1C4TA

Catalytic domain from trimeric dihydrolipoamide succinyltransferase
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
229
structure length
226
Chain Sequence
RSEKRVPMRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (DIHYDROLIPOAMIDE SUCCINYLTRANSFERASE)
publication title Expression, purification, and structural analysis of the trimeric form of the catalytic domain of the Escherichia coli dihydrolipoamide succinyltransferase.
pubmed rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 64
structure length 226
sequence length 229
chains with identical sequence B, C
ec nomenclature ec 2.3.1.61: Dihydrolipoyllysine-residue succinyltransferase.
pdb deposition date 1999-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1c4tA00
4G0BA 2ZBAA 1EAAA 3FP0A 2I9DA 2JGPA 5DUAA 4JN3A 1XMDA 1XMCA 1XL7A 1L5AA 5FALA 5KJUA 3FOTA 2II5A 2II4A 3B30A 2IHWA 4JN5A 2E1TA 1XL8A 4KE4A 4HVMA 2E1VA 1Q9JA 1CLAA 1DPCA 2II3A 1EACA 1PD5A 3CLAA 5KJWA 1NOCB 1CIAA 2XHGA 1QCAA 1C4TA 2BGHA 4KECA 1EAFA 2RKTA 5FANA 3B2SA 2RKVA 5KJVA 1DPBA 1EAEA 3MAEA 2CLAA 5KJSA 3U9BA 5T3EA 4CLAA 1EADA 4N72A 1E2OA 4G2MA 1SCZA 5DU9A 1EABA 4G22A 5KJTA 2E1UA 2XR7A 2VSQA 1Q23A 3U9FA 1DPDA 3L60A
chains in the Genus database with same CATH superfamily
4G0BA 3FP0A 1XMCA 1XL7A 1L5AA 5KJTA 2II5A 2FY2A 3B30A 4KE4A 4HVMA 1XL8A 1DPCA 2II3A 3CLAA 1CIAA 1NM8A 2XHGA 4EYWA 1EAEA 1NDIA 4CLAA 1EADA 1E2OA 1EABA 4G22A 1NDFA 2VSQA 3U9FA 1DPDA 1Q6XA 5DUAA 4JN3A 2H3UA 5FALA 2II4A 2DEBA 2E1TA 2H4TA 1CLAA 5FANA 4KECA 2RKTA 3B2SA 5KJVA 3MAEA 5KJSA 3U9BA 1T7QA 5T3EA 4G2MA 2E1UA 2H3WA 2XR7A 2H3PA 2FY3A 2I9DA 1NDBA 1T1UA 2RCUA 3FOTA 4JN5A 2E1VA 1EACA 1NOCB 1QCAA 1EAFA 4EPHA 2FW3A 2CLAA 1S5OA 2FYOA 1Q23A 2ZBAA 1EAAA 2JGPA 4EP9A 1XMDA 2FY5A 5KJUA 2IHWA 1T7NA 1T7OA 1Q9JA 1PD5A 5KJWA 1C4TA 2BGHA 2RKVA 2FY4A 1DPBA 4N72A 1SCZA 5DU9A 3L60A
chains in the Genus database with same CATH topology
4G0BA 2ZBAA 1EAAA 3FP0A 2I9DA 2JGPA 5DUAA 4JN3A 1XMDA 1XMCA 1XL7A 1L5AA 5FALA 5KJUA 3FOTA 2II5A 2II4A 3B30A 2IHWA 4JN5A 2E1TA 1XL8A 4KE4A 4HVMA 2E1VA 1Q9JA 1CLAA 1DPCA 2II3A 1EACA 1PD5A 3CLAA 5KJWA 1NOCB 1CIAA 2XHGA 1QCAA 1C4TA 2BGHA 4KECA 1EAFA 2RKTA 5FANA 3B2SA 2RKVA 5KJVA 1DPBA 1EAEA 3MAEA 2CLAA 5KJSA 3U9BA 5T3EA 4CLAA 1EADA 4N72A 1E2OA 4G2MA 1SCZA 5DU9A 1EABA 4G22A 5KJTA 2E1UA 2XR7A 2VSQA 1Q23A 3U9FA 1DPDA 3L60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G0B A;  2ZBA A;  1EAA A;  3FP0 A;  2I9D A;  2JGP A;  5DUA A;  4JN3 A;  1XMD A;  1XMC A;  1XL7 A;  1L5A A;  5FAL A;  5KJU A;  3FOT A;  2II5 A;  2II4 A;  3B30 A;  2IHW A;  4JN5 A;  2E1T A;  1XL8 A;  4KE4 A;  4HVM A;  2E1V A;  1Q9J A;  1CLA A;  1DPC A;  2II3 A;  1EAC A;  1PD5 A;  3CLA A;  5KJW A;  1NOC B;  1CIA A;  2XHG A;  1QCA A;  1C4T A;  2BGH A;  4KEC A;  1EAF A;  2RKT A;  5FAN A;  3B2S A;  2RKV A;  5KJV A;  1DPB A;  1EAE A;  3MAE A;  2CLA A;  5KJS A;  3U9B A;  5T3E A;  4CLA A;  1EAD A;  4N72 A;  1E2O A;  4G2M A;  1SCZ A;  5DU9 A;  1EAB A;  4G22 A;  5KJT A;  2E1U A;  2XR7 A;  2VSQ A;  1Q23 A;  3U9F A;  1DPD A;  3L60 A; 
#chains in the Genus database with same CATH topology
 4G0B A;  3FP0 A;  1XMC A;  1XL7 A;  1L5A A;  5KJT A;  2II5 A;  2FY2 A;  3B30 A;  4KE4 A;  4HVM A;  1XL8 A;  1DPC A;  2II3 A;  3CLA A;  1CIA A;  1NM8 A;  2XHG A;  4EYW A;  1EAE A;  1NDI A;  4CLA A;  1EAD A;  1E2O A;  1EAB A;  4G22 A;  1NDF A;  2VSQ A;  3U9F A;  1DPD A;  1Q6X A;  5DUA A;  4JN3 A;  2H3U A;  5FAL A;  2II4 A;  2DEB A;  2E1T A;  2H4T A;  1CLA A;  5FAN A;  4KEC A;  2RKT A;  3B2S A;  5KJV A;  3MAE A;  5KJS A;  3U9B A;  1T7Q A;  5T3E A;  4G2M A;  2E1U A;  2H3W A;  2XR7 A;  2H3P A;  2FY3 A;  2I9D A;  1NDB A;  1T1U A;  2RCU A;  3FOT A;  4JN5 A;  2E1V A;  1EAC A;  1NOC B;  1QCA A;  1EAF A;  4EPH A;  2FW3 A;  2CLA A;  1S5O A;  2FYO A;  1Q23 A;  2ZBA A;  1EAA A;  2JGP A;  4EP9 A;  1XMD A;  2FY5 A;  5KJU A;  2IHW A;  1T7N A;  1T7O A;  1Q9J A;  1PD5 A;  5KJW A;  1C4T A;  2BGH A;  2RKV A;  2FY4 A;  1DPB A;  4N72 A;  1SCZ A;  5DU9 A;  3L60 A; 
#chains in the Genus database with same CATH homology
 4G0B A;  2ZBA A;  1EAA A;  3FP0 A;  2I9D A;  2JGP A;  5DUA A;  4JN3 A;  1XMD A;  1XMC A;  1XL7 A;  1L5A A;  5FAL A;  5KJU A;  3FOT A;  2II5 A;  2II4 A;  3B30 A;  2IHW A;  4JN5 A;  2E1T A;  1XL8 A;  4KE4 A;  4HVM A;  2E1V A;  1Q9J A;  1CLA A;  1DPC A;  2II3 A;  1EAC A;  1PD5 A;  3CLA A;  5KJW A;  1NOC B;  1CIA A;  2XHG A;  1QCA A;  1C4T A;  2BGH A;  4KEC A;  1EAF A;  2RKT A;  5FAN A;  3B2S A;  2RKV A;  5KJV A;  1DPB A;  1EAE A;  3MAE A;  2CLA A;  5KJS A;  3U9B A;  5T3E A;  4CLA A;  1EAD A;  4N72 A;  1E2O A;  4G2M A;  1SCZ A;  5DU9 A;  1EAB A;  4G22 A;  5KJT A;  2E1U A;  2XR7 A;  2VSQ A;  1Q23 A;  3U9F A;  1DPD A;  3L60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...