA 2W93A 3ZWVA 2R7ZG 1G1AA 4KXNA 1UC8A 1AHNA 4JA0A 3RF6A 1QRDA 4RY0A 4Z99A 4JI6H 3QKWA 1N3LA 4D44A 2H11A 2OCGA 2KBEA 1KTVA 1V3VA 5CA1F 3U3RA 4RDXA 2DECA 4EZBA 1RW4A 1M2GA 1YS9A 2TMGA 3DMRA 2CVQA 4FW9A 3K5PA 5KC8A 1P16A 4OCZA 4OG2A 4EL0A 2OCYC 4HQLA 4LOJA 2DWPA 3V5NA 3ZV5A 2IBKA 1SB3A 4WA8A 3EW7A 4GWLA 1PJZA 3KR0A 5HKKD 3SSNA 1UNNC 4JLVA 3I01M 3A8TA 2HCRA 4C03A 5JW6A 4Q9IA 2R66A 4UUGA 1MD9A 5JJLA 4NCAA 3KB1A 4ESOA 3ZCUA 3V4LA 3C7AA 1Z63A 2R87A 4QXPA 5HCNA 1LPPA 4K6HA 1NT2A 2CDCA 3H99A 4Z2AA 2PLNA 3OM1A 2C3PA 2HT6A 2GBLA 4Q7QA 1RXWA 1JIVA 1GNQA 1XZAA 4PG6A 2CLSA 3RYTC 1QM5A 3CRMA 3LZDA 4O4LF 4AULA 3S8MA 2E48A 2V3WA 3V4PB 2HHFA 1KSFX 2C9OA 3T7SA 2WQ7A 1PT8A 2IUFA 2HCFA 1UDAA 2VHYA 1EE1A 1MB0A 4GMHA 3OQOA 1I9GA 1M83A 1Y5NA 3X1WA 4M49A 3IXMA 4O8CA 1N77A 4NBWA 5EJFA 4PAQA 1QH8A 1PAUA 4YJDA 2QVCA 2WF6A 2R86A 4TYQA 1FNCA 2DBRA 3RQIA 2VDKB 2Q5IA 7AT1A 4WADA 1UQTA 3CUYA 3KSBC 2R82A 1WCMA 2QE6A 3UAWA 4G0NA 2AI2A 1JPVA 2I67A 3GJQA 3GARA 2IC5A 1UPTA 1MG5A 1WMFA 4J2HA 1G42A 1XDNA 5F76A 1XPJA 3CLUD 1H1LB 3WKAA 3SXJA 1XRMA 2XSZA 3GEIA 4D2IA 3CFYA 5DE3A 1KY4A 3FC4A 4YJFB 1XSEA 2OO7A 1SUFA 2QVGA 2V1XA 1WCMG 3BB3A 2X1VA 5IC6A 5K8VA 5FBRB 1CUYA 4DBVO 4HGNA 1VPTA 4E2ZA 3ZJ5A 4MYTA 4IGFA 2R60A 2G09A 2C54A 2YZLA 1CR4A 2EYQA 4GYKA 5EE0A 3Q10A 4X93A 3IHTA 3TPCA 1MP0A 1W30A 3RU2A 3OVMA 4FDVA 4YA6A 4N5HX 2GPTA 3ADKA 4BIMA 1MX9A 1Z26A 1C8VB 1E9SA 4UMFA 2RGUA 2WSSA 3SX0A 4LXGA 4HWRA 2JFGA 3ZCRA 2V4MA 2VCYA 3PNMA 4JI2B 3W9SA 3EMKA 3I6QA 3NB0A 4ZV4A 5AVVA 1O6ZA 5B6JA 2NZYA 2GZAA 4RHFA 2R5FA 5LB2A 3IUNA 3SIRA 2BFAA 1MXHA 3CKYA 3ESXA 3UWMA 3I2YX 1TWCA 5C4XG 4UCXA 4MTEA 4JI7H 4PM4A 2Y4OA 1DDGA 4NHEA 1SXHA 3HJTA 3L1JA 4INZA 2IPOA 4LPKA 5AW9A 1VKNA 2UZ1B 4QTZA 2WM9B 5E2IA 3WLRA 5TY0A 1GZ3A 4DIUA 2DFLA 1I7PA 3EA5A 3BKWA 3IMGA 4B73A 1QFYA 2PUWA 2X15A 3IT3A 4BVEA 2XNHA 1VG9B 2NQ2C 1CVRA 1G4AE 1Q7TA 4JFRA 4XUDA 3QYPA 1UJ6A 3C24A 3NBFA 3LBFA 1BW9B 4N8EA 3AM5A 1NLMA 2O2IA 4YJKA 4BQIA 5P21A 3T9FA 5FFMA 4AUEA 4ZJUA 5IM5A 2R5NA 4BVGA 4N6GA 4DGQA 3DOIA 2FW0A 3RB3A 3OFKA 3MMXA 2PKQO 3RIYA 1E6MA 1PJ2A 4FWTA 4MOWA 2R84A 2PQ6A 3OIFA 1ONOA 4YP3A 2J67A 2VHEA 5FNVA 1RLIA 3LNCA 5FD8A 4DPMA 2IU4A 5GJWC 5E2AA 4MKZA 3V4OA 4ED1A 3H9UA 1E3MA 1N5RA 3N43B 4ZVKA 1SIJA 1ZHFA 5FI1B 4R1SA 1SBNE 4FXPA 3LL7A 2WE7A 1PV2A 4BGVA 2XGSA 5J9FA 4DRFA 4HYQA 1Z12A 3PWTA 3L77A 1TPZA 4YR3A 2V96A 2JZCA 3B82A 3F46A 3ZY3A 1RR6A 1VKOA 4ERNA 4I5EA 4XD2A 1CB0A 3GT3A 4BCCA 1ILWA 1LPBB 4I55A 1BGWA 3D8RA 3OTGA 1J0EA 2UVRA 3CKLA 4JLJA 3II6X 3QMWA 1S9HA 5M29A 1E7WA 3VNSA 2QVBA 3Q15C 5EP2A 2QTHA 2CYCA 4PC1A 2B9EA 1R0XA 5LKRA 3PTLA 3OPYA 2YYYA 3R3ZA 2P1RA 4K87A 2Y3IA 1TRHA 3UWKA 2HYIC 2QMZA 5H16A 4Q9AA 3L43A 5HMMA 4Y1RB 3TAXA 4UEOA 2B7BA 3M9OB 4IXMA 1WBJB 3OFSA 1UK8A 1XZCA 3WLOA 1JBKA 4JYZA 4LZWA 2X41A 1BKDR 4K9OA 3WHIA 1GLNA 2D4HA 5K3FB 2BUAA 1C3XA 3F5QA 1LXCA 3C1OA 2WNSA 1G18A 3A3KA 5A6SA 3JARA 4ER7A 4Q6WA 4LX0A 1RI5A 4FFBA 1SVMA 3S8YA 4XQ9A 2OV6A 4NAUA 2VDNB 1PR5A 1FFYA 3HVRA 1TVMA 2D2EA 4MB2A 3UT5A 1CE8B 2ZYRA 3F7TA 3NBKA 3B6ZA 1SELA 1NJ2A 2WTAA 3JTMA 3UF0A 4U9UA 3MFIA 3ICQB 3KHUA 1FJGH 2ST1A 4RXTA 4RK1A 3SMQA 3KOZA 1S8OA 4LDAA 4BX0A 5KC9A 4NFSA 1ARZA 5H7XA 5AQ1A 2PAAA 1NRIA 4W82A 2R8EA 4MQMA 4ECTA 4IMJB 3BA1A 3FSJX 1J25A 3ZXSA 3NKVA 5F1KA 1SYXB 1RWMA 5FI5A 4QFCA 3E05A 4Z9FA 1T43A 4W99A 3ZS8A 5CDFE 4O2LA 1CQJA 2UKDA 1GPAA 5C4IA 3EG5A 2ZRQA 5EP3A 2Q41A 3KD2A 4YHHH 5DSTA 3G0OA 3RWOA 3URMA 4D8VA 9LDBA 2FN8A 2GPJA 3RB8A 3WGIA 2ZUFA 4E0BA 3HOWG 1OC2A 3EGWA 1Z6PA 1XHLA 4C2MA 2JIQA 4P22A 5CURA 4HNVA 1TVCA 2BVNA 1YC2A 2B7QA 3FLBA 2UVVA 4C0AC 3CCQH 4XWOA 4RKWA 4TQSA 1ZN2A 5D7BA 1KERA 2VJYA 2MINB 4AYBA 1QGAA 5EXXA 3CC4H 4LH7A 1NLUA 2W2TA 3BWYA 4WK2B 1ECPA 4B3HA 5FPRA 4OQ4A 1UXOA 4G97A 5CK4A 1IXSB 1X92A 4KXXA 4JEUA 1SY7A 4G0MA 2I3AA 1R4MA 1LV7A 4ID9A 4MLZA 3V1TC 3OQJA 2OO3A 5KSPA 1IHOA 2D8MA 2QNIA 4R8RA 1NRJB 2C3UA 2XDQA 1U9CA 3V8NA 1E79D 3H5AA 1NNUA 2Z8XA 1U63A 1I9CA 2FZEA 1MABA 3A11A 1K4MA 1RYNA 1VBGA 1W4CA 3N1UA 4XM0A 2E4UA 4KK4A 5G2OA 1VLBA 4PGAA 4DY6A 3NT4A 1POXA 1NFRA 4LWZA 4IIYA 5ARBA 3U44A 3CEJA 4Q1EA 2NVUB 4PBTA 2A3RA 4HDRA 4KHPB 4HPJB 3E58A 3DFKA 4YX9A 4LZOA 3G8CA 1OX5A 2FR8C 5JWOA 1WF6A 4R1TA 4ZDKA 3NCHA 1EJ6A 4L7QA 1WEHA 3DBOB 3B51X 4TV9F 4ZREA 1VHWA 3HGQA 2NNWB 4BO7A 4ZQFA 1WXQA 4RV9A 4O33A 4QDUA 4MKFA 2EZTA 5AO9A 4U9HS 1MX3A 3W1EA 1M90J 4JITA 4IEIA 4UBIA 2VJLA 5EQFA 1F7UA 5A4JA 4HWSA 3VPDA 3M7IA 4P53A 1GAXA 3L1HA 3L7YA 4FI3F 4WZBA 3NC0C 4EYQA 3QGMA 4JI5H 4JP8A 1E4OA 2V3VA 2E1PA 4JV2A 4UUAA 3TJRA 2MYPA 3ZIAD 1JEQB 2P7IA 5AKIA 3ZHYA 1RWOA 3C3PA 1CIVA 2VHXA 4CF5A 3QX9A 3Q5EA 4Q4DA 2XUAA 4P34A 4R40A 1B16A 4MPDA 2Z95A 2W6QA 1JZSA 5F3WB 1VLZA 1JJVA 2W0SA 4DA8A 1KMCA 4Q4HA 3TECE 1ZU5A 3IBFA 1PUXA 3NCTA 3CSWA 5FBWB 2HLNA 3HHEA 3DKPA 1EUCA 4C89A 4PAGA 1IZ8A 1KI8A 4X5OA 1PFYA 1GFZA 4TT8A 3U4IA 4IOMA 3FXAA 4GI1A 4TOIA 3QVOA 4TXMA 1N8NA 3DVAB 5JMWA 5C2JB 4ZVTA 4F7WA 3UG6A 3DBLA 3KSDO 3QYFA 3R8XA 3H5IA 1M1KJ 2DFKB 1A77A 3OTQA 2J3KA 3K71B 1J2EA 1XZGA 1HE2A 4OGKA 3GJYA 3H8SA 4MV3A 4KCGA 3I2FA 3L8CA 5GAJA 4KQKA 2O1SA 4DN6A 4UBKA 3U3KA 2JF0A 5IUJC 1N6NA 5IP7G 5KYVA 1HLGA 1CBUA 1FEZA 5CYGA 2Q29A 2J0FA 4POOA 3LMLA 1N6HA 1AQLA 1EGQA 4NOJA 5TEVA 4GLBA 4XCXA 2BEWB 1VPVA 2B2CA 1DAAA 1KI1A 5EFZA 4HZGA 5I6DA 1F9EA 3IKTA 4U8GA 1DNPA 1MX5A 4TLMB 2HK9A 5ED4A 3GP5A 1OVGA 3Q7IA 2NVOA 4P98A 2PZEA 5K0ZA 7MHTA 3RS3A 2EEPA 4LYYA 1NN0A 3JVDA 2F3PA 2VWPA 3ABIA 1YFLA 1FDVA 2ZSIA 2IIQA 3M9LA 3PT5A 2IIBA 4KFRA 1DT5A 3ZXXA 1SKUA 2XOKA 1SIBE 4HQOA 4FB5A 1AQYA 4QG3A 1YHQH 4KZKA 2FMFA 5CCXA 1IZZA 2AQKA 1XRSB 5COQA 2X0SA 4XFKA 3V6KA 1BU5A 4RCYA 1ZBDA 2P2CA 3RUIA 4LRUA 3PP8A 1OV6A 4V0LA 3TD6A 3SHTA 1YGPA 4D4MA 2PMDA 2FZLA 4K9KA 2Q6TA 3AP1A 1EH5A 3P0JA 2XB4A 2GHIA 4B3TB 1USWA 1JQLB 3KZOA 1R12A 1NATA 3FSGA 1PUJA 3VR5H 3CXRA 4IGEA 4WE3A 4JLUA 3ZE2B 1ZKDA 1NVJA 1QK5A 4G6ZA 1GPJA 2FK1A 4K5QA 5JNUA 3WRYC 2NWQA 5GM2A 4GF5A 3HDJA 1B15A 3AHIA 1DPGA 5INTA 2XXAB 1XE3A 1LQ2A 4EHLA 3N2YA 5DYWA 3EY4A 3WLSA 4DCTA 4YT8A 2WILA 2UVWA 1N2CE 3CF5J 2VF4X 1T3LA 4F4JA 3NTLA 2RJ3A 4G67A 1EXNA 1R50A 4CQMD 5EKDA 4F4WA 5FHRA 2AFVA 5MN4A 1WSCA 1WP4A 3KBBA 4ZAFA 3RAJA 4BQOA 2I2WA 4RULA 4AD8A 3FGZA 2W0MA 2XUFA 1KE1A 4KOAA 1P1CA 4IDQA 4HD8A 3RAFC 2WJPA 1QHGA 3WYFA 3RVMA 5I5SA 3LFUA 1KBOA 3CLHA 3I9MA 3V8BA 1WDKA 4KUHA 1JTVA 2OESA 1KVQA 2V7QD 3MQ2A 3U49A 4HXGA 4B7ZA 1G8GA 1MDBA 1HTBA 3W34A 4GICA 5EJ2A 1N3IA 1T2VA 1IAQA 4MHTA 5JE8A 1H93A 3WJ1A 3KYBA 3B1VA 4X1OA 4O0MA 1U8TA 4NWIA 3X1DA 3JATB 2YVUA 3I5UA 3I62A 1VCHA 4OIFA 4ETMA 1WSBA 1IN4A 1JR3A 2YJ4A 4TM8A 1I94B 3NTVA 2PNJA 1W1IA 2VK2A 1EE9A 1MF7A 4K6OA 2IYLD 4JOBA 3LK6A 4YAJB 1YAHA 2CYBA 2H1WA 2NYUA 4TKMA 2W6NA 2HJHA 3J7AK 4GOKA 3QKSB 1OB5A 4Z8YA 4ARBA 1VSVA 1UPAA 4MWCA 5JT1A 5CVUA 2ECOA 1DIBA 3TZBA 1WEKA 4UHHA 5LWQA 1BW9A 2HK6A 5CGZA 4HNTA 1SXGA 2WTBA 3IHWA 3J81A 3SE0A 1RHUA 3PHIA 3A6PC 1FRQA 4ZAVA 2ZSJA 5KX5F 1M33A 2PZAA 3FOEC 1Q82J 2BGUA 2AU0A 2F43B 3GT4A 3QA3E 3BJYA 1T9BA 5C5JA 5EDWA 1K66A 2O2CA 1Z5NA 3NHAA 4J7XA 1SVSA 4RPHA 2YVQA 1IONA 1E1QD 4N41A 3Q2KA 4WGGA 1U80A 2DU8A 3Q1KA 4MIEA 4N49A 4YY3B 4NJEB 2ZKIA 2Y0EA 2B1IA 1ES9A 1EE2A 2ZITA 4GNKA 2OHHA 1IY8A 3VYVA 3TQIA 4L1KA 2R8ZA 4PG4A 3L0PA 1PZMA 3VX4A 3K0CC 2FKNA 1RTKA 5I3ZA 4DQLA 3NASA 4BMNA 2Z30A 4G5XA 4BU0A 2PRIA 5JCPA 3H2KA 4O7SA 4HT3B 4US0R 2A1TR 3GZ4A 2J9RA 2VDWA 2ZAOA 5LBTA 2XB9A 1U90A 4F5DA 3EFOB 3CYFA 2Q0XA 4ZMRA 5DW0A 4IIGA 2VJKA 1X7ZA 2BP7A 5FAXA 5IJ9B 2VXOA 1OA1A 4PRZA 4MAAA 2J6BA 2XWJI 3JRXA 2IIVA 3JQCA 4WCDA 1FFCA 4WKNA 5BV1A 1C3OA 1YONA 1K6XA 4GP9A 4L6IA 3PFIA 5FBLB 1P2SA 5BNFA 5BO5A 4CJXA 4JUAA 4HH3C 3TFQA 3NVKI 2Q07A 3STYA 3GJ6A 1DBIA 3PQEA 4CFZA 2C2OA 2R2GA 3PHBE 5EN4A 3ODGA 2PLWA 2Q6LA 3COPA 1RAGA 3OQ6A 1TUGA 3ZHTA 1YS2X 1MHTA 2AWOA 1VSQA 2CLDX 4LZAA 5T67A 5KTSA 5H4GA 4MRSA 2BH9A 4BX8A 3PTAA 4DVGA 3QUQA 5TPZA 1XP8A 3GFPA 1E9FA 4C7JA 2P65A 3I01A 1SZPA 2O7NA 3PZRA 3GQCA 5DNUA 1GL3A 1W6RA 3BH6A 1UWKA 5CYPA 4UCUA 3W5OA 1B33N 4S1PA 3VKUA 3DUFA 2IEBA 3L1UA 4E32A 1S7GA 1E64A 3DR3A 4WNIA 2XE4A 2ZSUA 2QIPA 4G5GA 2ETVA 3KT6A 3BBLA 3AHGA 5BQPA 2EP8A 3UK7A 1HNZH 4QGBA 3DNMA 3GTGA 3LKDA 3AR7A 1M8JA 1VE9A 1F2UB 1BS1A 3I42A 5EPUA 2YUIA 1YFZA 4ZQGA 2ALJA 3M6LA 4O3FA 3K8ZA 4Y98A 2HSZA 1OTHA 1FNDA 1REQB 4IXWA 4D96A 1AKQA 4PRYA 2YR0A 2BIFA 4FS1A 1S6YA 3BB4A 4DKJA 3Q98A 2JS7A 3QWFA 1TWHA 2JEFA 1GQSA 3A1VA 3A6HA 1UBOS 3WIVA 1RM4A 2HY7A 5F9MA 2I9PA 1PFVA 4OF4A 1G8AA 1KEZA 1M2OB 1ONNA 4BEJA 2ZM5A 2XKKA 4GX1A 3FOZA 1AX9A 3SLKA 2ZRHA 4KWCA 5HGXA 3ZGYA 3N5CA 2ZP1A 1XTIA 3ZDEA 3G9UA 3RSQA 2I4RA 2MINA 2J5QA 3CTMA 4M86A 3E5NA 4AIRA 3KKNA 1M3SA 3EVDA 4AWAA 3FMAA 3E7PA 3ZBUA 1K9VF 3LLUA 1FDSA 3VKWA 2B21A 1K5PA 4RC9A 5CDGA 1XZFA 2BM8A 5B1HA 2IYAA 1DMSA 4JGBA 1Z0ZA 5CB8A 1BE1A 4BP1A 5MDHA 2QRUA 3TS1A 2BKXA 4E5SA 4P4LA 1BXRB 2GCOB 1KTAA 3OM9A 4AJ2A 3MM4A 5EYPA 4CCWA 5BRJA 2NVUA 1E9DA 4NS1A 1TX4B 3RANA 2EU8A 3G5MA 4IAOA 5CAEB 1VECA 2QVXX 3FKQA 1CS0B 2YJ3A 1PWXA 4MQUA 4F6RA 1GGHA 1AUPA 5B6IA 2FR8A 2IY8A 4Q3KA 4X8OA 5EY5B 1YC5A 3E5RA 2HLDA 4EPYA 3I39X 2ZJFA 4LHEA 4YAIA 4BZWA 2ON6A 2JA7A 1WP9A 4FMDB 5FWYA 2LE0A 4NAVA 3WL4A 1XF1A 5FHQA 1TTQB 5HRCA 1R0YA 1QP4A 5KNDD 4KQHA 1FMFA 3FE2A 3FYSA 3H17A 2P5YA 4J6EA 1HR0H 2G0AA 3UAXA 4LE0A 2J33A 1XQWA 3B2NA 1EFRD 3IE0A 3PEVA 1XCJA 3CW2A 1LD3A 1RWWA 5DM4A 3PKZA 3AYHB 1E2PA 3O1HB 2EERA 1QG0A 2PR7A 3ISVA 4V0RA 4FLFA 3CUEF 4IYRA 2JA7G 3S0JA 3TJZA 2PYZA 1B41A 3ZX5A 1YJ8A 3B5IA 1V8FA 4EYGA 4EJMA 2FX5A 2X0NA 5LIRA 3TIVA 3BAAA 3ROFA 2P9JA 1HRDA 1P9NA 1TCCA 1YOVA 3GFGA 3UAVA 4N18A 1HO3A 2G4CA 2VBIA 4IIJA 2WIAA 4C5CA 1YRHA 4DUGD 5C81A 3EEYA 4M60A 4MUAA 4IFTA 1L5ZA 4R1NA 3AZOA 3NV7A 3IIJA 1SEVA 3O4FA 2GGSA 1KL7A 1DADA 3KBOA 1H2ZA 5K99A 1TWGA 1COZA 3SGLA 5JV5A 3UYYA 2ZJTA 3S1AB 2ZR0A 3AM1A 1CJVC 4O86A 3V9PA 1VRWA 4E13A 4DDVA 3RYHA 2V98A 2PCJA 3KR2A 3L93A 4WA7A 3GDHA 4QQFA 3FF1A 1YCHA 1ZGAA 2A7QA 4AQYB 4HWPA 1VB5A 3GQVA 5KFOA 2KJQA 1G9SA 3EVAA 1SCIA 3E3AA 3R77A 2VYVA 2QW8A 4KSYA 3EOZA 2OLSA 3FRJA 3NONA 3PYMA 3AYXB 2WTXA 1DWUA 4IJKA 2J0SA 4JI0B 4OQLA 3ZQKA 4EUFA 2XUKA 3OTHA 5F51A 3PBKA 2H00A 3T1HH 3G2NA 4CN8A 1XQVA 2GHTA 2PWYA 3KR1A 3ZWMA 4CR6A 2C4HA 2UU9H 4HZIA 2BQRA 4RF2A 2WFAA 2HMAA 2Q5JA 2I2DA 3NIDB 4DR7H 3Q8XB 1RXIA 5I48A 2R7LA 1MMFB 3ELYA 3PXUA 2ZRJA 3M6IA 1E0AA 2WIGA 2YV4A 3OKAA 3ETLA 3JYNA 1XWWA 2ZPUA 4BMXA 2PBZA 5J40A 4CIYA 1VM6A 4YI3A 4L85A 1WD7A 4DA6A 4DRZA 1RM3A 1HLFA 1YZVA 1ESDA 4RVFA 4F71A 3H8JA 4RL6A 1B0PA 4HB4A 1UBGA 4Q8FA 4YV7A 5I7WA 4TKZA 5EZSA 2GTHA 4YJHB 3HR8A 3TOSA 2WD8A 1ZN9A 1T6ZA 3UVEA 4RNDB 4U4AA 3BQ2A 4DQ0A 1SHTX 2OCIA 3H19A 2P2YA 4QU0A 4GBGA 1O1YA 2RDIA 2IYFA 5IC5A 5JFTA 2A1UA 2XXAA 2IH4A 1GYRA 3UGTA 2Y1GA 3WRYA 4BC1A 1NF9A 1PJQA 3RG2A 2ZJAA 1QVAA 3RC8A 3TVTA 2QVYX 3UUFA 4YT4A 4DG8A 5JADA 2QUHA 4Y2HA 4DAOA 3SJCA 3WJAA 2DQZA 2D0IA 3CEAA 1E3WA 2W9AA 1WVIA 4AZWA 4KRGA 2DQKA 3PVZA 4HYEA 4LJYA 1I14A 4RUAA 3T9BA 1KXJA 3G8AA 1WXXA 2BSXA 4IHAA 2PVPA 4B6PA 1YHNA 2UVQA 1JFSA 1VTKA 2GARA 2R00C 2Z9CA 3RODA 2HF9A 4AK9A 1LLQA 1QWSA 4KQMA 4ZICA 4RJ2A 2GN0A 3DULA 4ALLA 4XCVA 4JV5B 2DPXA 4M8KA 4KHZA 1SZCA 3F96A 2I4TA 4KODA 1GTVA 4MULA 4IP0A 3KHHA 1GDTA 3FCSB 4UD6A 1FMLA 3PN1A 4L15A 3ECSA 4JNCA 3EZGA 3QENA 1NIPA 2JBHA 2ERCA 2XYRA 3N0TA 1XD9A 1AG9A 3C6QA 1U7WA 4PZCA 1DTWB 5KNCD 3ND6A 4LVOA 4YDQA 1A4UA 4ZGBA 4DLNA 4R16A 4CL2A 3JATA 1AHIA 2ZG6A 1QNLA 4LDRA 1MJ5A 3PQ4A 4Y6RA 2FPSA 4BKUA 1KWKA 1EGHA 5HE8A 1BKYA 1A88A 4MWGA 1E3DA 1EA7A 1B0ZA 5EJ5A 3M5PA 4YAJA 2XBMA 2I22A 3CRVA 3TYXA 2H1FA 4WKPA 5C5EA 1QVWA 1WCYA 3CH5A 3GN1A 3QKSA 4FR0A 3TGLA 4A2CA 3L7OA 5JQGA 2JFPA 2A57A 1Y4AE 2EIXA 5E6SB 4F38A 2NO5A 5CM8B 1EEHA 4UTPA 3QFFA 4NNPA 2JHPA 4RLQA 4B7XA 3QLEA 4YHBA 1TT7A 3K8YA 5K8CA 1EFUA 1NNI1 2FEWB 4GMXA 2O0MA 2C20A 1KQFA 4PFJA 4MRMA 4P83A 4XVHA 3GGDA 4TXJA 2JJ1A 3ZWXA 4K9DA 4GQIA 5DU2A 3USCS 3FJ1A 4J29A 1PK8A 3OPXA 4Q7MB 1OGJA 2EW1A 4JC4A 4BN0A 4GZLA 1K27A 4A0RA 3BHIA 2VQEB 4OHZA 4OYYA 1PW7A 3E84A 1EU1A 5JYBA 2QJRA 1V6SA 3T7AA 1O6GA 2H9YA 1ZAUA 4NG5A 3KQKA 4NJEA 4KJZA 1IQPA 3RU3A 3BFXA 4YYZA 1NUUA 1Z4MA 4ONEA 1Q1NA 1ODTC 1JKXA 1E4GT 2I91A 3UNXA 2XR1A 4DA7A 3LVBA 5B7GA 4HDKA 3KQSA 4LTDA 3G88A 1Q16A 1W2WB 3DP7A 3ICEA 5D1OA 2WUGA 1YQEA 1XMQB 2GDZA 3K0CA 3A25A 4IIVA 4PU0A 3EFOA 3OU7A 4DANA 3U7IA 2JHCA 4CDNA 3L41A 3FF4A 3BE4A 4KGXA 1C8KA 3JASB 1B2LA 4H08A 4HZUA 3KAKA 1XXHB 4H1UA 4Q1DA 4MRVA 1K8QA 1Y1SA 2X8JB 2ZVPX 2H5EA 2NUBA 2SICE 4YJ3A 4FM9A 1U4NA 1RWNA 1YSCA 2B36A 3PJDA 4JQOA 1GNVA 2GSWA 3FNFA 3BIJA 4ZC1A 4RZXA 4JLAA 4MI1A 1UPFA 2QI9C 4F8EA 4TMYA 2O1WA 1PFKA 3WK5A 3EGVA 3NT5A 4LVNA 3CXUA 1UOPA 2J6SA 3PGVA 3PUZA 2FY8A 5IEBA 5KYWB 1T9KA