3WNZA

Crystal structure of bacillus subtilis ywfe, an l-amino acid ligase, with bound adp-mg-pi
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
465
structure length
465
Chain Sequence
KTVLVIADLGGCPPHMFYKSAAEKYNLVSFIPRPFAITASHAALIEKYSVAVIKDKDYFKSLADFEHPDSIYWAHEDHNKPEEEVVEQIVKVAEMFGADAITTNNELFIAPMAKACERLGLRGAGVQAAENARDKNKMRDAFNKAGVKSIKNKRVTTLEDFRAALEEIGTPLILKPTYLASSIGVTLITDTETAEDEFNRVNDYLKSINVPKAVTFEAPFIAEEFLQGEYGDWYQTEGYSDYISIEGIMADGEYFPIAIHDKTPQIGFTETSHITPSILDEEAKKKIVEAAKKANEGLGLQNCATHTEIKLMKNREPGLIESAARFAGWNMIPNIKKVFGLDMAQLLLDVLCFGKDADLPDGLLDQEPYYVADCHLYPQHFKQNGQIPETAEDLVIEAIDIPDGLLKGDTEIVSFSAAAPGTSVDLTLFEAFNSIAAFELKGSNSQDVAESIRQIQQHAKLTAKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanine-anticapsin ligase BacD
publication title Single Mutation Alters the Substrate Specificity of l-Amino Acid Ligase
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Ligase
total genus 142
structure length 465
sequence length 465
ec nomenclature ec 6.3.2.49: L-alanine--L-anticapsin ligase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13535 ATP-grasp_4 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3wnzA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3wnzA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wnzA01
3.90.1170.60 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Aldehyde Oxidoreductase; domain 3 3wnzA04
2R85A 3LP8A 2R7LA 3G8CA 1EHIA 4EGQA 4XZ3B 5LOVF 1CS0A 2I80A 1OBDA 4O7SA 1JDEA 2WYOA 2YRWA 5JQGF 1BXRA 2FPGB 5LYJF 2XCLA 2YWVA 4YB8B 4YAJB 5HV6A 1KJ9A 3TW6A 4I50F 4O7LA 5LXTF 2Z02A 5KX5F 4ZQIA 4M9UA 2W6PA 4IZOA 2R86A 3BSYA 3VA7A 3LWBA 4ME6A 4EGJA 4YBZB 4FFMA 2XD4A 4M99A 4EABA 4I4TF 3DF7A 4HQ6A 4O4LF 3TQTA 1E4EB 3VPBA 4YAKB 2W6QA 4O81A 2R7NA 3ETHA 3WO0A 2NPOA 3K3PA 4HNUA 3AX6A 5CAEB 1KC7A 3MJFA 1DV2A 2GPSA 2VR1A 2SCUB 4O7RA 4FGRA 5D8DA 3TIGA 4HNTA 1UC9A 4O7ZA 2YZNA 1M0TA 4O84A 4IWYA 3BSSA 1IOWA 2HJWA 4C5AA 1C30A 4EA9A 4TUYF 3U9SA 4O2AF 4XYMB 4MV1A 5GONF 3TINA 2W70A 3RV3A 1KBLA 1GSAA 1WR2A 3V4ZA 3HBLA 1OBGA 4EG0A 4O86A 1AUXA 4L1KA 3K5HA 1DV1A 2J9GA 3NUAA 1ULZA 1AUVA 1A48A 2VQDA 3JRXA 2NU9B 1KJJA 2FP4B 3WNZA 4O7YA 2GQSA 1JLLB 2NU6B 3N8DA 4FE2A 2YZGA 4MV6A 4WBNF 3MWDA 1M0WA 5LA6F 3JRWA 3KAKA 1JDBB 4FFNA 2OLSA 3BG5A 5CA1F 4MV8A 2V58A 1C3OA 2V59A 3R5XA 3VPDA 4GGMX 5IYZF 2R7KA 2PN1A 4O4IF 3RV4A 1UC8A 3HB9A 5FNVF 3OUZA 3RFCA 2CNVA 2GQRA 4QSHA 3TIIA 5JH7F 4FFRA 3ORRA 2I8CA 2YL2A 4O4JF 3U54A 4FFOA 1T36A 2QF7A 2GLTA 1GSOA 4O7VA 3JZIA 3I12A 2CQYA 4XYLB 2DIKA 3R5HA 3R5FA 1W93A 2FPIB 2W6ZA 2DWCA 4FFLA 1I7LA 5C8YF 3WO1A 4MV7A 2DLNA 2PBZA 4MV3A 1Z2NX 2CZGA 3VOTA 1GLVA 2CNQA 5I47A 5BPFA 1GSHA 1CQIB 4WD3A 3RUPA 2DZDA 1DIKA 3KALA 1PK8A 3HO8A 3R23A 3UFXB 2I87A 1B6RA 1E4EA 2FPPB 2X0SA 4TV9F 3ETJA 2R84A 5EZYF 1GGOA 1EUCB 4Y8VB 5LP6F 4MA0A 4O2BF 5BPHA 3JZFA 1IOVA 2R87A 2HGSA 3KREA 2YRXA 2YYAA 3V4SA 4O4HF 1PX2A 2NU8B 5J2UF 2YZMA 5J2TF 1BNCA 4FU0A 2PVPA 2NUAB 3VPCA 4XX0B 1JKJB 4M9CA 4TV8F 3VMMA 2W6OA 1EUDB 3KAJA 4O7TA 1M6VA 2YW2A 3E5NA 4MV9A 4EA8A 2IP4A 5KKNB 4EAAA 2ZDGA 4ZOLF 1KJIA 3Q2OA 3QFFA 2R6FA 1VBHA 4C5BA 2W6NA 2QK4A 4E4TA 3OUUA 4YJ3F 4IIJF 5CB4F 2VHEA 1CE8A 1Z2PX 4FFPA 1B6SA 3GLKA 1Z2OX 3G8DA 2ZDQA 1EZ1A 3BFPA 2YZLA 4EA7A 3MWEA 4O82A 4O7NA 3AW8A 2W6MA 2P0AA 2GPWA 1VBGA 4O83A 5JVDF 2ZDHA 4C5CA 2VPQA 1A9XA 5C1PA 2CNUA 4I55F 5H80A 1SCUB 5JVLA 3R9RA 5C1OA 3GIDA 3SE7A 5JQWA 4IWXA 5BMVF 1W96A 4O7WA 1VKZA 4DIMA 4M98A 2R82A 2W71A 1KUTA 2YS6A 4HNVA 2NU7B 5CA0F 4IHJF 1I7NA 2C00A 1EYZA 3N6RA 5HBRB 5K2MA 4NYEA 4RZQA 1KJQA 4HR7A 4J6EA 2YS7A 3K5IA 4ZHQF 3ORQA 2R7MA 1KJ8A 2FB9A 3BSWA 4YJ2F 3U55A 4MV4A 3U9TA 4DLKA 2V5AA 1KEEA 5DMXA 3Q1KA 4MA5A 1CQJB 4ZI7F 4MAMA 2Z04A
chains in the Genus database with same CATH superfamily
3SY8A 2BFBA 3DTFA 5KDLA 3RVRA 1WPRA 2R5FA 1T36B 1XZBA 1N6RA 4FHGA 1ACJA 3GDHA 1ZEJA 4NNPA 2DQSA 3ZHBA 1UBFA 2WJYA 3HCAA 5IAJA 3G8YA 2ZJ0A 1DTWA 3REGA 4YCSA 5A1JA 2EKLA 1LQ2A 3WNVA 3WG9A 5ARCA 2C58A 5F76A 4ZEOA 4FYYA 2W0SA 4XVRA 3BWMA 5KT7A 5IBPA 2RK4A 4H6WA 4O4LF 4OY3A 2P4EA 4D9FA 5LXTB 1Q1EA 4B3TH 3LUGA 2Y1GA 1JHRA 3G5UA 3M5DA 4W6ZA 4P7FA 3BA1A 2D8MA 3DTTA 4XW2A 3U0BA 3DLLJ 1NV8A 2AB0A 1LWNA 3L6OO 3TNLA 1I3KA 2X2EA 4QOJA 4UMVA 4N6OA 4UM5A 1Y5MA 1JZTA 2RGEA 4BO0A 4YDQA 3NAGA 4YMSA 5FBKA 2VJKA 1A50B 4YUXA 2ZBDA 4CDMA 5EC8A 3TTWA 3QUCA 3WIBA 4KFRA 1ZC4A 4KQFA 1J25A 2GF9A 1QIHA 2JGAA 3T99A 1VKJA 5LZ8A 5FPOA 1HE2A 2OGZA 1EMDA 1MEJA 3WNQA 3KXIA 2DR2A 2Y0SA 4D0LB 4RH1A 3WNZA 1WBJB 3FNBA 4RVOA 3C87A 4G1BA 3UT0A 3VUEA 4BLQA 1NUUA 2QRUA 2VXBA 3SHTA 3H2KA 3HSYA 4DNPA 3DDHA 4DQXA 4MWCA 5CT8A 4DSAA 2ZEJA 3N7AA 1G2WA 1PJ2A 1ATZA 4FFBB 1X1RA 2NXCA 3K7EA 3R3JA 1A9ZA 1E94E 4ZCTA 4A23A 3F6EX 4RCNA 1D5CA 4MUBA 4U2DA 1T9AA 1ONBA 3OA2A 5EFOA 4HNAB 1SUDA 1E6CA 5L6MB 1EFRA 1RD4A 1KFCB 4WDRA 3QVGB 3BRWA 3JQDA 4V02A 4Y1GA 1C14A 1Q0PA 2NZWA 2EFYA 2DKFA 4HAZA 2K5UA 3OF2A 4CFYA 1KI6A 3EEIA 5K1ZA 3MC1A 2GXUA 5DG9A 5AXBA 4KXYA 1TKCA 1PSWA 2O8EA 1Z2CA 3H20A 4MVYA 3IAS1 4BTVA 3QELB 1PVDA 4APMA 4BO5A 3LKBA 4H7EA 5A5GA 1N2BA 4J1TA 4RAQA 3FPSA 4C4ZA 2JGFA 3ICEA 4FKBA 1K7SN 1JMVA 4IGFA 1FMLA 3A0RB 1OZFA 1YS6A 1O54A 3ERCA 5AXDA 9GPBA 3U3KA 5IKXA 2P11A 4D8YA 4OREX 4RLSA 5DYGA 4O4HB 5E4TA 1SHLA 2XUDA 4KAJA 4EVIA 4AUMA 4DWWA 3FKSA 3JALA 4KBGA 5EIBC 2LIPA 1IN8A 4OHRA 3WDSA 4UBIA 1OPRA 3BFVA 2BMWA 3SHVA 1JJBA 1BRTA 4XD7D 1VL0A 5KYKA 2PZEA 1V96A 2R4TA 5FBZA 1PR5A 2BUCA 2X2OA 4JVOA 4M9ZA 1I7QB 1TU0A 4JCCA 1ZXXA 3W78A 4NONA 2HF8A 5K4GA 2O2EA 3WRYA 4KGVA 3KZKA 5CA0F 3IL2A 2BTOA 1GPUA 2GHQA 3RVKA 4LF9H 1I4EB 1O97D 4K8RB 2FSIA 1SKAA 2PR7A 4C7OB 4JLUA 5IYCG 1G2QA 3CISA 3FOAA 4LTNA 1IBMB 2C92A 2C5AA 1WMEA 4IXNA 2WJPA 2EERA 1U94A 1P7PA 3MGKA 3CVVA 1B73A 3CSUA 3G0DA 3LDUA 5KYXB 4ZCSA 4Q21A 4UNSA 3GDOA 4B9AA 4OX9Y 2EYQA 3G23A 1JPVA 4KIUA 1PSDA 4BZZA 3R7BA 3GEBA 2NADA 3PAJA 1PYOA 5L51A 1P33A 1M6HA 2WQ6A 3TAXA 1QRAA 1CUHA 1JMYA 3T61A 2K6GA 3T1OA 3LX4A 3JVIA 4KDCA 4D6XA 1EFTA 3OP4A 2C7BA 2SKEA 2ZSAA 1NNUA 3E03A 3GI1A 4MV5A 1E3WA 3UCEA 4K6NA 4MW9A 1DUSA 2BEKA 4GLJA 2P3OA 3THRA 1OY1A 1FS4A 1DEAA 4C1BA 2RJ3A 3KFXA 4DJDC 2XOKD 1XX6A 1RTTA 2X0IA 4I3GA 4TKVB 4LWOA 3T5JA 2Y4RA 4KKVA 3TI9A 3I55H 1X8JA 4HNUA 1SG6A 2XH8A 4D8UA 4PX2A 2H1HA 5FWXA 3ZQUA 1VQKH 2HA5A 6LDHA 3D2CA 1K06A 4BMNA 1G6HA 3ZY4A 4JLKA 3ZHSA 3DDUA 5GONF 4BNKA 1Q57A 1ETUA 3CWCA 3GIPA 1NLUA 3CLKA 3R3UA 3UAWA 4JU8A 2DJ5A 5CFOA 3RGWS 4D3DA 4Q39A 3QZ8A 1XNGA 1ZH6A 3FE2A 4O2AB 3UTDA 3I8OA 3SD7A 2LPMA 5BNIA 4MYDA 3AHIA 2BLNA 3CSWA 1Z6PA 4JEMA 5LKRA 1RRVA 3ITEA 5KVAA 5DLGA 1S2LA 3H11B 4BGDA 4BB9A 1NDUA 2GSDA 1YSCA 2FMAA 5CH8A 2QVYX 5ECWA 3RI3A 2MWMA 2Z4TA 1RS0A 4NBVA 1OD6A 4QZVA 3TI7A 2CJWA 1L8OA 5EJEA 4NBTA 3ZY2A 3BA6A 1TLTA 3DFKA 3ZK9A 1LVGA 5IG2A 4KODA 1PZEA 5IUNC 2CHQA 4YN3A 3PIOJ 4HEA6 1F2TB 4D4LA 2UUCB 3ENQA 1PFVA 2PRSA 3F3KA 1HNNA 4HYQA 2W43A 3LQ2A 3C8DA 3G6EH 2HVRA 5K8UA 2FZ4A 1RJFA 1DKLA 2WVJA 3AINA 5A4AA 1AF4A 2ZS9A 1U0JA 1A9QA 2QLNA 5C46F 4QPCA 1I4TD 4LOKA 3HO8A 2H1LA 4S2UA 1FFVB 2JIZA 3QVXA 3A1WA 2I87A 2VUSA 3DTVB 3KLMX 5EMMA 3U4AA 4TV9F 5FBLB 2D2FA 1X3LA 3PPIA 2VHYA 1XFDA 3F73A 2PWZA 4F3RA 5BOSA 3H5NA 3I62A 2C4UA 5GVSA 5JT1A 1OU4A 3QMPA 1VQ8H 3JYHA 2JH8A 4Q7EA 3PGLA 3D5TA 4C7KA 4G5RA 1LPNA 3DS8A 2RCNA 1OTXA 4MICA 3H7AA 1ZL2A 5JWOA 5HM6A 2Q2UA 4UCOA 4GKKH 1NN3A 4TVBA 1L5GB 1ZM3A 4RPKA 1GTRA 3N7UA 1TKBA 1YV9A 4DV0H 3JVDA 1K1EA 3OSUA 4J3JA 4MROA 2G9VA 2R6FA 3JS5A 1Q21A 3OE5A 5JMTA 3TD9A 5AVOA 2VK8A 4GPZA 3BDVA 4ZALA 5BXQC 5JALA 3OC0A 3J7TA 2ZIXA 4PZAA 2OORA 2CXPA 5LR6A 4YQYA 1T8SA 3LSYA 3Q5EA 2PA2A 4PYLA 4TTSA 2YVLA 1QZXA 3EFOB 2VZ0A 4CKYA 3LCJA 5LDGA 1G20E 2C07A 1C8KA 4DC1A 1NM5C 3SE7A 2ZYVX 1RI3A 4BQRA 2W71A 1NVJA 3MGAA 4L5JA 1GNSA 4X62H 2HF2A 3GBPA 3NHRA 2J33A 3HWRA 4NICA 2LZ0A 3L7BA 1JHOA 2QMHA 5JSHA 1P2DA 2ET6A 4BQOA 4AZVA 3R2JA 1LY1A 3OTOH 1ZRMA 3TRDA 1J8QA 2RD2A 1M8GA 4JDUA 3KAQA 4A2BA 3NQ41 4MEAA 1CS4C 4BCCA 3I9V6 1O94C 1T5TA 4ZJYA 4ER0A 4NCIA 1M6WA 1OU0A 2IYWA 1PT7A 4NYIR 4XSVA 3DXXA 1LF0A 1SXGA 4Q4AB 3E7WA 3DV9A 3I9LA 1ZSYA 4A2PA 3KJIA 4MW2A 4OF4A 4CQMB 5K5EA 4KJXA 1RAAA 4OA5A 4DRXB 4O7LA 1E69A 2AZTA 3AI1A 2FK7A 4A3BG 2AS0A 1NW3A 1R15A 5EQDA 4QHTA 1ONPA 5LP1A 1IVYA 1D4ZA 1H69A 3TQCA 4YRBA 3HYTA 1M72A 2QL9A 2GNPA 2IU4A 5SZKB 1FA9A 4QOSA 3VKWA 1ND5A 2Y0DA 3RS9A 2Y6VA 4GKVA 3SSOA 3V2UA 5F2EA 1IL0A 3CR8A 2FZWA 5IX8A 3RSZA 2PYIA 1Z4OA 3WLAA 3L77A 1S0MA 4LXUA 4U0JA 5KQLA 1FDRA 2ZAMA 5FAXA 4F71A 5E4FA 4EMBA 2PLWA 1OOEA 1H42A 2CVZA 2C4WA 4M1OA 1V3QE 2VNIA 1CNMA 3TE6A 1DAGA 3IUSA 3AUYA 3WLLA 1SD1A 4URUR 3UB4A 2VSFA 4IXTA 2ZJ3A 4IZ6A 2AF3C 2I4OA 4OGFA 5JZSA 4GPBA 4J94A 4JENA 2WG1A 4ISCA 5IWCA 1DXOA 2BM1A 4BPBA 4GPEA 3IIJA 1U3VA 1OLUB 4O3PA 1ZR2A 1R6XA 3QE0A 2V58A 1ABEA 1AGYA 4Q3DA 2C61A 4DR2H 1BMTA 1Q84A 5A5DA 1PWZA 4UZSA 1QHHB 1S8FA 3G7NA 4NCHA 2PKQP 2EX1A 4HL6A 4IVNA 1UR5A 3ANXA 5DNWA 2QTGA 4FFOA 1XI2A 2RJOA 3KTOA 2BFFB 4D8XA 1KC1A 4DZRA 3MJVA 4JT4A 2XYVA 421PA 3GR6A 1Y6FA 3MXOA 4L0QA 4AW9A 4EFKA 3U5ZB 4EHNA 3DR5A 2D6FA 4KG7A 1H65A 3PEUA 1LPPA 2AWOA 4G63A 4O4JB 2AD5A 2I2CA 3TTUA 4JA2A 3T3OA 4F2DA 1T8TA 4D5EA 2BGKA 3V1NA 1N48A 1BG6A 3QYPA 2QLJA 4UCTA 3K70B 4RJJA 1CBUA 5FLXW 4KVFA 1V7CA 3MS4A 3Q8LA 1QR6A 1W2HA 3N2GA 4ICIA 3BBPA 3WXBA 2H2FA 2HMVA 4P3YA 3M6FA 3AR5A 1BROA 2HI0A 3OY2A 3EBOA 1PR2A 1P2FA 2HEIA 5DLEA 1QGAA 1TDJA 4XH9B 1R0ZA 4OFBA 4JJKA 3C7DB 3QY0A 1KBOA 5AIAA 4MVJM 1UIRA 2CWWA 1O97C 5C1DA 5CIYA 4EY8A 4JB2A 2CLHB 3RROA 4TV8B 3GTKA 1A27A 1EE9A 2DTEA 3VH2A 3KZMA 3TZEA 2AOTB 2AX4A 1E9CA 4YAEA 3DMPA 5KFYA 2CL0X 1TVKB 1RRGA 1CRLA 3KBBA 5AHXA 1PN3A 3OFJA 1QE0A 3B5EA 5JVDF 3V8PA 3QHAA 2VPQA 4QIWA 3T4EA 1XHLA 1GGKA 3IOYA 4BBPA 1DXYA 1Y4DE 5AJXA 1DQZA 2DUUA 5HULA 2XT6A 3IESA 4JWKA 4QC2A 1RHRA 2DXIA 3I01A 3HHPA 1YQTA 5LL6P 3EK2A 2BYTA 1TUEA 3RYFA 1ODIA 1CF2O 5A9SB 2P9CA 4XOUA 2NQ8A 3MUFA 2Y0CA 4QYXA 1T2EA 4OMDA 1C7QA 4OKNA 1ZOPA 2FN8A 1W2WB 3HMKA 4EFEA 1KYXA 1L5NA 1BXGA 1DADA 4I8IA 5L1IA 3LCCA 2RHCA 1HSOA 3DH0A 2ZYHA 4YO7A 1MNQA 4H6VA 2PTGA 2I3GA 3UCXA 2R5WA 5HP4A 4MQLA 2FDXA 1MT0A 3QNMA 1ZISA 2GHRA 2VYFA 1WB5A 1V2GA 4OI2A 3I8SA 4OP3A 4E30A 5CFPA 2KB0A 2YWXA 2I4RA 2O14A 1MIOA 4Y0NA 3KD3A 1DRVA 3WK9A 3SBXA 1U0NA 2YV1A 4UZEA 4WHXA 3B1XA 4LRQA 5I7SA 5FWDA 3ETHA 1U2DC 4NARA 4QRIA 1U4OA 1GPNA 1EHYA 2IYNA 4FILA 3E9EA 3LY8A 1PFKA 2PLNA 4DV2H 1KK1A 2YVUA 1QUFA 3GDFA 4G3IA 2CCJA 3FWZA 1LC3A 1YBMA 2C8VA 5K3SA 2I3BA 1XNHA 2HTEA 1ZGJA 3L0DA 3PFNA 2C31A 1FJGB 2XDAA 4RHYA 1HMPA 3CT4A 4X66B 4CQLB 4F7WA 5E6SA 2ENUA 2O5RA 4S0XA 4Y2JA 5K8JB 2AI2A 2LDXA 3AUSA 1KHHA 4LCEA 1X7ZA 3ZV3A 2O0JA 3NT4A 3QZ7A 5JZVA 5COAA 3W2GA 1N4DA 3OFSA 4BU1A 2BJHA 5FH9A 1Z8FA 4KR7A 1OI2A 3EYAA 4EYSA 2INGX 5I9MA 4ZK2A 4Q4CA 2RGCA 4L9SA 2WYWA 3VR5H 3DFZA 4LBZA 1Y7IA 4D97A 1D3AA 4DPKA 1GGNA 2CMDA 1B00A 1NLMA 1RVV1 3K0BA 2P4SA 5B3KA 3PC3A 1VBNA 5DM0A 4UOZA 1IG3A 3I53A 2D1YA 4C4TA 1B43A 1VKHA 3LFTA 2Y0SE 3REQA 1LNZA 3OD5A 2WUWE 1F1JA 4EUKA 3JXEA 2JFUA 2IELA 3G2LA 1G7RA 4RIFA 1JG2A 5A4DA 3LPNA 4JV1A 4MLZA 2F8LA 2VXCA 4K2AA 1M76A 1GAQA 1PV1A 1U0LA 2AR7A 4MUXA 2WA1A 4QW8A 3OOEA 1GNLA 3UGTA 1GYFA 3QPAA 3RYIB 3K4PA 5K3OA 4U7GA 2UZ0A 2V98A 4RIHA 4JI6H 2PUGA 4HXYA 3WMFA 4MTEA 1TZKA 3IKVA 1JLKA 3UG6A 3LL7A 3RU2A 4KRXA 1T9GR 2X0SA 3E8SA 3MIIA 3W8DA 3I61A 3TW7A 1C29B 3JQAD 4B3BA 1DCMA 3V4OA 2PT5A 3B5JA 3BOSA 3CD6H 4AFNA 4CFZA 5IULC 4R9SA 4ZARA 4W5OA 7REQA 1V5GA 2UXCB 3MHPA 4Y2RA 4J1NA 5DQHA 5FBRB 4FU0A 2QQGA 3WWIA 5CEJA 1HT1E 5IP5A 4HEJA 3EMKA 1AGPA 1EU1A 1ISMA 4ZP1A 4HAWA 5E7IA 2PL3A 4KXQA 4D9EA 2P5SA 3H9JA 2TMKA 5ITVA 4OLBA 3KTFA 1RWWA 4E03A 5IM4F 1UMDB 2IYPA 1T9GS 2Q5HA 4WI1A 4F1JA 2ZYRA 3GLKA 1YI8A 4U1RA 4A0RA 5EMJA 1ULHA 4P86A 3C41J 2ZUCA 1JROB 2J32A 2Q28A 4M0JA 1J7KA 3JQGA 4CUKA 3VPHA 4DDMA 2MINA 4P7BA 4YMIA 4IWXA 1QFMA 4F45A 3UAVA 5DIZA 2FPWA 1KDRA 2BISA 1G63A 4R71A 4LKOA 2YOFA 4IHJF 3MLAA 2HJRA 3W6NA 3DMTA 4BNYA 2YOGA 3P9CA 3JR3A 2FY8A 4PLPA 4GP7A 3NDJA 2CLSA 3TLMA 5C53B 3MSCA 2I6XA 4OXRA 3GH1A 3ZJVA 3KP1A 1E1QA 1STOA 1M1YB 3ZDXB 4KQ2A 1WZNA 3ER6A 4RK1A 2ZBVA 2GERA 3PQCA 3GIJA 4KC0A 5K8TA 2GZ1A 3LVQE 2QROA 5GAHN 4EO7A 4FUTA 3IVAA 3NLLA 3G82C 1HNZH 1MJFA 3Q7RA 4POAA 1XU7A 2D4AA 4R9UC 5C35A 4C0JA 1UNNC 5KFHA 1EFAA 1O5IA 1QZTA 1NR7A 1XVTA 2YXLA 4BGUA 4EX6A 2HM7A 3OPNA 2XRFA 3T54A 4ASUD 2G67A 4B3JA 4JYBA 2C5LA 3F7OA 4BAZA 4E51A 3DDWA 4FOSA 3GLFE 1ZD8A 1UFQA 3L01A 3CC7H 4XCQA 4KQ9A 1NXTA 2Y1XA 5KWSA 5SV2A 4W1SA 1CG6A 1ZJ4A 1KEUA 3C70A 2FZGA 5DTJA 2IPOA 5H3HA 1P7YA 3IRUA 3CMMA 3QU5A 5IVKA 1BE6A 2FXVA 4A5OA 4RCYA 1N2XA 5AUQA 2Q5JA 3B9RA 3EZGA 1HDZA 2O7VA 1JFTA 2VNAA 2V7GA 2MSWA 5HOQA 3ZWKA 3W7VA 1KTAA 5IJ9A 5I48A 4BWYA 2V6FA 5LM3A 4X44A 1EFVA 4DANA 4GA5A 2Y8EA 2CJYA 4F92B 5JRJA 1A3GA 5KPDA 1V11B 4MK4A 4BO1A 2DFTA 5GM1A 3WK8A 3AHGA 1SXPA 1TYBE 3RS3A 5LMUB 4LI3X 5JDCA 4Y7DA 3ELYA 1P0FA 3HY4A 3OCZA 2IYQA 4G85A 3OD1A 4EKNB 4DRYA 1ZCFA 3DQPA 2VT2A 1FRVA 1XTPA 1TEVA 4FFNA 2AFVA 1CUXA 3MK31 3MPOA 4C7JA 1JIIA 4A16A 4JI0H 2I1WA 3GARA 1P91A 3HMQA 3WRXA 1I1NA 1XEFA 3LW7A 4HX2A 2PBRA 3W1VA 1Q3HA 3U54A 1C80A 1VG8A 1UJ6A 5JXIA 4CIWA 5FUVA 2Q1SA 4MWZA 3S2SA 2QJTA 5K9ZA 3LRXA 2HCFA 1HLFA 3CO5A 3JQRA 4JJGA 1OI4A 2IGTA 2QPLA 4ZGBA 3P45A 1W93A 2GRAA 3DLTA 3Q7PA 3C8UA 3T1NA 5DI3A 1NGSA 2DH5A 1Y1KE 4L8GA 4GQAA 5AM3A 4JQCA 2GB4A 1H05A 2G04A 3K1JA 3HPQA 3CC8A 2ORWA 4QYIB 3ZU4A 3HOVG 2JATA 4ZTBA 2FN3A 1YFLA 4PAWA 3N8NA 1MR3F 3A1UA 2XMZA 3DPIA 2G63A 1FZTA 3CGGA 4C4YA 4TX1A 3WMXA 3E4DA 4ZGWA 2AXQA 5IT4A 4OFXA 3N05A 1TK9A 1EVJA 3VM6A 2W2PA 4ARAA 3H1AA 3Q5GA 1JEJA 5E6RA 3R6GA 3PCXA 1SXJA 4WKCA 3KQQA 3PQ7A 2XMSA 5FXMA 1UKBA 1JFSA 4JKYA 1U0BB 2ACVA 4HGQA 2E0IA 2PMCA 3R8XA 2Q6LA 1TJ4A 2CD9A 2NO7A 2I2FA 4CBVA 4D3ZA 1J56A 2I54A 1TL7C 1LB1B 2BEVB 3DP7A 2XUPA 4Q18A 2IS1A 1NF9A 4N0MA 4U2EA 3DT9A 4AN4A 2AMJA 5BSGA 1NDQA 2ZCJA 1O6GA 3IV9A 4KRFA 5DWDA 4EF4A 4FHEA 1K86A 1JKXA 4UHHA 5AP9A 1K2VN 4CF6A 3QVMA 5TPWB 5BNFA 2Q1WA 3WB9A 4DV5H 1ZJ6A 3PYLA 4B80A 3HFSA 2OWEA 4JBXA 4E0BA 1T0IA 2EJ2A 2JAUA 2GZHA 1RJEA 3Q8SB 1E8DA 5HG0A 3QEKA 1N5KA 4DT1B 1T10A 2J9FB 1ONOA 5LLSA 3F8TA 3A14A 1ML4A 4B43A 4NEQA 1RQ7A 5AVKA 2Z58A 3PR4A 4UTRA 3K15A 3QENA 2J9ZB 2CF5A 3AEZA 1LSUA 1FUEA 2ZJFA 2PGOA 3WWZA 2QVXX 3GUUA 3WWPA 4QVGA 1WX1A 5IS2A 1GZ3A 1IY8A 1Q0QA 3D6MA 5AW3A 2ZBEA 4PX3A 3MSXA 4Q3CA 2PR2A 3OHSX 2KHZA 2EG5A 5KQMA 2VDNB 2HYIC 2ZB8A 2R96A 3OQVA 2KMLA 1LLUA 5EEHA 4YP6A 3TVYA 4R05A 1D2EA 1QDLB 3JRNA 5CH3A 1YRBA 2VXYA 3KHTA 1ZM9A 4URVR 4RADA 1OXBB 4CKBA 3E3LA 2EW8A 1KK2A 5AHOA 5E3HA 4C3OB 4O1HA 4LK2A 2ZRIA 1AXGA 4PG6A 5FBVB 4KREA 4FI3C 2FE4A 1JAXA 1DXQA 3V3TA 5FFNA 1QCCA 1K7XB 2HRCA 3RF7A 3OU7A 5AR1A 1EFDN 5I5YA 3F2IA 3SSMA 4D9GA 1GT91 4DY4A 4QQNA 3ZYZA 4PAQA 5JWHA 3L6DA 1YTEA 1EGQA 3T4UA 1ZONA 4L4YA 4BO9A 4AG3A 3TEJA 3NC0C 3R7WB 1L6IA 4EPWA 3A27A 1QKKA 2H0AA 1MO6A 1OAOA 1Y9JA 2OPBA 2OV1A 4MRMA 6ABPA 2FQYA 2W6JA 1Q1NA 2OLSA 4TMKA 1SB3A 1GQ2A 1LKZA 1A9XB 2JRCA 2PD4A 3KVVA 4NYIQ 5L9XA 3WB2A 5LDHA 1J24A 1KEKA 4OU4A 2CNNA 3DFUA 5FNVF 2PV0A 2J7PD 3N5KA 4JN6B 4TOIA 3EMBA 2GETA 1SC4A 1NMSA 1N57A 5TB5A 1QGUB 5J40A 2M98A 4OV6B 4AY4A 1BMFA 3RASA 4ALMA 3WL5A 1I8TA 1QH0A 1GVNB 4E3WA 3HN2A 4A3EG 4H6XA 2HHLA 1NOJA 2BZ1A 2G06A 1DAAA 1MO2A 3G1UA 1ZU5A 5EL0A 5C8YF 4Z4EA 4NG5A 1Q15A 4NJOA 2J0EA 2ZJYA 3FI0A 1VI6A 3EHDA 2PLRA 1XAHA 4ZDWA 4UUQA 3TDMA 4V0MA 3WGYA 1KY2A 3LC7O 5AJHA 3CQ9A 1Z4JA 3VYUB 1RADA 3PEEA 3C0FB 1MZBA 1S7CA 1PDWA 2RJNA 5TQ0B 1UMCB 3OMLA 1XD9A 4DLSA 2P9ZA 4ZT7A 4DNFA 1AKEA 3W5HA 2G1JA 1ST3A 2QTZA 3F7MA 5CITA 3JYPA 1Z5OA 2A9VA 3CGWA 3PNKA 3D31A 1G1MA 2BGWA 1SZPA 4PRYA 4JC4A 1J9GA 3E84A 1I4LD 1RJQA 4I14A 1R8SA 1W4CA 1ULSA 1SHTX 4TVSA 2R2GA 3MCWA 4RK7A 5F7OA 1GYRA 1XTKA 4K0KB 1JJAA 1FJXA 3C43A 4Z49A 4P81A 1X94A 3IV6A 5DGDA 4JUIA 1J33A 3S8MA 3EG9A 1ICIA 1LC0A 2QSZA 3OJEA 1K4MA 1XMQB 4UNQA 3BCHA 3EDCA 3B1FA 4YHHH 2P9GA 4LXTA 4ZXFA 1NBIA 1MUUA 3R0ZA 4KPGA 5JSQA 2RB4A 2D74A 4GM4A 1DAOA 3AV0B 4LISA 4AKTA 5ALZA 1GCOA 2VK2A 4B5LA 4HX9A 2VKTA 4CEJB 1E99A 1H2EA 4M0LA 2J67A 3MINB 1KUTA 4H35A 3TY8A 1H4VB 1M2HA 2NOAA 4KMOA 1P2BA 3TTSA 4K7JA 4EHJA 1WW3A 2PUHA 4HHEA 4Z9BA 1SU7A 3BTVA 4R8UA 4RA9B 1P16A 4I55B 3OWOA 1SZJG 4G5XA 1DRWA 3TG8A 1R9TA 2FN4A 3MERA 1QRSA 1ECFA 521PA 3P27A 1CQZA 5IHPA 3WL8A 2H2GA 3O1IC 5L40A 8ABPA 1JSLA 1GJRA 1UBNA 1W30A 3IUBA 2HMAA 2LUOA 1Q7YJ 4Y30A 4OH7A 4X54A 4TS3A 4MMXB 2QZSA 3AHJA 3JSLA 4I1VA 3BGVA 5EKSA 5DU2A 1GFSA 1E66A 4MS4A 1G6Q1 3DC2A 1MW8X 4CEHB 1YOVA 1ZD2P 2NQTA 1QF6A 3K9LA 4U0KA 5BWBA 3GLHB 5DULA 4PLTA 3GGCA 3BWEA 1LRLA 5D87A 1I01A 3ZE8A 3ZD7A 1FFHA 2HSDA 4WEQA 3V4LA 1LX7A 1SR8A 2MYPA 5F3WB 2WQ7A 4JROA 1R5BA 5TS2A 1FKAH 2Q62A 3HWWA 3TGWA 1NJ5A 3K3PA 3F4LA 1X1AA 2GPSA 3TBKA 2D54A 3UXMA 5HUJA 1IB0A 1TXGA 3OEHD 3AEKB 3C8ZA 4WK6A 3EZNA 3T06B 5KOHB 4RTSA 2W54B 3RH0A 4DVJA 4W5WA 2FJPA 5CU7A 5I9NA 2FR0A 2F00A 4DSZA 3GN2A 5IVDA 1U04A 3AP2A 1AIPA 2IOFA 4NEGA 1QPZA 4OMUA 2QLBA 4LQ4A 3EVEA 3HK2A 1UM9B 2EZ4A 3PJRA 5C8XA 1H93A 1FX0B 4V0QA 2LD4A 3MBOA 4CM3A 4OHYA 3GRPA 4A8TA 3TLGB 4QDOA 5KTYA 1Z9BA 3CINA 2VQDA 2IEBA 4YCLA 2J5BA 2H2HA 4LWQA 1Q1GA 3F6CA 1ZO8A 3UWDA 1A4UA 1QF9A 3NNDA 3CG4A 2UXBH 2R8BA 4BKMA 3G17A 2V7VA 4X91A 1QCZA 1L7OA 3EGDA 3WMEA 3DBVO 5IWAB 4R7RA 1OXMA 2PPLA 2HA6A 2QTRA 3SR0A 4GLXA 4NJMB 3I73A 2PRYA 1SBNE 3HVRA 3A3NA 4YREA 3OKCA 3P52A 4DCOA 1EGVB 2WPDA 2H85A 4XYLB 3QW4B 4OHKA 3GJTA 1UEXC 4G0VA 2YQZA 1HQCA 1MVOA 3NR2A 3H5AA 3VBCA 2W6ZA 3JVEA 3F0TA 1RI5A 4CIXA 2VDJA 3EMDA 3A6ZA 3P96A 3ADCA 5I47A 2FSHA 1OIWA 1GZDA 2X0DA 3Q87B 4DB2A 2VAWA 2B4TO 3L7OA 4MWDA 3Q72A 2CLFB 4PU0A 5CXUA 4AP9A 1GGOA 4KAAA 5CCEA 1AS3A 3AVUA 3RAGA 2UVDA 3EODA 5BVGA 1JTVA 2Z5LA 2K2QB 1WCV1 2GASA 2EP7A 5EDWA 1JR4A 1XCJA 3D8TA 5IT9A 3CU5A 4D82A 3EN0A 3WGNA 2P8JA 3KRTA 3OJOA 5F77A 5KNBA 1TF5A 1JHAA 3T41A 3MGBA 3ZDYB 5CBPA 4LBYA 3GNQA 5BN3B 3IRVA 1E5XA 5E6UA 4MV9A 1MX3A 4Q02A 1C0PA 4ZOLF 2P2GA 4DPLA 3G59A 1Y7LA 3ZCVA 4USAA 3OM1A 4BDSA 3I5AA 3EDRA 3I2IA 3IS3A 1NFFA 4E22A 3DO6A 2Z30A 3RLFA 4EENA 3BFPA 3MWEA 1JMKC 1R6VA 4W5NA 4GDMA 2FZ5A 1RXWA 5KSOA 1D2NA 1VDZA 4CC5A 4OQQA 3QKUA 2RDMA 3NVDA 4F72A 2CNUA 4IIJB 3HXLA 5AW6A 4X65H 2Y2UA 3GW8A 4BNLA 4NE7A 3DOHA 1RLIA 3Q6MA 3L0BA 3W05A 3X0DA 4A4DA 4K9OA 1WQ4A 1Z6GA 1I94H 1ZHFA 3KQHA 4AMGA 1WDWB 1TE2A 2AYYA 1PEDA 4TM8A 1VKOA 2NN3C 3IR5A 1OB5A 4WV3A 1NVFA 1CF4A 1WXFA 4S2EA 4L2IA 3W9YA 1TM4E 2AKAB 4RD2A 5G4KB 3ZBQA 3JQ7A 1Y3CE 4IDBA 2GEUA 1P0MA 3OC6A 5M29A 3CF0A 3V34A 2R7LA 4ZVNA 3I5MA 4IR9A 3OPVA 2V65A 4AJ1A 2W8ZA 2CNWD 3SM9A 4CHTA 2RAVA 3OLYA 3L6UA 5FJ8G 4DR3H 1KI9A 4F60A 1JU3A 4N9QA 1ZRNA 1NW8A 3U7IA 3NJRA 2ISCA 1OBCA 2HQSA 4UAGA 5B1EA 5JS8A 4US2R 3TKAA 4JYZA 2QYTA 4AU1A 5L3SA 4W9RA 1IB6A 1A4RA 4JCOA 5AMXA 3GCXA 3PG5A 2XVYA 3G8BA 2EJBA 5ISMA 1UT6A 1WYGA 2YIMA 4CNBA 2FLVA 1QIMA 2J0QA 4IX1A 2ZAYA 1BJTA 2KI5A 4Q4HA 3ORSA 3P2KA 1K3FA 4JI2B 2X6QA 4FP9A 2QR5A 4CV3A 2NVXA 4TMFA 1C1DB 1M9NA 2A1IA 2ZVJA 3VSAA 1M1UA 3PCTA 2G77B 2PANA 3AYHB 1SQGA 1NX9A 2AZ4A 2P1RA 2Q27A 3ZHYA 1PT6A 3HYCA 2WFZA 3ZWQA 4J4BA 4B4WA 1XTBA 5FYDA 1PTJC 5IABA 4Y1FA 5AVVA 3QPDA 1YJNH 5I51A 2C3UA 1K7EB 1JBQA 4YRNA 1V7PC 2OMDA 3DLPX 2HPZA 3BFKA 4CL8A 4WVFA 3DWFA 3OE7D 3EW9A 4BVHA 4F1WA 3HFRA 4P80A 1TAQA 2XCQA 4D57A 4RIIA 1RM4A 1F48A 3O4JA 5B2ZA 3VSBA 2DBRA 3D8UA 3D6UA 5HKBA 1UXHA 1EQAA 3TIIA 3NGMA 4TRMA 2X8JA 3ABOB 3VC2A 1P4HA 5KIAA 4O7VA 3G6KA 5D7NA 2HWKA 1WIWA 4QXAA 4RZ2A 5KWIA 4IGAA 3BCRA 4GVXA 2P6RA 1UMBB 2IHVA 2G8LA 2QUZA 4B3RB 2D13A 1K1QA 1R74A 1PWXA 4JSYA 2QGZA 4WZAB 3V8RA 3R23A 2IT1A 2WF9A 1OV6A 3NBYC 3C3WA 1HRDA 1S4QA 1IHPA 1ODSA 3ZWXA 4LE1A 3OCJA 4G0UA 4CMJA 2ZUTA 3ANYB 3Q7IA 1ZHOA 5ALYA 4TS4A 4X71A 3QMVA 2E4VA 3ZI0A 2PV7A 3CG0A 1CZNA 4WK2B 4MQEB 5FD5A 4W5TA 4X60A 4W63A 4UBOA 1P31A 2A0UA 3SNKA 4FS1A 3HB4X 1XMOH 1NBMA 3X1ZA 4ZI7B 1BFUA 1IBKH 1PR6A 2NO9A 2G0TA 3N39C 1FFBA 3ECAA 1A76A 2Q21A 1RCFA 1F38A 2GPNA 2HADA 1KVRA 4QGHA 3VR2A 4BNDA 3C97A 2BC9A 2R1TA 4YIHA 2GZRA 2P5TB 4A6DA 5DLFA 4O2BA 1T1GA 4DABA 4NVRA 2JVJA 4PGMA 2TSYB 1QR2A 4BVFA 3P9ZA 4HRVA 3KOXA 4OLJA 5KJCA 2BVNA 3IERA 1E0DA 2F3QA 3RJ5A 2EFJA 3KHLA 4O3FA 4ZGGA 1EFCA 5AQEA 2OO7A 3T8YA 2O5CA 2J41A 2XZPA 5DT9A 1JEDA 1Z28A 4NDNE 2VHTA 1FB5A 2EU8A 3ZW8A 2YYZA 3JQFA 4QEZA 2QD2A 3HKZA 1WHSA 5I5VA 1PR1A 3FNFA 3FSEA 5AKJA 3WWHA 1YNOA 3CF4G 4XWAA 2SECE 5B4VA 1JB9A 1DJLA 2C9DA 4DV4H 1YC5A 2HRDA 1IE3A 2I80A 3PQ8A 3NYQA 4B4UA 2EQAA 5EKUA 4CMGA 5LNK6 3VJLA 2UUPA 3AEQA 3D5EA 4GKAA 1JX6A 1HE5A 3EY9A 2NSLA 1IN1A 1E3EA 3SVLA 8MHTA 1QGYA 4MW4A 1IRXA 4HSGA 1SCKA 2AGOA 1F0KA 2PH7A 5DHPA 3COPA 3UJPA 3BKXA 5TJ9A 2ZE5A 1BCRA 4D26A 4J3NA 1JKJA 2G1UA 3CH5A 1WJGA 2ZE8A 1OFTA 1Q0HA 3BAFA 4IF6A 3OZGA 4RHCA 1TM1E 2IW1A 3X1WA 2A3NA 2BBTA 4N4AA 4UHCA 1HG0A 4B44A 4JVNA 1JXLA 3TLZA 3U80A 5EJ2A 3VJRA 1HETA 1KR5A 1F3LA 4TUYF 5KWEA 4M8KA 2WD7B 3CF4A 3KXDA 5B1SA 3GLRA 1PG0A 2XF2A 4PX5A 1SUCA 1H8EA 4AJ2A 4J9VA 2B2NA 2OZVA 1DAMA 2O06A 1WVGA 1ZPDA 2HIGA 1JJIA 4BAUA 2HIAA 2J7KA 4ZI2A 3W1GA 4IV8A 4KWEA 2G28A 4LGYA 4GRDA 5HQ3B 4JXKA 1N1GA 1SULA 4QECA 2PGNA 4FWIB 4OI4A 3DWEX 4EZEA 2PSSA 3EOAI 1P9NA 2CGEA 4ND4A 4L7VA 2CLLB 4HQLA 3WGMA 2I7VA 2EFDB 1H1DA 1T5LA 4XEUA 2WPNA 4AWXA 2VUHB 1V8PA 4YV2A 3O8QB 3NAMA 4FLEA 2PJRA 3I1FA 5C3EG 3Q7QA 4IIXA 2F1RA 4DZTA 1T2NA 2GFHA 3CZ5A 1YR9A 4YLYA 5EWJB 3ZGOA 1MG5A 2Y9MB 3KOOA 1VCIA 3NDBB 4EF5A 1EDDA 3WAJA 1JALA 2AW3A 2FP3A 1KIFA 4OQEA 2HK6A 2VTBB 2GARA 2R8GA 4HVAA 4HK4A 4HZUA 1W46A 5ALDA 5IUJC 3C6KA 1NASA 2OVBA 1H0HA 1YQGA 1YT5A 4MQBA 3A9VA 1RZ3A 1WDKA 3ANLA 5I5XA 4NBUA 3H99A 2DX7A 5AXAA 1SNYA 4YBZA 3BD9A 2W2NA 1YKGA 4JJFA 4E2FA 1QB7A 4Y9SA 4RULA 5JTTA 2QJFA 5K3FB 4MAFA 3M5PA 3SOZA 4V1CB 4WKBA 3E70C 1ODFA 1FDWA 3E9MA 5CG2A 5BSRA 4UJ3A 3IKLA 5AVTA 4J0QA 4ARVA 2XA1A 3CIOA 2EBHX 2I7CA 5F1KA 3AONB 4KLNA 1DC3A 3JD0A 3K9NA 4QUJA 4R0NA 4V0ME 2HRBA 5KVQA 2NXEA 3OIDA 2E87A 2ASVA 4TTVA 1U31A 4ZU6X 4GR9A 2AR0A 2G08A 1WS6A 1DBWA 3R6LA 4IILA 4TSFD 5FF9A 3I5UA 4WN9B 1J5EH 4YJ3F 2Q4OA 1DP4A 2AXEA 2XYHA 1QH9A 4S1OA 2VAPA 4IDEA 1EQ2A 3KU1A 4YH1A 1UOPA 1JNYA 3CEJA 3LO8A 1F7UA 3K96A 3TZQA 1YK0A 2YXNA 2GUWA 1K7FB 3G8AA 5FP0A 4CIAA 2G9RA 1J70A 3EXHA 4YQWA 1B2LA 4UM9B 5BMVF 4Y2SA 1OGJA 1OX5A 1QE3A 3CR3C 4E2WA 4NMLA 3NWPA 1UEJA 3IT1A 1WRBA 2PCLA 3C3KA 3MWKA 3RSHA 3ZLJA 4YV1A 4KYIB 2C8KA 2YV4A 5DGIA 2IQ5A 2WIFA 1TM7E 3ZGNA 1RWXA 2QXTA 4DMRA 3ZLUA 3IKTA 5JG7A 4D9HA 2G07A 4DTCA 2JK1A 3CR7A 3TOSA 4FMBB 2EJ3A 2AMYA 2E55A 1T9HA 3UHFA 5DTQA 1JDEA 1UDXA 3ET5A 4D9KA 1AUPA 2GEFA 1T2CA 3QJYA 3DZJA 4JNKA 1H1LA 4GSLA 2I3AA 4IGEA 3AVOA 2BR4A 5KX5F 4YAGA 2HVQA 4II3A 4JI8H 3U4DA 5EHXA 1K3TA 3NHAA 2V55B 3W5DA 2GUGA 1KMIY 2COKA 2QRQA 4CF3A 4CWAA 3F6PA 1RXCA 4YXFA 2LKCA 3OOYA 4JEUA 4I1IA 1X42A 3CCFA 4H08A 3SZMA 2Y67A 2JFNA 3HJRA 4LH7A 3LDFA 1Z29A 1ZICA 3FM9A 1KU0A 5BRNA 1R9JA 2RG7A 1VBMA 4LC1A 1O4WA 4QXPA 2COGA 4EA9A 1LK7A 1YQEA 2OG2A 2AQIA 2BUAA 4GBMA 1ZD5A 3JAWB 5F7XA 1QOQB 4BWFB 1JJ2H 3OQJA 1Z7WA 3DMDA 3DVAA 5FV7A 2VEDA 4C7YA 2HLNA 3GLIE 2EIXA 1Q19A 3AESB 2W93A 2RAFA 2WU1A 5GINE 3K16A 1NPDA 3K2QA 1YIJH 4QOHA 2B1RA 4JUCA 5EHGA 3PNPA 1KI3A 1EM8B 4IAOA 3QKSB 1IOZA 1XQ6A 4RHUA 3M7IA 1TCBA 4BTEA 3JVUA 4ZIRB 4RGBA 1FSZA 4K88A 4K9QA 4HY3A 3IIIA 3WWOA 4ZVKA 4N3BA 4L9WA 4EQ6B 1EUQA 3VGPA 1BDJA 3SHQA 4JUZA 1R4NB 3PR2B 2CDBA 3FFTA 2ZREA 4KOEC 1I7DA 4FZJA 4U5XA 3CZMA 1Z68A 5DXAA 4GM1A 4YDSA 1ZI6A 2P9YA 4KYVA 1JZSA 5IAEA 2WE8A 3DMGA 3PUHA 4X41A 1UOEA 2I6UA 4EY7A 4A27A 1Z2NX 3KQUA 5F1YA 2BCGY 1YRLA 2OT3B 4W5JA 4EP1A 1SHKA 1KS2A 3IVGA 2IH2A 4MGKR 1GTSA 4ENWA 3S0JA 1DIOB 4RM3A 2WU0A 1HF3A 3GRUA 2DPXA 3BIXA 1UKEA 2QMYA 1FRNA 3Q12A 4PSDA 3BABA 1M2WA 4NATA 1AK1A 4TXLA 2R87A 3AV3A 4AJPA 1CDZA 1NQOA 2P3SA 1WMAA 2F67A 4EHBA 3AMVA 1ORHA 2GAJA 4YYYA 3JAKB 2WKSA 3QLUC 3OT4A 4RV5A 1VHTA 2D4HA 4X3PA 4QBHA 5G3YA 2AHOA 1S01A 1I2AA 3KWMA 3LH5A 1NPYA 3AR4A 2GRUA 4H7JA 5TRTA 3BAAA 3FGZA 1LFAA 3CBGA 1X6VA 3C6XA 2NV6A 1Z2PX 3EXG2 2FFBA 4Y9RA 5U4QA 3QVJA 3V8QA 3S2ZA 2DBVO 1UANA 3OQMA 1GG5A 2JL1A 4O7NA 4I46A 1E2DA 5ITWA 4J9LA 1FS5A 4M0KA 1E0JA 2FMUA 4GT1A 4U67J 5JC8A 2DQYA 1EUYA 4Q4LA 5K3BA 1EIZA 1KP3A 1JJVA 4D9BA 5HIMA 1RLOA 2WFMA 1R0CA 3S70A 4UE3S 1NW7A 1NF3A 2J9XB 4FYVA 5JBQA 5YASA 5HBRB 5D3MA 3BTUA 1RWKA 3ZOKA 5HNEA 1ET0A 3SC2B 4NZNA 2JLVA 3WQBA 2ZRNA 4PQFA 5FTJA 4J16A 2P2ZA 2F1JA 3LZ6A 4F4FA 1YZYA 2YZ2A 2WM2A 3DPUA 3DL4A 1DBPA 3I4FA 1E18A 3RGGA 4FFDA 1OKKD 3AIIA 4FWBA 1SRRA 5HDQA 3THXA 3MT7A 4XWOA 3N70A 2X3UA 1Q3TA 4KO3S 3NPMA 5AJWA 3FNHA 3S2IA 3FCCA 2WYUA 4OYYA 1I0LA 2AUNA 4OCZA 4LVCA 3HT5A 2KYRA 5DMHA 4BP1A 121PA 4ZAYA 4QBKA 5EZYA 4B3XA 4XX0A 4GWLA 4A3FG 4JI3H 3U7QB 1G291 1EP9A 4X94A 4HCJA 4E2YA 2OBNA 1VQ9H 1AS0A 2RGBA 2X5KO 1D5WA 4M8LA 5A4IS 3H6HA 1O87A 4M76B 4IRDA 3TIGA 1TJNA 1QORA 4HUTA 4M2LA 3IUNA 4IUBS 1D9XA 3VR1A 4OVKA 5A0FA 1C7FA 1L3BA 4KE6A 1NUTA 2DBQA 3PWTA 2WJJA 3HCDA 1IYEA 4KI7A 3ZK7A 3RBAA 3OJFA 2WWTA 4D9IA 3V4ZA 2HK9A 4EEQA 2RGDA 3I0ZA 1P0CA 5I3CA 4F4WA 4MGZR 4C7ZA 1NBOA 2DFNA 1ZD3A 3M8KA 3AEUB 1QH1B 5KFSA 3O95A 1J5PA 3HJBA 1UWKA 2JVIA 3IEKA 3RJ0A 3O4RA 4BNUA 1YIDA 2A67A 4NI5A 2JBWA 2NU6B 1PQUA 1WOYA 4Q1DA 4R9NA 1YDFA 1JDSA 3SCZA 2QHXA 4QNNA 1JIVA 4YP0A 1K0UA 3WNDA 2AUMA 2GFQA 1P29A 4Q45A 3BZBA 4EEXA 1UQRA 3G85A 2W8KA 1XV5A 4YRJA 1PQPA 4IKPA 3L0SA 1OWTA 4EZBA 3G4SH 4YBRA 4C4RA 2OBLA 1OASA 4OEHA 5FUWA 3N28A 4RY2A 3U4GA 4M0UA 2F4NA 4AJLA 2QN6A 3IXMA 4JEHA 2W2KA 5HILA 4UU0A 3UANA 4B3CA 3VYSB 1PG5A 5H68A 3FPHA 3C7CB 4HDQB 3Q98A 4DUGD 4EUNA 5F21A 2ALZA 2VHVA 2HFKA 4CI0B 3H5WA 3TLYA 1F3OA 2C3YA 5ARDA 4GD3Q 3GFTA 3RUIA 2V5VA 4J7AA 1I9GA 3RS2A 2FQXA 2R6CA 3MHTA 4HAIA 5E2AA 1E2GA 4QYTA 2FRDC 1JE0A 1E60A 4QG7A 3FTPA 3RNOA 2CXTA 3PZPA 4FB5A 1OLXA 2BL4A 2XDYA 5EMHA 1H4TA 4G5FA 4LDZA 3WGJA 3BEOA 5TPZD 2BKXA 5ULLA 4XOIA 2XC9A 3UB3A 3QQ5A 3DKKA 1AJEA 1ZRSA 2HREA 3VTFA 4R1PA 1U2RA 5FFMA 4HAUA 4HLQB 1Q92A 2V9CA 1Y89A 1N62B 3D2BA 1KQOA 1NG9A 4Z4CA 4DV1H 3RHFA 4A36A 3TX6A 4HLUC 3BE5A 3VV3A 1DFIA 3VDMA 4DG8A 3LQFA 5H3LA 3VO1A 3MF4A 1HI9A 2AMLA 1Y3BE 1YVRA 4A03A 4E2ZA 1LTKA 4QOGA 4X1KA 3I5XA 3BWCA 1TWCA 4DDUA 5FA8A 4XWYA 4IGKA 3EXIB 4QXRA 1QO0D 3EB9A 4P3PA 4Q1EA 1IQRA 1N78A 2HBZA 3S2FA 1NBME 1ZGZA 1SCUB 5CFNA 4KDEA 3IN5A 3NKLA 4XE5A 4RB1A 3ZN2A 2HDHA 4G0YA 1L7VC 1EP1B 3RRBA 3ZX5A 4BX0A 3HKBA 3M9WA 4EKYA 4RS4A 2CN1A 2QN3A 3PDIB 1XK5A 4BVGA 3RBXA 1JTFA 1EX9A 3CPSA 2HHCA 2QUBA 4UFPA 4LJ7A 4DV7H 2PT9A 3CZRA 3RIEA 2XGGA 4C3UA 1UWVA 1S3IA 2HR1A 2O52A 1QTNA 4CM8A 1FM0E 1UP4A 3R6TA 4XZ3B 1PGPA 3CVWA 2BMFA 1USIA 4BWSC 3DFIA 2CK3D 1NUHA 2VQ6A 4FQ5A 3TMAA 4MQ4A 5C4IA 2HMUA 3TOVA 3NTUA 2YQ5A 1SZDA 4OGLA 2ADOA 3VOBA 7MHTA 3LW8A 5H1SO 2ZW9A 5C7YA 3RRYA 1ZHQA 2HPVA 3R0QA 3VI4B 1HE3A 1EX6A 5C8ZA 5HUOA 4HJRA 5ALHA 4FBMA 1U0TA 3UAZA 4I81A 2PT7A 1L7RA 1LSOA 4LOAA 2M1XA 2GAAA 4ZZ3A 5JD6A 3QTLA 2QSJA 3PC8A 3NOXA 4RTMA 4E07A 3GQBA 4GFDA 3N2KA 2HU8A 1NULA 2D5IA 3AL3A 3UO8B 4CKEB 1JQKA 1TTQB 1FBNA 3RTDA 1ZAUA 3BMOA 2VA2A 2XNCA 4EY3A 1FFUB 4IO9J 3L8HA 4RAOA 3SNHA 3MD9A 3SQLA 3ZDBA 2OV2A 4NU6A 5C52B 4X1YB 3S2UA 3QVTA 5M5BA 1NPTO 4B34A 2HU7A 5A3JA 2HSWA 3QVLA 2VTEA 4ARBA 1EI9A 2CT8A 1F14A 5IXJA 3DO5A 2W9AA 1A2OA 5GIOE 1BDBA 3OOHA 3LRTA 3CB2A 4IXMA 3MR2A 4WFQA 2DGDA 3ORRA 2ATXA 1M1ZA 4R7TA 4JMLA 1EB9A 1YB1A 4C0SA 5F73A 1HT2E 1UK7A 3T5LA 5C81A 2OZLB 3R9XB 3PBKA 4C01A 2DWCA 2ZTSA 3VISA 5WRFA 4AS2A 4B6GA 3ENVA 2BPOA 4OHOA 2CNQA 2PO7A 3K9CA 2YIDA 2QOEA 2HGWA 1V3UA 4EVRA 3CUEF 2MYUA 4MDHA 3UOGA 2O2SA 2LCIA 1ZZEA 2ZM6H 3U3MA 1WKIA 3RAXA 2GEDA 4XGNA 2YUIA 3KTMA 5EJ8A 2OCAA 5KSWB 2DPYA 3H8SA 4FSXA 1EUCB 2CNOA 3C3DA 5PNTA 1VQ6H 3FR8A 3TFWA 1EVIA 4CLHA 2H4ZA 1SBQA 3DB1A 3U7JA 3R75A 3FVTA 1L1EA 4M86A 4JC8A 4ENVA 4XPIA 1HE4A 3BL6A 3GMDA 3NDIA 5LPNA 4LE0A 1GGHA 1J5XA 2ZP1A 3CEMA 5EWFA 3JPWA 4B4DA 1ISHA 1JKFA 2Z56A 1FQOA 5EMLA 4NBNA 4UVIA 1L7NA 2OR3A 5D3QA 4BGVA 1UBOS 2QJWA 4IY1A 4P92A 2JI4A 1EBFA 5KDOA 5BW6B 1O03A 1IIRA 5IAOA 1RCUA 3R3VA 4KQMA 1E79D 4EH1A 5A2QA 3B6ZA 2BKUA 4PNHA 3B1VA 4EGAA 4NCXA 2ZTMA 3BGOS 5KFCA 3H19A 4CM4B 1OGIA 1AN0A 2CW7A 4AROA 3QFSA 2G4VA 3PF8A 4D4JA 4RUAA 3ZJYA 3UPDA 4JJIA 2GBLA 4NXMH 1MO3A 5CB4B 1MABA 2QUJA 5JMWA 3E53A 1U7WA 4OBEA 1PEAA 2VCEA 3KEGA 3Q9UA 4FYJA 2XCRB 5FPTA 4RD0A 1IAVA 2D3TA 1Y5LA 3F90A 1YDWA 3B9BA 2PZGA 3EZ7A 5M7EA 4OAQA 4JI4B 4QE3A 1H8HD 1B3RA 2XTAA 3JATA 3DZCA 3PFCA 2CKZB 1EDBA 1YDGA 4FOLA 4C30A 1CERA 1N6NA 5EWEA 1RT9A 3VU0A 3G8CA 4R7ZA 4L3WA 1VA4A 2PZJA 2VJDA 1W88B 5EVCA 3V2HA 4DIEA 4QQKA 3KQNA 3AOGA 1Q2XA 2J8ZA 3U7RA 3U19A 2NO4A 3WKAA 3WSVA 2FE1A 2AFHB 4CL3A 1VCMA 1NVBA 1YITH 5LXTF 3UJNA 3VR4D 3VNUA 1KMHB 1M67A 1MAWA 1D8TA 2JZCA 4PG4A 4RD1A 4CGYA 2X1LA 2CSXA 4FIZA 5LMNB 4TXNA 1ISSA 1FVIA 2CLEB 3CA8A 1QP0A 4B3MB 3SXUB 1ZG3A 1CZKA 4PHFA 5CAEB 5FTWA 4LX8A 3A58B 3KKEA 4BLWA 2FMXA 2M6RA 3LSTA 4HYYA 2CZCA 7AT1A 2Y71A 2PDAA 5HHTA 2R44A 2X2PA 3SN6A 3UHOA 4GBJA 4E5MA 4XYMB 3WS7A 3NVMB 4TL9A 1WY5A 2BF4A 4ZKDA 1E6UA 1OW3B 1M2GA 1IHDA 4ZYUA 5EMNA 3HJUA 4NS4A 1VMEA 2W2LD 1DV1A 2H54A 5J4KA 4LHZA 2J9GA 3KHRA 5JFOA 4LYJA 3EPPA 1CE8B 1EIWA 3IDAA 4CGZA 1QVWA 3HCPA 4XWGA 5HIIA 5HZHA 1GU1A 2IDZA 4DDTA 2VJNA 1A1SA 4NCKA 4F4UA 4TWIA 5KTOA 2R7KA 2CUZA 2VP3A 1X7GA 2PJDA 4UMEA 3J80A 2J6BA 3UMSA 5TQJA 1YCFA 1GDTA 4AJOA 2C88A 5MN5A 4ZVVA 4FW8A 3N2IA 1Z83A 5A05A 4MCIA 2VQEH 3ADBA 4QUGA 4BO8A 1T94A 5KT3A 1G9TA 1U8EA 5HPYB 1XZNA 2UAGA 4ZFNA 2HO5A 2GN6A 1SVOA 4Z0HO 2GESA 2DHQA 2YJNA 3R5FA 4PHGA 3CH4B 1A5SB 1UDCA 5MDHA 1D07A 1KAEA 2W58A 4DSNA 2H4WA 1G2IA 4XUCA 2J87A 2X58A 1EVQA 4JLSA 5IJAA 1XR3A 1JFRA 4JT2A 2HT6A 1H3NA 8ATCA 3MGCA 5E2IA 5BR4A 2Y4OA 1G18A 2HB6A 1UQUA 4EYKA 1M2OB 5KU1A 3TD2A 2AA3A 4YWHA 4LXGA 3Q7SA 4IDFA 5CB8A 3EZ2A 3WKEA 1V25A 2FX2A 3ZDCA 2QVCA 3FKQA 3AKDA 2VATA 1J39A 4RQUA 1F06A 1OT3A 5B58C 4CIVA 5JH7A 2BRUA 4CUJA 4LFAB 4HN4B 4KO1S 4O4HF 2QTBA 1W4AA 2X0JA 2F9LA 4QIWE 1RRCA 3NOVA 3OG9A 3K0EA 2Y0PA 1ESCA 2DBZA 2Q1TA 1COWA 3VR6A 3IQDB 5KCZA 2YDYA 4ZCPA 1MVNA 2V54A 5JSUA 1SXQA 1YFKA 3IEUA 1LZKA 3TBHA 5KT5A 1FP6A 1B0ZA 1ZNZA 4JLWA 3CNHA 1NSTA 3C14C 2FW9A 2R6DA 1MIHA 1LQUA 1P19A 3G9XA 3LLVA 1JEYB 1CT9A 3NOQA 3UMJA 3PP8A 3GHHA 1JL3A 3RB4A 1R5OA 2V6MA 1XTVA 2AN1A 3HNOA 4WUTA 3YASA 3AUTA 3QUTA 1YVPA 2Y92A 3MCVA 3E2IA 4YYEA 1JH9A 1I1KA 3KZ1E 4TLAA 4IIFA 4EPRA 4RZQA 5JROA 1DZ3A 1LI5A 5CR5A 1Q7GA 1X14A 1AG9A 3UTCA 2O8FA 1Q6ZA 2OC4A 3BKWA 3FF1A 3L7CA 2GEBA 4ZI7F 4A3IG 5BWOA 4KV7A 4PONA 1JVBA 4JI1H 3GV8B 3AB7A 3GT3A 4KQ6A 2ZTLA 3VKUA 3WFIA 1Q7TA 1Q22A 2CLDX 3DNFA 2LR0A 2XCIA 4FCWA 2AVDA 3M33A 3PTAA 2UZ4A 4YAJB 2JD1A 1GD1O 3CX4A 2OECA 1L4HA 4YQEA 4OYLA 3EVTA 1PWEA 1QFYA 1ZJYA 1NBHA 4I7EA 3HN6A 4KIJA 1ZY2A 4GMDA 4NTZA 4EQZA 4TV9A 3CZ9A 4JZYA 3ETNA 2RHHA 4JJ7A 2VI5A 2RDJA 3FCUB 1NIJA 4YAKB 1P7WA 1MQAA 2W6QA 3EWSA 5F23A 5F9LA 5AYVA 3W9SA 3AX6A 1U4NA 1VGRA 1RQNA 1RJ9A 4WLFA 5B1DA 1VLMA 4Q19A 2ZZMA 4Y2HA 3RE1A 2QG6A 3K1AA 3K9GA 4RF5A 1TAHA 1Y7TA 3W8EA 3S68A 4JP8A 4O2AF 1NL3A 2M2IA 4BLOA 3D0RA 1OYVA 3DOIA 3FD8A 3VNAA 1KBLA 5B3JC 1AKUA 4PVCA 3VYTB 1QRUA 1ZN7A 3ZQ4A 1LNQA 1RQLA 3ZIAA 3CCQH 3Q15C 2Q5OA 4O3RA 1FDVA 1E63A 3TPZA 1NYLA 1FBTA 5T4BA 2WM3A 3DNMA 1GL9B 2XEXA 2QX6A 1MOQA 2MJLA 4D4MA 4R41A 1V7QA 1CY0A 1F4LA 1KIAA 4QHYA 2NVWA 1P6UA 1MAVA 4I2VA 1M34B 1O3YA 3ZWWA 2A1UA 3UJCA 1WKVA 2JJ2D 2QRZA 4GR5A 5C7LO 2VPZA 2DB3A 1K4KA 2E21A 4NCNA 2Q5EA 2R5NA 4MCAA 3ZY6A 2RE8A 2O2YA 3V4VB 4HNGA 4N8DA 4LHVA 3BXFA 2D5BA 4TTRA 5DM6J 4LF8H 4MUAA 3S4YA 3LM8A 3MMPA 1RXVA 2CQYA 1SOWA 3R5HA 5EZ5A 1DCFA 3TTXA 3GFSA 3HB5X 2LW7A 5CLHA 1N34B 3EIUA 3AB3A 3TLBA 1TM5E 2WIBA 2PTHA 3VU9B 3CCEH 3AFHA 3Q9LA 1SQ6A 1QKJA 2R00C 1SMKA 4QJBA 3ZDDA 1IHUA 5D2CA 3Q3JB 3M5WA 1USWA 5DLPA 2AN4A 1VOTA 4O4IA 3LQKA 3TKLA 5CM8B 1UJ2A 2L42A 3RRFA 5T4EA 3EXEB 4W8GA 4LI0A 2H5JA 5IJXA 2HJSA 3P2EA 3IHWA 3IULA 3QG5A 4MYCA 1IZZA 3TCKA 5E3IA 1D0IA 1MG0A 4J9QA 2FSGA 2YW2A 1ZOLA 1JG4A 5JS7A 2R4UA 4KZKA 2HLDD 3ZEIA 1A5AB 1P7VA 5AK4A 1N3YA 2OYCA 2EFHB 4QJ3A 3EDMA 1BJRE 3I23A 2P0EA 5LQKA 4D92A 1IPEA 1EXMA 3A9SA 4JOBA 4M9RA 4EOGA 3GGSA 2I78A 1VJCA 3D9QX 2PUJA 4F91B 3H18A 1KSGA 1I13A 5EIHA 5F51A 1FVFA 2C2MA 1YUNA 1WD7A 2UVRA 4P1ZA 1DMSA 4DF3A 4E1VA 1NVDA 4D25A 4G0QA 3S81A 4F9FA 3QP9A 5ALKA 3IMKA 2WSSA 4ERNA 1XF9A 2TRSB 2WK6A 3H5QA 3UWKA 2V7QA 3LHFA 2EJUA 5ITZA 3T9DA 5JY6A 1SFOA 4N40A 3BTSA 3OKAA 3FUXA 1LTHR 1M73E 1ABFA 4UMFA 2CE7A 3HUTA 3QWIA 2QP3A 4CMCA 3ZOZA 2WF8A 2V6GA 3U4MA 4D9CA 1XAJA 4NC9A 3EPHA 4NMMA 5TX7A 1XHEA 4F96A 2Z6AA 2XIQA 1X0XA 4QAQA 2QSYA 3SIRA 3THSA 3WB0A 2FW8A 3WGUA 3GVXA 5FI5A 4JLOA 4X0EA 4QBFA 2PA3A 1L7BA 2FR8C 2B21A 1GUDA 3TQSA 1BH2A 5LOVB 5IP9G 1JDJA 4F9GA 4ME6A 3U26A 5NULA 2AUTA 3ID6C 2QPAA 2EJTA 3PGA1 2HUPA 4J0DA 3RR5A 1ONNA 1XCOA 2V8BA 2JLCA 2PD6A 1OH8A 1FTQA 3GP5A 2H07A 3JQEA 2XZOA 3A1VA 3EGXA 5T3YA 5ADHA 2WLTA 5FIUA 2VUUA 1JLRA 1KH2A 2Z09A 1QWSA 5I7WA 1NTOA 4ND7A 2DUNA 4KR3A 3RVDA 1FU8A 3RWOA 4EHHA 2Y1KA 5AKHA 4MVJI 4D74A 4PO8A 3QI2A 1XTTA 4RORA 4PLCA 1QM5A 3GGDA 1OWOA 1C3VA 1LI7A 2CNDA 3NFRA 5JJCA 3HGTA 4AQYH 1SHZA 5AUNB 2AOUB 3UKJA 4OP1A 2QY6A 5JVDA 3U4QB 3QI7A 1IC6A 3UQ8A 4N01A 2UYCA 3RHZA 3USZA 2UU9H 1AS2A 3H7IA 3L79A 5C4MA 4IH1A 1WCIB 2FHSA 2FZKA 2Y93A 2A86A 1NXWA 2B7QA 2JLBA 3HM2A 3SWWA 5BV1A 3II6X 1YE3A 1U6IA 3FPGA 1N6OA 1OXTA 2WWGA 5LA6B 3M1AA 4KX3A 4O4JF 1KEVA 3BWVA 1SXJE 1N7GA 5BYKA 1QVFH 4NFSA 4RHEA 3EPGA 5DHAA 4L6CA 4WNAA 3IAUA 2X9NA 1T8RA 3IB6A 1FLVA 1N5JA 2J6CA 3JSAA 1ID1A 3CE6A 3CLTD 5BW5A 3FC4A 3QOWA 2O8BA 3PLNA 2A0YA 2XNHA 2R92G 5E1BA 2GZSA 3H3FA 4EO4A 5TMBA 1JX4A 3A6LA 1R00A 1OWMA 1JDTA 1U2ZA 1GAEO 3QU7A 4OK3A 3GMIA 2V0GA 4R1MA 3GQCA 1EZZA 3HV2A 4LF7H 2HYDA 1WSDA 4ZKEA 4GVPA 4IYJA 3N6XA 1LLFA 1Y9ZA 2WYHA 1E59A 4HNQA 2ARKA 2NZUG 1RPNA 2HDNB 3DLAA 4EUFA 4HLDA 4PQYA 4BO4A 2GCOA 2P9BA 2JAWA 2HK8A 4LV8B 1WXDA 4TV8F 3B2EA 3N7TA 4I1YA 3V33A 1I2LA 4MJ7A 2P2LA 1L4LA 3QX3A 3K32A 3TYXA 5FD6A 3MD0A 1BW9A 1SKBA 2GDJA 5CTAA 3O4VA 4ENUA 1V35A 2IWHA 4LZOA 1AN9A 1WKBA 4FJ1A 5TMPA 3UAOA 3AZOA 5AICA 4YCMA 3CVZA 1N36H 2REQA 2NUPA 2OFXA 5AI5A 2QRHA 4QVKA 4RIGA 1OXSC 1DG9A 3BIJA 2PCJA 2R92A 4PCVA 4FDTA 2ID8A 4KN8A 4XR4A 4ZEWA 4NZOA 1DMRA 1SXIA 1HL3A 1KSHA 4LG1A 5DX1A 3VJKA 5B4UA 4QIHA 2G71A 4KHPB 4R1LA 3H6KA 1M8FA 3DZIA 4KXUA 2R6HA 1RWVA 3UVEA 3JY6A 4YUAA 1T8PA 3L7NA 3KDSE 3EOBI 3TW4A 2YNMA 5EWLA 2PMKA 1T9BA 4YT8A 5KC9A 3WBFA 5FD8A 3GRYA 5CXSA 4BYGA 5BWWA 3KOUA 4K6MA 4M54A 3IAM6 2PYDA 3V97A 1CP2A 2P6MA 4P31A 1CZLA 1CKMA 3VKGA 5E7QA 1NJ6A 4FWTA 3WLIA 1XD8A 1WUKS 4XSHA 5A3RA 2OV6A 4G4JA 3TW6A 3I83A 5KYYA 3PIIA 4DSUA 2VNSA 4AKEA 4DA0A 4XYEA 3W5AA 2H1IA 1CSEE 4LH6A 5JQGB 1C0LA 2ZIWB 1IZ7A 4V2UA 4OH1A 2W90A 3IPYA 2FMKA 4ED0A 3SLGA 4Z1MA 3GGGA 1NI4A 1CZUA 4BLRA 2EGHA 3WA7A 4WERA 3AF0A 4GKJH 4WLEA 4Y3UA 3EYWA 2FG7C 3PDHA 4LJSA 1HTWA 1IPFA 4JI7B 3OE1A 5CFRA 1CUWA 3MRTA 4O08A 4HSEA 4P3NA 3WICA 3GLGA 3LMLA 5MFPA 3CEHA 1R1DA 2WY2D 4B6JA 5JAIA 3ELDA 3KHHA 3B6JA 4RVFA 3PJDA 3N75A 3IBSA 3SZUA 2Q1UA 2IKQA 1CZRA 1E20A 3KQMA 5ICCA 2IODA 5IM4A 4QUKA 4BUCA 1X74A 3T7DA 4ZCMA 2E85A 3KSMA 4DA4A 2SHKA 5E2BA 3TL2A 4OHCA 4YJHB 3IX7A 1SD5A 3DE1X 4GXRA 2W11A 2XTJA 3EC7A 4R5HA 4LYFA 2H5LA 2FCRA 2IUEA 2I34A 5IK2D 4DOMA 4V0SA 2GKGA 3DM5A 3KJXA 1EFPA 1U7XA 4DLWA 3KLNA 3BG5A 5HZGA 4IHJA 2F6RA 3I37X 3QU9A 5BQPA 5TEWA 1E9FA 2QKYA 1N2IA 5FTLA 2E2IA 4ZI3A 1VIDA 2ZRQA 2Q6IA 2VJMB 4WY8A 2R60A 3E05A 3O3MB 5JS1A 4UNNA 1XRJA 4KPUB 1G5FA 1B0UA 3L6CA 3FWYA 2IDJA 2QN8A 5DNVA 3PE6A 5AI8A 1HLPA 4LFCH 4F46A 2G4CA 2V7XA 1FLAA 1NMXA 4GOOD 3S44A 1AQJA 1E58A 2IKSA 2XPCA 4F9TA 4ZPXA 3KT3A 2QV7A 5AK5A 4FJ2A 4ENTA 1HNXH 1GL7A 2GRJA 4WH0A 3KUCA 4BRUA 4NJEB 1N56A 1VJGA 5AI4A 3DVQX 1UUFA 1R8JA 4AZ3A 4RTJA 4A2QA 2FEAA 1QAPA 3PJEA 5HFJA 4PG8A 3W04A 3DDNA 4Q37A 1C4XA 5SYAA 1V8ZA 2IXGA 3WK6A 1KQFA 1X1EA 3ROZA 2Y4NA 1KDYA 1EEXB 1Q14A 2F1KA 2AJCA 4OSPA 721PA 2X40A 5DISC 3GDWA 4ZO6A 3ZLTA 1KDPA 2WZBA 3OCXA 3UJAA 3DL7A 4W6QA 4CM9A 1P75A 3E48A 2FN9A 4ZN6A 2V7PA 4KH1A 4KNVA 4TQGA 3HADA 3GUHA 5BT9A 1NMEA 3EQ2A 2PJZA 2VCYA 2XE6A 1Q7BA 3FCEA 3OT1B 3NIBA 3BN3A 2P0AA 1DBQA 1KU6A 4GMKA 3QKWA 4C4AA 4ARSA 4C7BA 3NC0B 3UZOA 4H6PA 5AKIA 2WU3A 3X43A 4FNMA 2WIAA 4RELA 3ZHZA 1VKZA 3JQ9A 4DR1B 2NNWB 4JQYA 1YFJA 4XQ9A 1IHYA 3H5IA 3AY0A 4UHKA 5DNEA 1SUSA 2RK6A 2XMPA 1HE8B 3CPJB 4GX0A 1XNJA 1ZNXA 2ZT7A 3I9KA 4ERXA 4LBVA 2G36A 3H5VA 1KDOA 3FUTA 3JQAB 2SICE 5A4JA 1OFVA 4BNMA 4WESA 3DOCA 1H23A 4E4YA 3HXQA 5K99A 3CC4H 4UNPA 1KT8A 1MH9A 1QV9A 1O77A 3DLBA 2A1TR 1BDHA 1M2NA 2IE0A 2B83A 1JVSA 4GMXA 4PICA 3IG0A 2BQ3A 2JKYA 3PX2A 5ALOA 4BE7B 3M1YA 3GFQA 3DULA 1AV6A 2OHXA 4BJHB 4EJ0A 3UHAA 1F4PA 2J0UA 2B9VA 5D00A 2P6PA 2ZTHA 4HUJA 4U7HA 4ZQIA 3C3BA 3D4NA 3PS9A 1XXHB 3K30A 2IYEA 2R97A 3L0PA 1M2VA 1K6MA 1RYMA 3KCQA 1HWYA 4JBYA 3X1KA 5BUCA 2I3DA 3G2MA 3DOEA 1U3CA 2A1TS 3VDXA 1E6LA 1GZUA 1X8LA 3P32A 4W99A 3B36A 1OHHA 3U17A 3FNGA 4EELA 2AG8A 2X41A 1U4SA 1PP4A 2R68A 3I9FA 1V6CA 1M2EA 4TWBA 2FQ1A 3HKEB 1X39A 1TT5B 4CMIA 1FXWF 1J49A 1A8HA 2Z9CA 2DPHA 1JNXX 4FD2A 2OO5C 1IY0A 1LSJA 4BNHA 1G0OA 4B81A 4CCYB 3TN7A 5JDIC 2HIVA 3EVCA 3OLCX 4FMDB 1PE0A 4MVXA 4YJKA 4I4TA 4PYRA 3EGIA 3ZVRA 1KQGA 4FR5A 4R8SA 4X7PA 4UOQA 4HOYA 2UZ3A 3B7GA 1ADFA 1A97A 4UXHA 1ZC3A 1BWRA 3IP3A 5EJ5A 3EF0A 2A78A 3NYIA 3SC3A 3B8HA 2X76A 4MV8A 1IOLA 5JCJA 3ZHXA 4UHJA 1UC8A 1FYWA 1N2CB 3IHTA 1R4AA 1FTGA 4CIYA 2PAFA 3ZVLA 1Z4MA 4Y6PA 1ABBA 4JHLA 3KE8A 3LWDA 2QF7A 3WYBA 4ZREA 2J6SA 2ATCA 1ZK2A 4TM5A 1S2OA 1UINA 2H9AA 2WJVA 4O3OA 3E2PA 3C1TA 1U9IA 4QGBA 2DSTA 3STVA 3LWZA 3NHWA 2IS6A 3B8EA 1XJ0A 1R27A 1W2BH 3FFAA 4KXVA 4WA8A 1KZYC 2ATEA 5AH0A 1ENPA 3OUTA 3UCFA 3H13A 5AM4A 1THZA 2ZU6A 3T1YH 5KSZA 1Z8DA 4YO8A 4CXMA 4RTLA 1XA4A 2Q9BA 5K3AA 3NGDA 2EWWA 3KWFA 4EW3A 4B74A 1INLA 1I6LA 5H82A 3VPCA 1J0DA 4G2TA 1R0WA 2W8BA 2RBGA 4OL0A 4Q7QA 3K2EA 2NT4A 3PJFA 3ETCA 1Q7EA 1PLLA 2VJLA 1CQPA 1QJ4A 2DFLA 3E5NA 2VBCA 1IXRC 4OXQA 4UOEA 1VSVA 1C9JA 2VA9A 1HDOA 1BA2A 4O8CA 3I6ZA 4AUEA 3HH8A 5DF1A 3ZXIA 2BJWA 4JBHA 3E9YA 2E6UX 3KTAA 3Q7TA 1IRIA 1OA1A 1KEWA 2NP7A 2X8AA 4G0MA 3U2QA 3NZEA 4MVJP 4E5KA 1Z2DA 2AJTA 3DE6X 2E5LB 4LSGA 2WWHA 5KINB 3I2HA 1BJKA 4PRZA 4NENB 1W1UA 3IPRA 4PC6A 3ZWDA 1PS8A 4O29A 4PGHA 4MRPA 4E5UA 2O48X 3C85A 4P9NA 2QA5A 4GS5A 1L1QA 3OF3A 5I5WA 3NBKA 4LHMA 3KSRA 2Z5GA 2HIHA 2O7SA 3SGIA 3WFJA 1WM1A 2Y1FA 4LJRA 3RB3A 4Q1AA 3QOFA 2RGNC 2DEUA 1Z63A 2V1UA 3QEJA 4YUVA 5JI3E 2FWAA 3JQ8A 4YCDA 1OIVA 1QDUA 2BAGA 2C28A 3CCJH 1KMNA 3UAGA 2PXHA 4BFLA 2OMKA 1S7GA 1CJVC 4MNTA 4W9NC 4UUOA 2IU0A 1D03A 1X1SA 4ZO7A 2Q6TA 1V5WA 2ASJA 1SG0A 5GZ6A 2XCAA 3ZX4A 1X7YB 4G89A 5C8YA 5HJ2A 1WETA 3N41B 1KJ9A 3ZJUA 4IJUA 1RJDA 1Q1ZA 2XWPA 3MPUA 4ZI5A 1HDRA 5K0FA 1AK9A 2A7XA 1CUCA 1IONA 1D1PA 2XA2A 3GG9A 1V4YA 4DNXA 2XMDA 2CDAA 1SKQA 4ER5A 4CLDA 3A37A 1KK0A 4DPMA 4BOYA 1LU9A 3RNLA 1GCIA 1OTHA 2AL7A 4GYYA 1EFHA 4B17A 1H6DA 2J6IA 5BOVA 2CVQA 3BXEA 4CI9A 4Q3NA 4R6WA 1GQQA 1RU3A 3NFYA 5GQSA 4CKWB 4Q82A 2BFPA 3QVOA 2PUVA 3GJXC 4J49A 1G5PA 4MVJF 1JIJA 2A1HA 5IJWA 3GT7A 2N47A 2Q2TA 1CR0A 3JAMA 3BMCB 1G5HA 1GAJA 4CDNA 4XDHA 4RMHA 4HH1A 4TKMA 1CKNA 4JD5A 3KOYA 1MAHA 1JQBA 2X3FA 1TIPA 3VPXA 3A1EA 5I4KA 1IATA 3BC1A 3O92A 2FP4B 1PVOA 4J4TA 1THGA 3QYJA 3PXXA 1Q1BA 3BGWA 4UCQA 4BTLA 3KB8A 3DAFA 5ESDA 3CTPA 3LUCA 3L0ZA 1Q11A 1GM5A 1YE5A 4BIIA 5IXYA 3O9VA 3FCYA 1B42A 4R1SA 4BDTA 2IPMA 3GO4A 5TF4A 1NN0A 3TWOA 3IOBA 4A8PA 4DMUB 3WBJA 1CF9A 4K9SA 3O83A 2PSEA 1DKUA 1AC5A 6REQB 3KPVA 3HOXG 3L1VA 3TW0A 2ODPA 4DHEA 1BS9A 1YL6A 1GTL1 2E3TA 1SIBE 3MTJA 3AM4A 4QQRA 2ZXEA 4NE9A 2O0HA 4X3CA 1FMAE 4V0KA 4LZAA 3TB4A 4V1CI 4WBNA 4H4CA 5HJEA 1FFYA 2OGUA 2FF7A 4G67A 3EQ6A 2R0QC 3KZNA 1O2DA 1SRQA 3JYQA 4MRSA 2Q9CA 2YHAA 3F96A 1IY2A 5EUBA 5IBQA 3EDQA 3PYXA 3PU6A 5I9TA 5FWNA 1Y8CA 4K40A 3RJMA 2PXCA 2B4RO 3RU3A 3HYLA 3ESAA 4A6PA 2EL7A 4LJKA 4MRRA 5JAOA 1YR7A 4QWMA 5K0BA 3AF1A 1VIMA 3R6WA 3RCBA 4LYGA 3TK1A 1DEOA 3WZMA 3HKZE 1RHKA 1PZNA 2QW1A 3SFTA 4OHUA 1E5QA 2OTLH 5JNVA 2P9JA 1U0FA 4H0FA 1ID8A 3T95A 1YKSA 2FCAA 3U09A 3AJ8A 3PW0A 1AZLA 5H02A 1JGTA 3DAAA 4HZGA 4ND8A 5IH3A 2Z8YA 4ZVPA 3VR3A 1SOAA 1YA8A 1GTMA 3KPYA 2HCTA 4I55F 5LQRA 3UJBA 3FH0A 4M98A 5BQ5A 1EGHA 4BO3A 1ZN9A 1YQWA 3OAAA 4CM7A 1DAPA 1U11A 1V4NA 2WKQA 1QVVA 5GVRA 1XWWA 4NBLA 3SJBA 3OLZA 2IIBA 1ZQ7A 2BR5A 1OVGA 3ENNA 4Q9DA 2OPHA 3RS0A 1O0BA 3R5KA 2BFAA 4GLFA 4B40A 1QH8A 1EP2B 3G2IA 5KWVA 2YWRA 2FUG1 1C3OB 5CURA 3X1DA 2IHJA 3W1BA 3RBZA 4QU5A 2HPHA 2AHRA 2D0DA 4B6EA 2QG4A 4C3ZA 3L7YA 3Q4GA 2QS9A 2GFIA 3K9QO 3L84A 3ROQA 4QEDA 2WJAA 2JHAA 5JR3A 2X14A 3BMNA 5DM2A 3MT0A 5B7QA 2NSJA 2Y1DA 1NJIJ 1XZCA 2X0KA 3BILA 3QOXA 3HVKA 4H3KB 2YHSA 1UBCA 3I6BA 5GJWC 1MGOA 3WGZA 3WJ7A 2WZDA 4OXIA 3NBYB 4F3TA 4QGGA 1ZSVA 1XCPA 3FLMA 1IHXA 5DHSA 4HDMA 4WK0B 2C9CA 1WE2A 3A1SA 3EPLA 3BMQA 3USES 2RBKA 4QDUA 3CT6A 5K03A 3PRJA 4BCDA 2KBEA 1S3FA 4GF5A 4KQCA 1W5SA 2MR6A 3FOFC 4HQNA 2C9MA 1JQ3A 4DYHA 1MTZA 2C20A 3ZCTA 4FYIA 3PSHA 2PMWB 3BRCA 3IAAA 3LGXA 2X0RA 2W2MA 3W2TA 1X1BA 2IYSA 3SZRA 4G5YA 3N5CA 2GZAA 3ZCPA 5L4LA 4CKZA 1NN1A 2C3OA 3ED1A 3ZG6A 3ZW9A 4DM3A 1K2WA 2FV8A 1HEYA 3HDVA 4K3UA 4Y1RA 4N48A 4ZCIA 2W7TA 3CCMH 5DQIA 3CF2A 4ZOLA 1T3LA 1FW8A 2YASA 2W70A 2YBDA 4TVOA 2ZCVA 1CIPA 5K8IA 2PFGA 2P3LA 5BN1A 2IY8A 4BQFA 3HLYA 1GZHB 1KSJA 1UKYA 2H8GA 3G7SA 5BUSA 3Q3CA 2R8IA 3O94A 5E9JA 2VTKA 1ZH4A 1ISRA 4NU0A 3IP1A 3SGLA 1WCXA 3FYUC 4Y6OA 4RFSA 4O4LA 3GLGE 2ORVA 3QPWA 5IVHA 5KI6A 3GY0A 3AR6A 5DWVA 4GX1A 1N5WB 3OOJA 1U8TA 1MEEA 3N2EA 4J0IA 5COQA 3SKXA 3HVIA 4C14A 2B4AA 1P8JA 3JWHA 4FS3A 5JAUA 3VR5D 3TQRA 2L2QA 2Z1NA 4OA8A 1XA3A 4J0EA 2C4MA 4LEIA 3KEOA 4A8JA 2ONYA 3JARB 2I4TA 1SY7A 4Q00A 3DBHA 3RYHA 3PFHA 3W3AA 5IN5A 3NVYC 3C24A 1N6IA 2QBYA 2FE3A 1HO3A 1EDOA 1CNEA 3L1KA 3DV0B 4HGNA 1LSSA 1DWUA 5ENDA 4M60A 5JI2E 4PRKA 1RLTA 4FEYA 3Q11A 2R3SA 4JBGA 3L18A 4C0LA 3A10A 1I2DA 3C16C 4FC6A 4UY8M 4B75A 3SYRA 4U7PB 4II2A 4RTRA 3OPQA 3T1HH 4QTZA 3OSPA 2NVOA 4QA9A 4RK5A 5H0IA 2ZWPA 2DHRA 1ZD9A 3HDQA 4DN6A 5JLAA 3T9CA