The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
40
|
sequence length |
136
|
structure length |
136
|
Chain Sequence |
MKQFEIVIEPIQTEQYREFTINEYQGAVVVFTGHVREWTKGVKTEYLEYEAYIPMAEKKLAQIGDEINEKWPGTITSIVHRIGPLQISDIAVLIAVSSPHRKDAYRANEYAIERIKEIVPIWKKEIWEDGSKWQGH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure of a molybdopterin synthase-precursor Z complex: insight into its sulfur transfer mechanism and its role in molybdenum cofactor deficiency.
pubmed doi rcsb |
| molecule keywords |
Molybdopterin-converting factor subunit 2
|
| molecule tags |
Transferase
|
| source organism |
Staphylococcus aureus
|
| total genus |
40
|
| structure length |
136
|
| sequence length |
136
|
| chains with identical sequence |
E, H, K
|
| ec nomenclature |
ec
2.8.1.12: Molybdopterin synthase. |
| pdb deposition date | 2007-07-04 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02391 | MoaE | MoaE protein |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Complex | Aldehyde Oxidoreductase; domain 3 | Molybdopterin biosynthesis MoaE subunit |
#chains in the Genus database with same CATH superfamily 1NVJ A; 2OMD A; 4AP8 A; 2Q5W E; 2WP4 A; 1NVI E; 3BII E; 3RPF A; 1FM0 E; 5MPO C; 1FMA E; 2QIE A; #chains in the Genus database with same CATH topology 5JVH J; 4XR5 A; 3J7Z M; 3CCM H; 3PIP J; 3WO1 A; 1QPN A; 5GAD N; 4C80 A; 1WKI A; 5HUL A; 1FFV B; 5HUO A; 1YJN H; 2W3S B; 4GA4 A; 4IO9 J; 1FIQ C; 3NVY C; 1YJ9 H; 1KD1 J; 2B7Q A; 2OMD A; 1QPO A; 2Q5W E; 2E3T A; 4WFB J; 3DLL J; 3B9J C; 1VQO H; 1VQ7 H; 1SB3 A; 1WYG A; 2QEX H; 2ZJQ J; 3BII E; 2ZJP J; 1S72 H; 3CC7 H; 4LHM A; 2DSJ A; 3AN1 A; 1SIJ A; 4ZOH A; 1QVF H; 2JBM A; 3NVV C; 1N5W B; 3CMA H; 1VQ5 H; 1VQ4 H; 2W55 B; 1K9M J; 3PIO J; 1QAP A; 3C2E A; 3SR6 C; 4AP8 A; 4C7Y A; 1VQ9 H; 3OW2 H; 1N63 B; 4WFN J; 3FAH A; 1OTP A; 1AZY A; 1M90 J; 4IOA J; 3NVW C; 2I1O A; 3TQV A; 1YIT H; 5H1S O; 2OTJ H; 2TPT A; 3PAJ A; 3CCL H; 1VQN H; 1M1K J; 1YTE A; 4USA A; 4X46 A; 2J0F A; 4U67 J; 3CCE H; 3NRZ C; 1FO4 A; 1BRW A; 4EAF A; 1VQ8 H; 3G6E H; 1KQS H; 3CPW H; 4WF9 J; 3CCR H; 3CCJ H; 2WK5 A; 5MPO C; 5HL7 J; 1QPQ A; 3CXC H; 1NJI J; 1N5X A; 1VQM H; 1VDV A; 1RM6 A; 5AYY A; 1W2B H; 1YHQ H; 4GA6 A; 1Q86 J; 5JVG J; 5DM6 J; 2OTL H; 3EUB 4; 5MLC O; 1O4U A; 1JRO B; 1VQK H; 4KWV A; 3NVZ C; 4WCE J; 1V97 A; 1Q81 J; 1YI2 H; 5AN9 F; 4YEK A; 3L0G A; 3I56 H; 5EY3 A; 2QIE A; 3CC4 H; 1QPR A; 1ZXI B; 1NVJ A; 4C7Z A; 2QA4 H; 2WP4 A; 1YJW H; 1NVI E; 3G4S H; 1VQL H; 3RPF A; 1VLB A; 4WFA J; 1FMA E; 1K73 J; 1YTD A; 5EP8 A; 4US9 A; 4US8 A; 1JJ2 H; 1JRP B; 2WK6 A; 3L4P A; 4GA5 A; 1DGJ A; 2W54 B; 1QVG H; 4UY8 M; 3AM9 A; 3CF5 J; 4I9A A; 5AYX A; 1FFU B; 4KWW A; 1N61 B; 1N60 B; 1YIJ H; 2W3R B; 1VQP H; 3H5Q A; 3I55 H; 1Y69 K; 2B7P A; 3CCQ H; 3CD6 H; 5DM7 J; 1Q7Y J; 5GAE N; 4YYY A; 1X1O A; 1N62 B; 3VMM A; 2I14 A; 3AMZ A; 3C2F A; 3WO0 A; 4EAD A; 3ETR C; 3NS1 C; 1N8R J; 3C2V A; 5HUP A; 1UOU A; 3FC4 A; 3WNZ A; 1K8A J; 3GNN A; 3G71 H; 1YTK A; 1Q82 J; 3C2R A; 2ZJR J; 3CCU H; 5GAG N; 1VQ6 H; 2B7N A; 3CCS H; 4IOC J; 2PA2 A; 3CC2 H; 1KC8 J; 3CME H; 1FM0 E; 5GAH N; 5AYZ A; 3C2O A; 3CCV H; #chains in the Genus database with same CATH homology 1NVJ A; 2OMD A; 4AP8 A; 2Q5W E; 2WP4 A; 1NVI E; 3BII E; 3RPF A; 1FM0 E; 5MPO C; 1FMA E; 2QIE A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...