1K73J

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
167
structure length
156
Chain Sequence
KPGAMYRNSSKPAYTRREYISGIPGKKIAQFDMGNNGAGPTYPAQVELVVEKPVQIRHNALEAARVAANRYVQNSGAAANYKFRIRKFPFHVIRENKDGMRAPFGKPVGTAARVHGANHIFIAWVNPDPNVEEAWRRAKMKVTPTINIDSSPAGNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule keywords 23S RRNA
molecule tags Ribosome
total genus 27
structure length 156
sequence length 167
ec nomenclature
pdb deposition date 2001-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 1k73J00
5JVGJ 1WKIA 1JJ2H 3PIPJ 5DM7J 2QEXH 3I56H 1VQNH 5MLCO 1QVGH 3CCVH 3G71H 1W2BH 3CPWH 1VQPH 4IOCJ 4UY8M 4WF9J 4WFNJ 3CCLH 5GAGN 1KQSH 1M90J 5GADN 1YI2H 1YJWH 3CCRH 5JVHJ 1K8AJ 1M1KJ 1S72H 2OTLH 2PA2A 2ZJRJ 5AN9F 1VQ8H 1Q86J 5GAEN 1VQKH 3G4SH 1VQMH 1Q81J 3CC2H 4IOAJ 5HL7J 1Q82J 3OW2H 1VQ5H 3J7ZM 1K9MJ 1N8RJ 5H1SO 4WFAJ 3CC4H 1YJ9H 3CMAH 4U67J 3CCMH 3CF5J 5DM6J 4WFBJ 2OTJH 1VQ7H 4WCEJ 3CXCH 1QVFH 1VQ6H 3CC7H 1NJIJ 3CMEH 3G6EH 3CCUH 3DLLJ 3CCQH 3I55H 1KD1J 1YJNH 1KC8J 5GAHN 3CCSH 1YITH 1Q7YJ 1YIJH 1K73J 1VQLH 3PIOJ 1VQ9H 3CD6H 2QA4H 1YHQH 3CCJH 2ZJQJ 4IO9J 3CCEH 1VQ4H 2ZJPJ 1VQOH 1Y69K
chains in the Genus database with same CATH superfamily
5JVGJ 1NVJA 4LHMA 1VLBA 1WKIA 1FFUB 1OTPA 1JJ2H 4GA5A 1QAPA 3PIPJ 3C2RA 5DM7J 3NVVC 3I56H 2Q5WE 2TPTA 2QEXH 3EUB4 1VQNH 1SIJA 5MLCO 3SR6C 1QVGH 1NVIE 1YTEA 4C7ZA 4KWWA 3CCVH 3G71H 1YTDA 1W2BH 4US8A 3CPWH 1FM0E 1VQPH 4IOCJ 1RM6A 4UY8M 4WF9J 4YEKA 3AM9A 4GA6A 3VMMA 4WFNJ 4X46A 1N62B 1AZYA 1VDVA 5EY3A 3CCLH 3NVYC 5GAGN 1QPRA 1KQSH 1M90J 1FO4A 5GADN 1YI2H 4US9A 3BIIE 4KWVA 1YJWH 2OMDA 5MPOC 1FFVB 3CCRH 5JVHJ 1BRWA 3C2FA 2DSJA 5HUPA 1FMAE 1K8AJ 2B7PA 5HULA 1M1KJ 1S72H 2I1OA 2OTLH 2PA2A 3ETRC 2ZJRJ 1ZXIB 5AN9F 1VQ8H 1QPQA 1Q86J 5GAEN 3NRZC 4GA4A 1VQKH 3G4SH 1JROB 4YYYA 3AMZA 4C80A 1WYGA 1VQMH 1Q81J 3RPFA 4USAA 1UOUA 3CC2H 4IOAJ 5HL7J 2E3TA 1Q82J 2WK6A 2J0FA 3WO1A 3OW2H 1VQ5H 3J7ZM 1K9MJ 1JRPB 3L4PA 5HUOA 1N8RJ 5H1SO 4WFAJ 3CC4H 5EP8A 3NVWC 1N5XA 2QIEA 2WK5A 1YJ9H 3CMAH 4U67J 3CCMH 3H5QA 3CF5J 5DM6J 5AYYA 5AYZA 3WNZA 4C7YA 4WFBJ 2OTJH 3NS1C 4ZOHA 1X1OA 1VQ7H 2W3SB 2W55B 3B9JC 1V97A 4WCEJ 3L0GA 3CXCH 1QVFH 3AN1A 1YTKA 3GNNA 4EADA 2WP4A 5AYXA 1VQ6H 1N63B 3CC7H 1NJIJ 3CMEH 3G6EH 1SB3A 3CCUH 3DLLJ 3C2OA 1O4UA 2B7NA 2I14A 3C2VA 3CCQH 3I55H 3PAJA 1QPOA 3NVZC 4EAFA 1KD1J 1YJNH 2W54B 1KC8J 2W3RB 5GAHN 3CCSH 1YITH 3FC4A 4XR5A 1Q7YJ 1N5WB 1YIJH 1K73J 4I9AA 1QPNA 1VQLH 3TQVA 3PIOJ 1VQ9H 2B7QA 1N60B 2JBMA 3CD6H 1DGJA 2QA4H 1YHQH 3CCJH 2ZJQJ 4IO9J 3C2EA 3CCEH 1VQ4H 2ZJPJ 3FAHA 1N61B 1VQOH 1FIQC 4AP8A 1Y69K 3WO0A
chains in the Genus database with same CATH topology
5JVGJ 1WKIA 1JJ2H 3PIPJ 5DM7J 2QEXH 3I56H 1VQNH 5MLCO 1QVGH 3CCVH 3G71H 1W2BH 3CPWH 1VQPH 4IOCJ 4UY8M 4WF9J 4WFNJ 3CCLH 5GAGN 1KQSH 1M90J 5GADN 1YI2H 1YJWH 3CCRH 5JVHJ 1K8AJ 1M1KJ 1S72H 2OTLH 2PA2A 2ZJRJ 5AN9F 1VQ8H 1Q86J 5GAEN 1VQKH 3G4SH 1VQMH 1Q81J 3CC2H 4IOAJ 5HL7J 1Q82J 3OW2H 1VQ5H 3J7ZM 1K9MJ 1N8RJ 5H1SO 4WFAJ 3CC4H 1YJ9H 3CMAH 4U67J 3CCMH 3CF5J 5DM6J 4WFBJ 2OTJH 1VQ7H 4WCEJ 3CXCH 1QVFH 1VQ6H 3CC7H 1NJIJ 3CMEH 3G6EH 3CCUH 3DLLJ 3CCQH 3I55H 1KD1J 1YJNH 1KC8J 5GAHN 3CCSH 1YITH 1Q7YJ 1YIJH 1K73J 1VQLH 3PIOJ 1VQ9H 3CD6H 2QA4H 1YHQH 3CCJH 2ZJQJ 4IO9J 3CCEH 1VQ4H 2ZJPJ 1VQOH 1Y69K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JVG J;  1WKI A;  1JJ2 H;  3PIP J;  5DM7 J;  2QEX H;  3I56 H;  1VQN H;  5MLC O;  1QVG H;  3CCV H;  3G71 H;  1W2B H;  3CPW H;  1VQP H;  4IOC J;  4UY8 M;  4WF9 J;  4WFN J;  3CCL H;  5GAG N;  1KQS H;  1M90 J;  5GAD N;  1YI2 H;  1YJW H;  3CCR H;  5JVH J;  1K8A J;  1M1K J;  1S72 H;  2OTL H;  2PA2 A;  2ZJR J;  5AN9 F;  1VQ8 H;  1Q86 J;  5GAE N;  1VQK H;  3G4S H;  1VQM H;  1Q81 J;  3CC2 H;  4IOA J;  5HL7 J;  1Q82 J;  3OW2 H;  1VQ5 H;  3J7Z M;  1K9M J;  1N8R J;  5H1S O;  4WFA J;  3CC4 H;  1YJ9 H;  3CMA H;  4U67 J;  3CCM H;  3CF5 J;  5DM6 J;  4WFB J;  2OTJ H;  1VQ7 H;  4WCE J;  3CXC H;  1QVF H;  1VQ6 H;  3CC7 H;  1NJI J;  3CME H;  3G6E H;  3CCU H;  3DLL J;  3CCQ H;  3I55 H;  1KD1 J;  1YJN H;  1KC8 J;  5GAH N;  3CCS H;  1YIT H;  1Q7Y J;  1YIJ H;  1K73 J;  1VQL H;  3PIO J;  1VQ9 H;  3CD6 H;  2QA4 H;  1YHQ H;  3CCJ H;  2ZJQ J;  4IO9 J;  3CCE H;  1VQ4 H;  2ZJP J;  1VQO H;  1Y69 K; 
#chains in the Genus database with same CATH topology
 5JVG J;  1NVJ A;  4LHM A;  1VLB A;  1WKI A;  1FFU B;  1OTP A;  1JJ2 H;  4GA5 A;  1QAP A;  3PIP J;  3C2R A;  5DM7 J;  3NVV C;  3I56 H;  2Q5W E;  2TPT A;  2QEX H;  3EUB 4;  1VQN H;  1SIJ A;  5MLC O;  3SR6 C;  1QVG H;  1NVI E;  1YTE A;  4C7Z A;  4KWW A;  3CCV H;  3G71 H;  1YTD A;  1W2B H;  4US8 A;  3CPW H;  1FM0 E;  1VQP H;  4IOC J;  1RM6 A;  4UY8 M;  4WF9 J;  4YEK A;  3AM9 A;  4GA6 A;  3VMM A;  4WFN J;  4X46 A;  1N62 B;  1AZY A;  1VDV A;  5EY3 A;  3CCL H;  3NVY C;  5GAG N;  1QPR A;  1KQS H;  1M90 J;  1FO4 A;  5GAD N;  1YI2 H;  4US9 A;  3BII E;  4KWV A;  1YJW H;  2OMD A;  5MPO C;  1FFV B;  3CCR H;  5JVH J;  1BRW A;  3C2F A;  2DSJ A;  5HUP A;  1FMA E;  1K8A J;  2B7P A;  5HUL A;  1M1K J;  1S72 H;  2I1O A;  2OTL H;  2PA2 A;  3ETR C;  2ZJR J;  1ZXI B;  5AN9 F;  1VQ8 H;  1QPQ A;  1Q86 J;  5GAE N;  3NRZ C;  4GA4 A;  1VQK H;  3G4S H;  1JRO B;  4YYY A;  3AMZ A;  4C80 A;  1WYG A;  1VQM H;  1Q81 J;  3RPF A;  4USA A;  1UOU A;  3CC2 H;  4IOA J;  5HL7 J;  2E3T A;  1Q82 J;  2WK6 A;  2J0F A;  3WO1 A;  3OW2 H;  1VQ5 H;  3J7Z M;  1K9M J;  1JRP B;  3L4P A;  5HUO A;  1N8R J;  5H1S O;  4WFA J;  3CC4 H;  5EP8 A;  3NVW C;  1N5X A;  2QIE A;  2WK5 A;  1YJ9 H;  3CMA H;  4U67 J;  3CCM H;  3H5Q A;  3CF5 J;  5DM6 J;  5AYY A;  5AYZ A;  3WNZ A;  4C7Y A;  4WFB J;  2OTJ H;  3NS1 C;  4ZOH A;  1X1O A;  1VQ7 H;  2W3S B;  2W55 B;  3B9J C;  1V97 A;  4WCE J;  3L0G A;  3CXC H;  1QVF H;  3AN1 A;  1YTK A;  3GNN A;  4EAD A;  2WP4 A;  5AYX A;  1VQ6 H;  1N63 B;  3CC7 H;  1NJI J;  3CME H;  3G6E H;  1SB3 A;  3CCU H;  3DLL J;  3C2O A;  1O4U A;  2B7N A;  2I14 A;  3C2V A;  3CCQ H;  3I55 H;  3PAJ A;  1QPO A;  3NVZ C;  4EAF A;  1KD1 J;  1YJN H;  2W54 B;  1KC8 J;  2W3R B;  5GAH N;  3CCS H;  1YIT H;  3FC4 A;  4XR5 A;  1Q7Y J;  1N5W B;  1YIJ H;  1K73 J;  4I9A A;  1QPN A;  1VQL H;  3TQV A;  3PIO J;  1VQ9 H;  2B7Q A;  1N60 B;  2JBM A;  3CD6 H;  1DGJ A;  2QA4 H;  1YHQ H;  3CCJ H;  2ZJQ J;  4IO9 J;  3C2E A;  3CCE H;  1VQ4 H;  2ZJP J;  3FAH A;  1N61 B;  1VQO H;  1FIQ C;  4AP8 A;  1Y69 K;  3WO0 A; 
#chains in the Genus database with same CATH homology
 5JVG J;  1WKI A;  1JJ2 H;  3PIP J;  5DM7 J;  2QEX H;  3I56 H;  1VQN H;  5MLC O;  1QVG H;  3CCV H;  3G71 H;  1W2B H;  3CPW H;  1VQP H;  4IOC J;  4UY8 M;  4WF9 J;  4WFN J;  3CCL H;  5GAG N;  1KQS H;  1M90 J;  5GAD N;  1YI2 H;  1YJW H;  3CCR H;  5JVH J;  1K8A J;  1M1K J;  1S72 H;  2OTL H;  2PA2 A;  2ZJR J;  5AN9 F;  1VQ8 H;  1Q86 J;  5GAE N;  1VQK H;  3G4S H;  1VQM H;  1Q81 J;  3CC2 H;  4IOA J;  5HL7 J;  1Q82 J;  3OW2 H;  1VQ5 H;  3J7Z M;  1K9M J;  1N8R J;  5H1S O;  4WFA J;  3CC4 H;  1YJ9 H;  3CMA H;  4U67 J;  3CCM H;  3CF5 J;  5DM6 J;  4WFB J;  2OTJ H;  1VQ7 H;  4WCE J;  3CXC H;  1QVF H;  1VQ6 H;  3CC7 H;  1NJI J;  3CME H;  3G6E H;  3CCU H;  3DLL J;  3CCQ H;  3I55 H;  1KD1 J;  1YJN H;  1KC8 J;  5GAH N;  3CCS H;  1YIT H;  1Q7Y J;  1YIJ H;  1K73 J;  1VQL H;  3PIO J;  1VQ9 H;  3CD6 H;  2QA4 H;  1YHQ H;  3CCJ H;  2ZJQ J;  4IO9 J;  3CCE H;  1VQ4 H;  2ZJP J;  1VQO H;  1Y69 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...