1VQ6H

The structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
171
structure length
160
Chain Sequence
KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIDSSPAGNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule keywords 23S ribosomal rna
molecule tags Ribosome
total genus 37
structure length 160
sequence length 171
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 1vq6H00
1YJNH 3CC7H 3CCJH 3CCMH 1KC8J 1NJIJ 1KD1J 3OW2H 1N8RJ 1YITH 1VQKH 1Y69K 4IOAJ 3CMAH 1JJ2H 1WKIA 4WF9J 3G71H 1QVGH 1K9MJ 3PIPJ 3PIOJ 1VQLH 3CCVH 1VQNH 1VQ9H 2QEXH 3J7ZM 1VQ7H 2PA2A 4WFAJ 4U67J 1VQ4H 3CF5J 1VQ8H 1Q86J 3CXCH 3G6EH 5MLCO 1M1KJ 3CC2H 5DM7J 3G4SH 3CC4H 1KQSH 2OTJH 5AN9F 4UY8M 1YJWH 5GADN 2QA4H 3CCLH 1QVFH 4WFBJ 3I55H 1VQPH 1W2BH 3CCRH 1YI2H 1YJ9H 3CMEH 3CPWH 3CD6H 1Q81J 1VQOH 5GAHN 2ZJPJ 5JVGJ 4WFNJ 1VQ6H 1Q7YJ 5HL7J 5JVHJ 1VQMH 3CCSH 3DLLJ 1K73J 2ZJQJ 1M90J 1YHQH 5DM6J 2OTLH 2ZJRJ 1S72H 1YIJH 5H1SO 4IOCJ 3CCQH 5GAGN 4IO9J 1VQ5H 3CCUH 5GAEN 3I56H 4WCEJ 1Q82J 1K8AJ 3CCEH
chains in the Genus database with same CATH superfamily
1FMAE 2OMDA 1YJNH 3CC7H 3CCJH 4EAFA 1QPQA 4US8A 3SR6C 3CCMH 1KC8J 5AYZA 1NJIJ 1KD1J 3OW2H 3FC4A 2E3TA 3NVYC 4GA4A 1N63B 3WO1A 1N8RJ 1JRPB 2JBMA 1YITH 1VQKH 1Y69K 1FFVB 4IOAJ 3CMAH 2Q5WE 4I9AA 1JJ2H 4KWWA 3TQVA 1WKIA 4WF9J 4GA5A 1YTDA 3G71H 1N61B 1QVGH 3AMZA 1K9MJ 3PIPJ 1QPNA 2QIEA 3PIOJ 1VQLH 3NVZC 1FO4A 3CCVH 1NVJA 1FIQC 1N60B 5HUOA 1YTEA 1VQNH 4YYYA 1VQ9H 2QEXH 2DSJA 3FAHA 2I14A 3J7ZM 1VLBA 2B7QA 1WYGA 3NVWC 1VQ7H 2PA2A 2W54B 2WK5A 1ZXIB 1VDVA 4WFAJ 4U67J 5HUPA 1VQ4H 3CF5J 1N62B 3C2VA 1VQ8H 3WO0A 3CXCH 3L0GA 3G6EH 1Q86J 3C2RA 4GA6A 3PAJA 1FFUB 4C80A 4USAA 3C2FA 1O4UA 1YTKA 5MLCO 1M1KJ 2W3RB 3CC2H 5DM7J 1FM0E 3G4SH 1JROB 3CC4H 3AN1A 1KQSH 3NVVC 5AN9F 2OTJH 4UY8M 1YJWH 5GADN 4US9A 2QA4H 3CCLH 2B7PA 4C7YA 1QVFH 4WFBJ 3EUB4 2J0FA 1V97A 3VMMA 4C7ZA 3I55H 4KWVA 1VQPH 1W2BH 3ETRC 3CCRH 5AYXA 1YI2H 1YJ9H 3CMEH 4EADA 1SIJA 3WNZA 2B7NA 3CPWH 3NRZC 2WK6A 5AYYA 4AP8A 1DGJA 3CD6H 5EY3A 3C2OA 1Q81J 3RPFA 1VQOH 5HULA 3H5QA 5GAHN 1AZYA 1X1OA 2ZJPJ 4WFNJ 5JVGJ 1N5XA 3BIIE 1VQ6H 4YEKA 2WP4A 5HL7J 5JVHJ 3GNNA 1Q7YJ 1VQMH 3CCSH 1N5WB 3DLLJ 3L4PA 1K73J 1QPOA 3B9JC 2ZJQJ 1M90J 4ZOHA 1YHQH 5DM6J 1SB3A 5EP8A 2OTLH 4XR5A 2TPTA 2I1OA 2ZJRJ 4LHMA 3C2EA 1S72H 1YIJH 5H1SO 1BRWA 1QPRA 1RM6A 1UOUA 3CCQH 4IOCJ 5GAGN 4IO9J 1VQ5H 2W55B 3CCUH 4X46A 5GAEN 5MPOC 3I56H 3NS1C 3AM9A 1OTPA 4WCEJ 1Q82J 1K8AJ 1QAPA 2W3SB 3CCEH 1NVIE
chains in the Genus database with same CATH topology
1YJNH 3CC7H 3CCJH 3CCMH 1KC8J 1NJIJ 1KD1J 3OW2H 1N8RJ 1YITH 1VQKH 1Y69K 4IOAJ 3CMAH 1JJ2H 1WKIA 4WF9J 3G71H 1QVGH 1K9MJ 3PIPJ 3PIOJ 1VQLH 3CCVH 1VQNH 1VQ9H 2QEXH 3J7ZM 1VQ7H 2PA2A 4WFAJ 4U67J 1VQ4H 3CF5J 1VQ8H 1Q86J 3CXCH 3G6EH 5MLCO 1M1KJ 3CC2H 5DM7J 3G4SH 3CC4H 1KQSH 2OTJH 5AN9F 4UY8M 1YJWH 5GADN 2QA4H 3CCLH 1QVFH 4WFBJ 3I55H 1VQPH 1W2BH 3CCRH 1YI2H 1YJ9H 3CMEH 3CPWH 3CD6H 1Q81J 1VQOH 5GAHN 2ZJPJ 5JVGJ 4WFNJ 1VQ6H 1Q7YJ 5HL7J 5JVHJ 1VQMH 3CCSH 3DLLJ 1K73J 2ZJQJ 1M90J 1YHQH 5DM6J 2OTLH 2ZJRJ 1S72H 1YIJH 5H1SO 4IOCJ 3CCQH 5GAGN 4IO9J 1VQ5H 3CCUH 5GAEN 3I56H 4WCEJ 1Q82J 1K8AJ 3CCEH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJN H;  3CC7 H;  3CCJ H;  3CCM H;  1KC8 J;  1NJI J;  1KD1 J;  3OW2 H;  1N8R J;  1YIT H;  1VQK H;  1Y69 K;  4IOA J;  3CMA H;  1JJ2 H;  1WKI A;  4WF9 J;  3G71 H;  1QVG H;  1K9M J;  3PIP J;  3PIO J;  1VQL H;  3CCV H;  1VQN H;  1VQ9 H;  2QEX H;  3J7Z M;  1VQ7 H;  2PA2 A;  4WFA J;  4U67 J;  1VQ4 H;  3CF5 J;  1VQ8 H;  1Q86 J;  3CXC H;  3G6E H;  5MLC O;  1M1K J;  3CC2 H;  5DM7 J;  3G4S H;  3CC4 H;  1KQS H;  2OTJ H;  5AN9 F;  4UY8 M;  1YJW H;  5GAD N;  2QA4 H;  3CCL H;  1QVF H;  4WFB J;  3I55 H;  1VQP H;  1W2B H;  3CCR H;  1YI2 H;  1YJ9 H;  3CME H;  3CPW H;  3CD6 H;  1Q81 J;  1VQO H;  5GAH N;  2ZJP J;  5JVG J;  4WFN J;  1VQ6 H;  1Q7Y J;  5HL7 J;  5JVH J;  1VQM H;  3CCS H;  3DLL J;  1K73 J;  2ZJQ J;  1M90 J;  1YHQ H;  5DM6 J;  2OTL H;  2ZJR J;  1S72 H;  1YIJ H;  5H1S O;  4IOC J;  3CCQ H;  5GAG N;  4IO9 J;  1VQ5 H;  3CCU H;  5GAE N;  3I56 H;  4WCE J;  1Q82 J;  1K8A J;  3CCE H; 
#chains in the Genus database with same CATH topology
 1FMA E;  2OMD A;  1YJN H;  3CC7 H;  3CCJ H;  4EAF A;  1QPQ A;  4US8 A;  3SR6 C;  3CCM H;  1KC8 J;  5AYZ A;  1NJI J;  1KD1 J;  3OW2 H;  3FC4 A;  2E3T A;  3NVY C;  4GA4 A;  1N63 B;  3WO1 A;  1N8R J;  1JRP B;  2JBM A;  1YIT H;  1VQK H;  1Y69 K;  1FFV B;  4IOA J;  3CMA H;  2Q5W E;  4I9A A;  1JJ2 H;  4KWW A;  3TQV A;  1WKI A;  4WF9 J;  4GA5 A;  1YTD A;  3G71 H;  1N61 B;  1QVG H;  3AMZ A;  1K9M J;  3PIP J;  1QPN A;  2QIE A;  3PIO J;  1VQL H;  3NVZ C;  1FO4 A;  3CCV H;  1NVJ A;  1FIQ C;  1N60 B;  5HUO A;  1YTE A;  1VQN H;  4YYY A;  1VQ9 H;  2QEX H;  2DSJ A;  3FAH A;  2I14 A;  3J7Z M;  1VLB A;  2B7Q A;  1WYG A;  3NVW C;  1VQ7 H;  2PA2 A;  2W54 B;  2WK5 A;  1ZXI B;  1VDV A;  4WFA J;  4U67 J;  5HUP A;  1VQ4 H;  3CF5 J;  1N62 B;  3C2V A;  1VQ8 H;  3WO0 A;  3CXC H;  3L0G A;  3G6E H;  1Q86 J;  3C2R A;  4GA6 A;  3PAJ A;  1FFU B;  4C80 A;  4USA A;  3C2F A;  1O4U A;  1YTK A;  5MLC O;  1M1K J;  2W3R B;  3CC2 H;  5DM7 J;  1FM0 E;  3G4S H;  1JRO B;  3CC4 H;  3AN1 A;  1KQS H;  3NVV C;  5AN9 F;  2OTJ H;  4UY8 M;  1YJW H;  5GAD N;  4US9 A;  2QA4 H;  3CCL H;  2B7P A;  4C7Y A;  1QVF H;  4WFB J;  3EUB 4;  2J0F A;  1V97 A;  3VMM A;  4C7Z A;  3I55 H;  4KWV A;  1VQP H;  1W2B H;  3ETR C;  3CCR H;  5AYX A;  1YI2 H;  1YJ9 H;  3CME H;  4EAD A;  1SIJ A;  3WNZ A;  2B7N A;  3CPW H;  3NRZ C;  2WK6 A;  5AYY A;  4AP8 A;  1DGJ A;  3CD6 H;  5EY3 A;  3C2O A;  1Q81 J;  3RPF A;  1VQO H;  5HUL A;  3H5Q A;  5GAH N;  1AZY A;  1X1O A;  2ZJP J;  4WFN J;  5JVG J;  1N5X A;  3BII E;  1VQ6 H;  4YEK A;  2WP4 A;  5HL7 J;  5JVH J;  3GNN A;  1Q7Y J;  1VQM H;  3CCS H;  1N5W B;  3DLL J;  3L4P A;  1K73 J;  1QPO A;  3B9J C;  2ZJQ J;  1M90 J;  4ZOH A;  1YHQ H;  5DM6 J;  1SB3 A;  5EP8 A;  2OTL H;  4XR5 A;  2TPT A;  2I1O A;  2ZJR J;  4LHM A;  3C2E A;  1S72 H;  1YIJ H;  5H1S O;  1BRW A;  1QPR A;  1RM6 A;  1UOU A;  3CCQ H;  4IOC J;  5GAG N;  4IO9 J;  1VQ5 H;  2W55 B;  3CCU H;  4X46 A;  5GAE N;  5MPO C;  3I56 H;  3NS1 C;  3AM9 A;  1OTP A;  4WCE J;  1Q82 J;  1K8A J;  1QAP A;  2W3S B;  3CCE H;  1NVI E; 
#chains in the Genus database with same CATH homology
 1YJN H;  3CC7 H;  3CCJ H;  3CCM H;  1KC8 J;  1NJI J;  1KD1 J;  3OW2 H;  1N8R J;  1YIT H;  1VQK H;  1Y69 K;  4IOA J;  3CMA H;  1JJ2 H;  1WKI A;  4WF9 J;  3G71 H;  1QVG H;  1K9M J;  3PIP J;  3PIO J;  1VQL H;  3CCV H;  1VQN H;  1VQ9 H;  2QEX H;  3J7Z M;  1VQ7 H;  2PA2 A;  4WFA J;  4U67 J;  1VQ4 H;  3CF5 J;  1VQ8 H;  1Q86 J;  3CXC H;  3G6E H;  5MLC O;  1M1K J;  3CC2 H;  5DM7 J;  3G4S H;  3CC4 H;  1KQS H;  2OTJ H;  5AN9 F;  4UY8 M;  1YJW H;  5GAD N;  2QA4 H;  3CCL H;  1QVF H;  4WFB J;  3I55 H;  1VQP H;  1W2B H;  3CCR H;  1YI2 H;  1YJ9 H;  3CME H;  3CPW H;  3CD6 H;  1Q81 J;  1VQO H;  5GAH N;  2ZJP J;  5JVG J;  4WFN J;  1VQ6 H;  1Q7Y J;  5HL7 J;  5JVH J;  1VQM H;  3CCS H;  3DLL J;  1K73 J;  2ZJQ J;  1M90 J;  1YHQ H;  5DM6 J;  2OTL H;  2ZJR J;  1S72 H;  1YIJ H;  5H1S O;  4IOC J;  3CCQ H;  5GAG N;  4IO9 J;  1VQ5 H;  3CCU H;  5GAE N;  3I56 H;  4WCE J;  1Q82 J;  1K8A J;  3CCE H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...