1Q81J

Crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
167
structure length
156
Chain Sequence
KPGAMYRNSSKPAYTRREYISGIPGKKIAQFDMGNNGAGPTYPAQVELVVEKPVQIRHNALEAARVAANRYVQNSGAAANYKFRIRKFPFHVIRENKDGMRAPFGKPVGTAARVHGANHIFIAWVNPDPNVEEAWRRAKMKVTPTINIDSSPAGNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into Peptide Bond Formation
pubmed doi rcsb
molecule keywords 23S ribosomal rna
molecule tags Ribosome
total genus 27
structure length 156
sequence length 167
ec nomenclature
pdb deposition date 2003-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 1q81J00
5JVGJ 1QVGH 1NJIJ 1M1KJ 1S72H 5DM7J 3PIPJ 4WCEJ 1VQMH 1VQKH 1VQ4H 3CCRH 3G71H 3G4SH 4WF9J 1JJ2H 1VQOH 3CPWH 1YJNH 2OTLH 1YITH 3CCEH 3I56H 1Y69K 1K73J 2QA4H 4UY8M 1QVFH 1Q82J 3OW2H 2ZJPJ 3DLLJ 2ZJRJ 1KD1J 1N8RJ 4WFAJ 3CCMH 4IOCJ 1VQ5H 3CCLH 1Q7YJ 3CCSH 3CCUH 3PIOJ 1VQ6H 1Q81J 5GAEN 3CC7H 5DM6J 5H1SO 1K8AJ 3CD6H 1Q86J 3CMEH 3CXCH 1VQ7H 3J7ZM 1VQNH 1YIJH 2OTJH 1W2BH 4WFBJ 1VQLH 3CCQH 4U67J 3CF5J 1YJ9H 3G6EH 1YJWH 3I55H 1M90J 4WFNJ 3CC4H 5GADN 5HL7J 4IOAJ 1VQPH 1YI2H 5MLCO 3CMAH 2ZJQJ 3CCVH 5GAGN 1K9MJ 1VQ9H 1WKIA 4IO9J 2PA2A 5JVHJ 3CCJH 1YHQH 1VQ8H 2QEXH 3CC2H 5AN9F 1KQSH 1KC8J 5GAHN
chains in the Genus database with same CATH superfamily
5JVGJ 3FC4A 4USAA 1QVGH 1YTKA 4XR5A 2J0FA 1X1OA 3WNZA 5MPOC 1V97A 2TPTA 1AZYA 1NJIJ 2B7PA 1M1KJ 3NS1C 3GNNA 1S72H 2WP4A 5DM7J 3AM9A 4YEKA 3NRZC 3PIPJ 4WCEJ 2QIEA 3L4PA 4AP8A 2W55B 3FAHA 4C7ZA 5AYZA 2WK5A 1N61B 1VQMH 4EADA 1YTDA 1QPQA 1VQKH 1SIJA 1VQ4H 3CCRH 4GA6A 3G71H 1QAPA 3H5QA 3G4SH 4WF9J 3C2FA 3C2EA 3NVVC 1JJ2H 2W54B 1VQOH 2E3TA 3CPWH 4KWVA 1UOUA 1SB3A 1YJNH 4US8A 2I1OA 3NVZC 2OTLH 1YITH 3CCEH 3I56H 1JROB 4ZOHA 1NVJA 2DSJA 2QA4H 1Y69K 1K73J 2OMDA 4UY8M 1FMAE 1QVFH 3WO1A 3WO0A 2B7QA 1Q82J 2Q5WE 3OW2H 2ZJPJ 3DLLJ 2ZJRJ 3PAJA 1KD1J 1N8RJ 1JRPB 1RM6A 3C2RA 4WFAJ 3CCMH 5HUOA 4IOCJ 3NVYC 1BRWA 4KWWA 3VMMA 3CCLH 1VQ5H 3BIIE 1Q7YJ 3CCSH 3CCUH 3PIOJ 1VQ6H 1QPNA 1Q81J 5GAEN 3CC7H 3C2VA 5H1SO 5DM6J 1K8AJ 1O4UA 1WYGA 1Q86J 3CD6H 1N60B 1QPOA 4US9A 3CMEH 2I14A 3CXCH 1VQ7H 1VLBA 3EUB4 3J7ZM 1VQNH 1YIJH 1FFUB 2OTJH 1W2BH 2WK6A 4WFBJ 1VQLH 1QPRA 3CCQH 3SR6C 4U67J 2JBMA 1FIQC 5AYYA 3TQVA 1FFVB 3CF5J 5EP8A 3G6EH 1YJ9H 1YJWH 1N5XA 3AMZA 3I55H 3B9JC 1OTPA 1M90J 4WFNJ 3CC4H 2B7NA 5GADN 5HL7J 1YTEA 2W3SB 4EAFA 4IOAJ 1FM0E 3ETRC 1VQPH 1YI2H 5MLCO 3CMAH 3L0GA 2ZJQJ 4C80A 3CCVH 5GAGN 4GA5A 1N63B 1K9MJ 1VQ9H 1WKIA 4LHMA 5HUPA 4IO9J 2PA2A 5JVHJ 1FO4A 4GA4A 5HULA 1N62B 2W3RB 3NVWC 4C7YA 3CCJH 3AN1A 1N5WB 1YHQH 1VQ8H 2QEXH 1ZXIB 4I9AA 4X46A 3RPFA 4YYYA 5EY3A 3CC2H 1NVIE 5AN9F 5AYXA 1KQSH 1DGJA 1VDVA 5GAHN 3C2OA 1KC8J
chains in the Genus database with same CATH topology
5JVGJ 1QVGH 1NJIJ 1M1KJ 1S72H 5DM7J 3PIPJ 4WCEJ 1VQMH 1VQKH 1VQ4H 3CCRH 3G71H 3G4SH 4WF9J 1JJ2H 1VQOH 3CPWH 1YJNH 2OTLH 1YITH 3CCEH 3I56H 1Y69K 1K73J 2QA4H 4UY8M 1QVFH 1Q82J 3OW2H 2ZJPJ 3DLLJ 2ZJRJ 1KD1J 1N8RJ 4WFAJ 3CCMH 4IOCJ 1VQ5H 3CCLH 1Q7YJ 3CCSH 3CCUH 3PIOJ 1VQ6H 1Q81J 5GAEN 3CC7H 5DM6J 5H1SO 1K8AJ 3CD6H 1Q86J 3CMEH 3CXCH 1VQ7H 3J7ZM 1VQNH 1YIJH 2OTJH 1W2BH 4WFBJ 1VQLH 3CCQH 4U67J 3CF5J 1YJ9H 3G6EH 1YJWH 3I55H 1M90J 4WFNJ 3CC4H 5GADN 5HL7J 4IOAJ 1VQPH 1YI2H 5MLCO 3CMAH 2ZJQJ 3CCVH 5GAGN 1K9MJ 1VQ9H 1WKIA 4IO9J 2PA2A 5JVHJ 3CCJH 1YHQH 1VQ8H 2QEXH 3CC2H 5AN9F 1KQSH 1KC8J 5GAHN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JVG J;  1QVG H;  1NJI J;  1M1K J;  1S72 H;  5DM7 J;  3PIP J;  4WCE J;  1VQM H;  1VQK H;  1VQ4 H;  3CCR H;  3G71 H;  3G4S H;  4WF9 J;  1JJ2 H;  1VQO H;  3CPW H;  1YJN H;  2OTL H;  1YIT H;  3CCE H;  3I56 H;  1Y69 K;  1K73 J;  2QA4 H;  4UY8 M;  1QVF H;  1Q82 J;  3OW2 H;  2ZJP J;  3DLL J;  2ZJR J;  1KD1 J;  1N8R J;  4WFA J;  3CCM H;  4IOC J;  1VQ5 H;  3CCL H;  1Q7Y J;  3CCS H;  3CCU H;  3PIO J;  1VQ6 H;  1Q81 J;  5GAE N;  3CC7 H;  5DM6 J;  5H1S O;  1K8A J;  3CD6 H;  1Q86 J;  3CME H;  3CXC H;  1VQ7 H;  3J7Z M;  1VQN H;  1YIJ H;  2OTJ H;  1W2B H;  4WFB J;  1VQL H;  3CCQ H;  4U67 J;  3CF5 J;  1YJ9 H;  3G6E H;  1YJW H;  3I55 H;  1M90 J;  4WFN J;  3CC4 H;  5GAD N;  5HL7 J;  4IOA J;  1VQP H;  1YI2 H;  5MLC O;  3CMA H;  2ZJQ J;  3CCV H;  5GAG N;  1K9M J;  1VQ9 H;  1WKI A;  4IO9 J;  2PA2 A;  5JVH J;  3CCJ H;  1YHQ H;  1VQ8 H;  2QEX H;  3CC2 H;  5AN9 F;  1KQS H;  1KC8 J;  5GAH N; 
#chains in the Genus database with same CATH topology
 5JVG J;  3FC4 A;  4USA A;  1QVG H;  1YTK A;  4XR5 A;  2J0F A;  1X1O A;  3WNZ A;  5MPO C;  1V97 A;  2TPT A;  1AZY A;  1NJI J;  2B7P A;  1M1K J;  3NS1 C;  3GNN A;  1S72 H;  2WP4 A;  5DM7 J;  3AM9 A;  4YEK A;  3NRZ C;  3PIP J;  4WCE J;  2QIE A;  3L4P A;  4AP8 A;  2W55 B;  3FAH A;  4C7Z A;  5AYZ A;  2WK5 A;  1N61 B;  1VQM H;  4EAD A;  1YTD A;  1QPQ A;  1VQK H;  1SIJ A;  1VQ4 H;  3CCR H;  4GA6 A;  3G71 H;  1QAP A;  3H5Q A;  3G4S H;  4WF9 J;  3C2F A;  3C2E A;  3NVV C;  1JJ2 H;  2W54 B;  1VQO H;  2E3T A;  3CPW H;  4KWV A;  1UOU A;  1SB3 A;  1YJN H;  4US8 A;  2I1O A;  3NVZ C;  2OTL H;  1YIT H;  3CCE H;  3I56 H;  1JRO B;  4ZOH A;  1NVJ A;  2DSJ A;  2QA4 H;  1Y69 K;  1K73 J;  2OMD A;  4UY8 M;  1FMA E;  1QVF H;  3WO1 A;  3WO0 A;  2B7Q A;  1Q82 J;  2Q5W E;  3OW2 H;  2ZJP J;  3DLL J;  2ZJR J;  3PAJ A;  1KD1 J;  1N8R J;  1JRP B;  1RM6 A;  3C2R A;  4WFA J;  3CCM H;  5HUO A;  4IOC J;  3NVY C;  1BRW A;  4KWW A;  3VMM A;  3CCL H;  1VQ5 H;  3BII E;  1Q7Y J;  3CCS H;  3CCU H;  3PIO J;  1VQ6 H;  1QPN A;  1Q81 J;  5GAE N;  3CC7 H;  3C2V A;  5H1S O;  5DM6 J;  1K8A J;  1O4U A;  1WYG A;  1Q86 J;  3CD6 H;  1N60 B;  1QPO A;  4US9 A;  3CME H;  2I14 A;  3CXC H;  1VQ7 H;  1VLB A;  3EUB 4;  3J7Z M;  1VQN H;  1YIJ H;  1FFU B;  2OTJ H;  1W2B H;  2WK6 A;  4WFB J;  1VQL H;  1QPR A;  3CCQ H;  3SR6 C;  4U67 J;  2JBM A;  1FIQ C;  5AYY A;  3TQV A;  1FFV B;  3CF5 J;  5EP8 A;  3G6E H;  1YJ9 H;  1YJW H;  1N5X A;  3AMZ A;  3I55 H;  3B9J C;  1OTP A;  1M90 J;  4WFN J;  3CC4 H;  2B7N A;  5GAD N;  5HL7 J;  1YTE A;  2W3S B;  4EAF A;  4IOA J;  1FM0 E;  3ETR C;  1VQP H;  1YI2 H;  5MLC O;  3CMA H;  3L0G A;  2ZJQ J;  4C80 A;  3CCV H;  5GAG N;  4GA5 A;  1N63 B;  1K9M J;  1VQ9 H;  1WKI A;  4LHM A;  5HUP A;  4IO9 J;  2PA2 A;  5JVH J;  1FO4 A;  4GA4 A;  5HUL A;  1N62 B;  2W3R B;  3NVW C;  4C7Y A;  3CCJ H;  3AN1 A;  1N5W B;  1YHQ H;  1VQ8 H;  2QEX H;  1ZXI B;  4I9A A;  4X46 A;  3RPF A;  4YYY A;  5EY3 A;  3CC2 H;  1NVI E;  5AN9 F;  5AYX A;  1KQS H;  1DGJ A;  1VDV A;  5GAH N;  3C2O A;  1KC8 J; 
#chains in the Genus database with same CATH homology
 5JVG J;  1QVG H;  1NJI J;  1M1K J;  1S72 H;  5DM7 J;  3PIP J;  4WCE J;  1VQM H;  1VQK H;  1VQ4 H;  3CCR H;  3G71 H;  3G4S H;  4WF9 J;  1JJ2 H;  1VQO H;  3CPW H;  1YJN H;  2OTL H;  1YIT H;  3CCE H;  3I56 H;  1Y69 K;  1K73 J;  2QA4 H;  4UY8 M;  1QVF H;  1Q82 J;  3OW2 H;  2ZJP J;  3DLL J;  2ZJR J;  1KD1 J;  1N8R J;  4WFA J;  3CCM H;  4IOC J;  1VQ5 H;  3CCL H;  1Q7Y J;  3CCS H;  3CCU H;  3PIO J;  1VQ6 H;  1Q81 J;  5GAE N;  3CC7 H;  5DM6 J;  5H1S O;  1K8A J;  3CD6 H;  1Q86 J;  3CME H;  3CXC H;  1VQ7 H;  3J7Z M;  1VQN H;  1YIJ H;  2OTJ H;  1W2B H;  4WFB J;  1VQL H;  3CCQ H;  4U67 J;  3CF5 J;  1YJ9 H;  3G6E H;  1YJW H;  3I55 H;  1M90 J;  4WFN J;  3CC4 H;  5GAD N;  5HL7 J;  4IOA J;  1VQP H;  1YI2 H;  5MLC O;  3CMA H;  2ZJQ J;  3CCV H;  5GAG N;  1K9M J;  1VQ9 H;  1WKI A;  4IO9 J;  2PA2 A;  5JVH J;  3CCJ H;  1YHQ H;  1VQ8 H;  2QEX H;  3CC2 H;  5AN9 F;  1KQS H;  1KC8 J;  5GAH N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...