2OTJH

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
171
structure length
160
Chain Sequence
KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIDSSPAGNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule keywords 23S ribosomal RNA
molecule tags Ribosome
total genus 40
structure length 160
sequence length 171
ec nomenclature
pdb deposition date 2007-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 2otjH00
3CC2H 3CCMH 3G6EH 1VQPH 1VQOH 4WFAJ 4WFNJ 2PA2A 3G71H 4IO9J 1VQMH 5GAGN 5MLCO 3CCJH 5H1SO 1Q82J 1VQLH 3CMAH 1VQ8H 3CC7H 1VQNH 2QA4H 1YI2H 3I56H 1VQ7H 3G4SH 1KD1J 3CCSH 1VQ4H 4IOCJ 1YJ9H 5DM7J 2OTLH 5HL7J 1Q7YJ 3DLLJ 1Y69K 1YIJH 1YHQH 3CCRH 1VQKH 5DM6J 4WFBJ 1M1KJ 3CD6H 1NJIJ 3CCLH 1W2BH 1VQ5H 4IOAJ 3OW2H 5GAEN 2QEXH 1QVFH 1K8AJ 1K9MJ 4WF9J 5JVHJ 1JJ2H 1Q86J 1WKIA 3CCUH 2ZJRJ 1YJNH 1S72H 5GADN 4U67J 3PIOJ 3CCQH 1YJWH 3PIPJ 3I55H 3CC4H 1KQSH 2ZJQJ 4WCEJ 3CXCH 1YITH 1K73J 2OTJH 1KC8J 3CCEH 1VQ9H 3CPWH 5AN9F 2ZJPJ 5JVGJ 1VQ6H 1Q81J 1M90J 3J7ZM 3CCVH 1QVGH 5GAHN 1N8RJ 4UY8M 3CF5J 3CMEH
chains in the Genus database with same CATH superfamily
3CC2H 3CF5J 5MPOC 1N61B 3G6EH 3CCMH 1VQPH 4WFAJ 1VQOH 1WYGA 5AYYA 1BRWA 1N60B 2QIEA 2W3SB 4WFNJ 2PA2A 1QPQA 3G71H 3H5QA 4IO9J 5HUPA 1VQMH 5GAGN 1X1OA 5MLCO 3CCJH 5HUOA 1RM6A 5H1SO 1FMAE 3C2FA 1YTDA 3FAHA 3AM9A 1Q82J 1VQLH 3CMAH 1VQ8H 3CC7H 4GA4A 1VQNH 2QA4H 1JRPB 2OMDA 1DGJA 1FFVB 1NVJA 1YI2H 4I9AA 1ZXIB 3I56H 1VQ7H 3C2EA 4EADA 2WK6A 3G4SH 2W54B 1KD1J 3AN1A 4AP8A 2I1OA 3CCSH 3SR6C 1VQ4H 2W3RB 3WO1A 4IOCJ 4US9A 1YTEA 2B7PA 3ETRC 4EAFA 1JROB 1YJ9H 5DM7J 2OTLH 5HL7J 1Q7YJ 3DLLJ 1N63B 2TPTA 1Y69K 4X46A 1YIJH 1YHQH 2I14A 1YTKA 1FM0E 3CCRH 3GNNA 1VQKH 5DM6J 5EP8A 4C80A 3BIIE 4XR5A 3EUB4 4WFBJ 1M1KJ 3CD6H 4C7ZA 1NJIJ 3CCLH 1OTPA 1W2BH 1VQ5H 3NS1C 1SIJA 4IOAJ 2B7NA 1VLBA 1QPNA 4ZOHA 1NVIE 3OW2H 3NRZC 4GA6A 5GAEN 4LHMA 2E3TA 1FO4A 1VDVA 2QEXH 1QVFH 1K8AJ 1QAPA 1SB3A 4C7YA 1K9MJ 3NVYC 4WF9J 5JVHJ 2WK5A 4KWVA 1JJ2H 3FC4A 1WKIA 3CCUH 1Q86J 2ZJRJ 4KWWA 4YYYA 1YJNH 1S72H 5GADN 4YEKA 3C2VA 5EY3A 4U67J 3NVZC 3PIOJ 3CCQH 1YJWH 3L4PA 3PIPJ 2DSJA 3I55H 2J0FA 3L0GA 3TQVA 4USAA 1FFUB 3CC4H 1KQSH 2ZJQJ 3WNZA 4GA5A 4US8A 3AMZA 4WCEJ 3NVWC 3CXCH 2W55B 1YITH 3WO0A 1K73J 1N5XA 1AZYA 2OTJH 3C2OA 1KC8J 1O4UA 3VMMA 3B9JC 3CCEH 1VQ9H 3CPWH 1UOUA 5AN9F 2ZJPJ 5JVGJ 1VQ6H 1Q81J 1M90J 3J7ZM 1V97A 3CCVH 1QPOA 1N62B 3C2RA 3RPFA 1QVGH 5HULA 1QPRA 5AYZA 1N5WB 2WP4A 5GAHN 3NVVC 1N8RJ 3PAJA 4UY8M 5AYXA 1FIQC 2JBMA 2B7QA 2Q5WE 3CMEH
chains in the Genus database with same CATH topology
3CC2H 3CCMH 3G6EH 1VQPH 1VQOH 4WFAJ 4WFNJ 2PA2A 3G71H 4IO9J 1VQMH 5GAGN 5MLCO 3CCJH 5H1SO 1Q82J 1VQLH 3CMAH 1VQ8H 3CC7H 1VQNH 2QA4H 1YI2H 3I56H 1VQ7H 3G4SH 1KD1J 3CCSH 1VQ4H 4IOCJ 1YJ9H 5DM7J 2OTLH 5HL7J 1Q7YJ 3DLLJ 1Y69K 1YIJH 1YHQH 3CCRH 1VQKH 5DM6J 4WFBJ 1M1KJ 3CD6H 1NJIJ 3CCLH 1W2BH 1VQ5H 4IOAJ 3OW2H 5GAEN 2QEXH 1QVFH 1K8AJ 1K9MJ 4WF9J 5JVHJ 1JJ2H 1Q86J 1WKIA 3CCUH 2ZJRJ 1YJNH 1S72H 5GADN 4U67J 3PIOJ 3CCQH 1YJWH 3PIPJ 3I55H 3CC4H 1KQSH 2ZJQJ 4WCEJ 3CXCH 1YITH 1K73J 2OTJH 1KC8J 3CCEH 1VQ9H 3CPWH 5AN9F 2ZJPJ 5JVGJ 1VQ6H 1Q81J 1M90J 3J7ZM 3CCVH 1QVGH 5GAHN 1N8RJ 4UY8M 3CF5J 3CMEH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC2 H;  3CCM H;  3G6E H;  1VQP H;  1VQO H;  4WFA J;  4WFN J;  2PA2 A;  3G71 H;  4IO9 J;  1VQM H;  5GAG N;  5MLC O;  3CCJ H;  5H1S O;  1Q82 J;  1VQL H;  3CMA H;  1VQ8 H;  3CC7 H;  1VQN H;  2QA4 H;  1YI2 H;  3I56 H;  1VQ7 H;  3G4S H;  1KD1 J;  3CCS H;  1VQ4 H;  4IOC J;  1YJ9 H;  5DM7 J;  2OTL H;  5HL7 J;  1Q7Y J;  3DLL J;  1Y69 K;  1YIJ H;  1YHQ H;  3CCR H;  1VQK H;  5DM6 J;  4WFB J;  1M1K J;  3CD6 H;  1NJI J;  3CCL H;  1W2B H;  1VQ5 H;  4IOA J;  3OW2 H;  5GAE N;  2QEX H;  1QVF H;  1K8A J;  1K9M J;  4WF9 J;  5JVH J;  1JJ2 H;  1Q86 J;  1WKI A;  3CCU H;  2ZJR J;  1YJN H;  1S72 H;  5GAD N;  4U67 J;  3PIO J;  3CCQ H;  1YJW H;  3PIP J;  3I55 H;  3CC4 H;  1KQS H;  2ZJQ J;  4WCE J;  3CXC H;  1YIT H;  1K73 J;  2OTJ H;  1KC8 J;  3CCE H;  1VQ9 H;  3CPW H;  5AN9 F;  2ZJP J;  5JVG J;  1VQ6 H;  1Q81 J;  1M90 J;  3J7Z M;  3CCV H;  1QVG H;  5GAH N;  1N8R J;  4UY8 M;  3CF5 J;  3CME H; 
#chains in the Genus database with same CATH topology
 3CC2 H;  3CF5 J;  5MPO C;  1N61 B;  3G6E H;  3CCM H;  1VQP H;  4WFA J;  1VQO H;  1WYG A;  5AYY A;  1BRW A;  1N60 B;  2QIE A;  2W3S B;  4WFN J;  2PA2 A;  1QPQ A;  3G71 H;  3H5Q A;  4IO9 J;  5HUP A;  1VQM H;  5GAG N;  1X1O A;  5MLC O;  3CCJ H;  5HUO A;  1RM6 A;  5H1S O;  1FMA E;  3C2F A;  1YTD A;  3FAH A;  3AM9 A;  1Q82 J;  1VQL H;  3CMA H;  1VQ8 H;  3CC7 H;  4GA4 A;  1VQN H;  2QA4 H;  1JRP B;  2OMD A;  1DGJ A;  1FFV B;  1NVJ A;  1YI2 H;  4I9A A;  1ZXI B;  3I56 H;  1VQ7 H;  3C2E A;  4EAD A;  2WK6 A;  3G4S H;  2W54 B;  1KD1 J;  3AN1 A;  4AP8 A;  2I1O A;  3CCS H;  3SR6 C;  1VQ4 H;  2W3R B;  3WO1 A;  4IOC J;  4US9 A;  1YTE A;  2B7P A;  3ETR C;  4EAF A;  1JRO B;  1YJ9 H;  5DM7 J;  2OTL H;  5HL7 J;  1Q7Y J;  3DLL J;  1N63 B;  2TPT A;  1Y69 K;  4X46 A;  1YIJ H;  1YHQ H;  2I14 A;  1YTK A;  1FM0 E;  3CCR H;  3GNN A;  1VQK H;  5DM6 J;  5EP8 A;  4C80 A;  3BII E;  4XR5 A;  3EUB 4;  4WFB J;  1M1K J;  3CD6 H;  4C7Z A;  1NJI J;  3CCL H;  1OTP A;  1W2B H;  1VQ5 H;  3NS1 C;  1SIJ A;  4IOA J;  2B7N A;  1VLB A;  1QPN A;  4ZOH A;  1NVI E;  3OW2 H;  3NRZ C;  4GA6 A;  5GAE N;  4LHM A;  2E3T A;  1FO4 A;  1VDV A;  2QEX H;  1QVF H;  1K8A J;  1QAP A;  1SB3 A;  4C7Y A;  1K9M J;  3NVY C;  4WF9 J;  5JVH J;  2WK5 A;  4KWV A;  1JJ2 H;  3FC4 A;  1WKI A;  3CCU H;  1Q86 J;  2ZJR J;  4KWW A;  4YYY A;  1YJN H;  1S72 H;  5GAD N;  4YEK A;  3C2V A;  5EY3 A;  4U67 J;  3NVZ C;  3PIO J;  3CCQ H;  1YJW H;  3L4P A;  3PIP J;  2DSJ A;  3I55 H;  2J0F A;  3L0G A;  3TQV A;  4USA A;  1FFU B;  3CC4 H;  1KQS H;  2ZJQ J;  3WNZ A;  4GA5 A;  4US8 A;  3AMZ A;  4WCE J;  3NVW C;  3CXC H;  2W55 B;  1YIT H;  3WO0 A;  1K73 J;  1N5X A;  1AZY A;  2OTJ H;  3C2O A;  1KC8 J;  1O4U A;  3VMM A;  3B9J C;  3CCE H;  1VQ9 H;  3CPW H;  1UOU A;  5AN9 F;  2ZJP J;  5JVG J;  1VQ6 H;  1Q81 J;  1M90 J;  3J7Z M;  1V97 A;  3CCV H;  1QPO A;  1N62 B;  3C2R A;  3RPF A;  1QVG H;  5HUL A;  1QPR A;  5AYZ A;  1N5W B;  2WP4 A;  5GAH N;  3NVV C;  1N8R J;  3PAJ A;  4UY8 M;  5AYX A;  1FIQ C;  2JBM A;  2B7Q A;  2Q5W E;  3CME H; 
#chains in the Genus database with same CATH homology
 3CC2 H;  3CCM H;  3G6E H;  1VQP H;  1VQO H;  4WFA J;  4WFN J;  2PA2 A;  3G71 H;  4IO9 J;  1VQM H;  5GAG N;  5MLC O;  3CCJ H;  5H1S O;  1Q82 J;  1VQL H;  3CMA H;  1VQ8 H;  3CC7 H;  1VQN H;  2QA4 H;  1YI2 H;  3I56 H;  1VQ7 H;  3G4S H;  1KD1 J;  3CCS H;  1VQ4 H;  4IOC J;  1YJ9 H;  5DM7 J;  2OTL H;  5HL7 J;  1Q7Y J;  3DLL J;  1Y69 K;  1YIJ H;  1YHQ H;  3CCR H;  1VQK H;  5DM6 J;  4WFB J;  1M1K J;  3CD6 H;  1NJI J;  3CCL H;  1W2B H;  1VQ5 H;  4IOA J;  3OW2 H;  5GAE N;  2QEX H;  1QVF H;  1K8A J;  1K9M J;  4WF9 J;  5JVH J;  1JJ2 H;  1Q86 J;  1WKI A;  3CCU H;  2ZJR J;  1YJN H;  1S72 H;  5GAD N;  4U67 J;  3PIO J;  3CCQ H;  1YJW H;  3PIP J;  3I55 H;  3CC4 H;  1KQS H;  2ZJQ J;  4WCE J;  3CXC H;  1YIT H;  1K73 J;  2OTJ H;  1KC8 J;  3CCE H;  1VQ9 H;  3CPW H;  5AN9 F;  2ZJP J;  5JVG J;  1VQ6 H;  1Q81 J;  1M90 J;  3J7Z M;  3CCV H;  1QVG H;  5GAH N;  1N8R J;  4UY8 M;  3CF5 J;  3CME H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...