2RKTA

Crystal structure of apo f. graminearum tri101
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
452
structure length
437
Chain Sequence
b'SMAFKIQLDTLGQLPGIYTQISLLYPVSDSSQYPTIVSTFEQGLKRFSEAVPWVAGQVKAEGISEGNTGTSFIVPFEDVPRVVVKDLRDDPSAPTIEGMRKAGYPMAMFDENIIAPRKTLPIGPGTGPDDPKPVILLQLNFIKGGLILTVNGQHGAMDMVGQDAVIRLLSKACRNDPFTEEEMTAMNLDRKTIVPYLENYTIGPEVDHQIVKADVAGGPVSASWAFFTFSPKAMSELKDAATKTLFVSTDDALSAFIWKSASRVRLERIDGSAPTEFCRAVDARPAMGVSNNYPGLLQNMTYHNSTIGEIANESLGATASRLRSDPASMRQRTRGLATYLHNNPDKSNVSLTADADPSTSVMLSSWAKVGLWDYDFGLGLGKPETVRRPIFEPVESLMYFMPKKPDGEFCAALSLRDEDMDRLKADKEWTKYAQYVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trichothecene 3-O-acetyltransferase
publication title Structural and Functional Characterization of the TRI101 Trichothecene 3-O-Acetyltransferase from Fusarium sporotrichioides and Fusarium graminearum: KINETIC INSIGHTS TO COMBATING FUSARIUM HEAD BLIGHT
pubmed doi rcsb
source organism Gibberella zeae
molecule tags Transferase
total genus 141
structure length 437
sequence length 452
ec nomenclature
pdb deposition date 2007-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02458 Transferase Transferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 2rktA01
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 2rktA02
1Q23A 3L60A 3MAEA 2JGPA 4JN5A 1CIAA 1XL8A 1EAEA 5FALA 1EADA 4KE4A 1XL7A 1QCAA 1CLAA 2RKVA 4N72A 2E1TA 1C4TA 3U9BA 1EACA 5FANA 2II3A 1DPBA 3FOTA 2XR7A 5KJSA 2E1UA 1L5AA 2XHGA 1DPCA 4G2MA 3B2SA 5KJUA 2RKTA 3U9FA 2BGHA 1DPDA 1PD5A 1NOCB 3B30A 5T3EA 1Q9JA 3CLAA 4G0BA 4JN3A 4HVMA 4KECA 2E1VA 2ZBAA 4G22A 5KJTA 1XMCA 1EAFA 2II5A 1EAAA 2CLAA 2IHWA 2II4A 3FP0A 5DU9A 1E2OA 4CLAA 1EABA 5DUAA 2VSQA 1SCZA 2I9DA 5KJWA 1XMDA 5KJVA
chains in the Genus database with same CATH superfamily
3MAEA 1C4TA 1NDFA 3FOTA 1NM8A 2XR7A 5T3EA 2H3PA 4HVMA 1S5OA 4G22A 2FY5A 1EAFA 2FY3A 2II5A 5DU9A 2IHWA 1E2OA 2FY4A 5KJTA 1Q23A 2JGPA 1CIAA 1XL8A 5FALA 1QCAA 4N72A 2E1TA 5FANA 1DPBA 5KJSA 2RCUA 4EP9A 1DPCA 5KJUA 3B30A 1Q9JA 4G0BA 4KECA 2CLAA 5DUAA 1SCZA 3L60A 4JN5A 1EADA 4KE4A 1XL7A 3U9BA 1NDBA 2FW3A 2DEBA 2XHGA 1L5AA 3U9FA 1T1UA 1NOCB 1T7OA 2H4TA 2E1VA 2FY2A 2ZBAA 4EPHA 1XMCA 4EYWA 1T7QA 2VSQA 1PD5A 4CLAA 1T7NA 5KJVA 1EAEA 2FYOA 1CLAA 2RKVA 1EACA 2II3A 2E1UA 4G2MA 3B2SA 1Q6XA 2RKTA 2H3UA 2BGHA 1DPDA 4JN3A 3CLAA 3FP0A 2II4A 1EAAA 1NDIA 2H3WA 1EABA 2I9DA 5KJWA 1XMDA
chains in the Genus database with same CATH topology
1Q23A 3L60A 3MAEA 2JGPA 4JN5A 1CIAA 1XL8A 1EAEA 5FALA 1EADA 4KE4A 1XL7A 1QCAA 1CLAA 2RKVA 4N72A 2E1TA 1C4TA 3U9BA 1EACA 5FANA 2II3A 1DPBA 3FOTA 2XR7A 5KJSA 2E1UA 1L5AA 2XHGA 1DPCA 4G2MA 3B2SA 5KJUA 2RKTA 3U9FA 2BGHA 1DPDA 1PD5A 1NOCB 3B30A 5T3EA 1Q9JA 3CLAA 4G0BA 4JN3A 4HVMA 4KECA 2E1VA 2ZBAA 4G22A 5KJTA 1XMCA 1EAFA 2II5A 1EAAA 2CLAA 2IHWA 2II4A 3FP0A 5DU9A 1E2OA 4CLAA 1EABA 5DUAA 2VSQA 1SCZA 2I9DA 5KJWA 1XMDA 5KJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q23 A;  3L60 A;  3MAE A;  2JGP A;  4JN5 A;  1CIA A;  1XL8 A;  1EAE A;  5FAL A;  1EAD A;  4KE4 A;  1XL7 A;  1QCA A;  1CLA A;  2RKV A;  4N72 A;  2E1T A;  1C4T A;  3U9B A;  1EAC A;  5FAN A;  2II3 A;  1DPB A;  3FOT A;  2XR7 A;  5KJS A;  2E1U A;  1L5A A;  2XHG A;  1DPC A;  4G2M A;  3B2S A;  5KJU A;  2RKT A;  3U9F A;  2BGH A;  1DPD A;  1PD5 A;  1NOC B;  3B30 A;  5T3E A;  1Q9J A;  3CLA A;  4G0B A;  4JN3 A;  4HVM A;  4KEC A;  2E1V A;  2ZBA A;  4G22 A;  5KJT A;  1XMC A;  1EAF A;  2II5 A;  1EAA A;  2CLA A;  2IHW A;  2II4 A;  3FP0 A;  5DU9 A;  1E2O A;  4CLA A;  1EAB A;  5DUA A;  2VSQ A;  1SCZ A;  2I9D A;  5KJW A;  1XMD A;  5KJV A; 
#chains in the Genus database with same CATH topology
 3MAE A;  1C4T A;  1NDF A;  3FOT A;  1NM8 A;  2XR7 A;  5T3E A;  2H3P A;  4HVM A;  1S5O A;  4G22 A;  2FY5 A;  1EAF A;  2FY3 A;  2II5 A;  5DU9 A;  2IHW A;  1E2O A;  2FY4 A;  5KJT A;  1Q23 A;  2JGP A;  1CIA A;  1XL8 A;  5FAL A;  1QCA A;  4N72 A;  2E1T A;  5FAN A;  1DPB A;  5KJS A;  2RCU A;  4EP9 A;  1DPC A;  5KJU A;  3B30 A;  1Q9J A;  4G0B A;  4KEC A;  2CLA A;  5DUA A;  1SCZ A;  3L60 A;  4JN5 A;  1EAD A;  4KE4 A;  1XL7 A;  3U9B A;  1NDB A;  2FW3 A;  2DEB A;  2XHG A;  1L5A A;  3U9F A;  1T1U A;  1NOC B;  1T7O A;  2H4T A;  2E1V A;  2FY2 A;  2ZBA A;  4EPH A;  1XMC A;  4EYW A;  1T7Q A;  2VSQ A;  1PD5 A;  4CLA A;  1T7N A;  5KJV A;  1EAE A;  2FYO A;  1CLA A;  2RKV A;  1EAC A;  2II3 A;  2E1U A;  4G2M A;  3B2S A;  1Q6X A;  2RKT A;  2H3U A;  2BGH A;  1DPD A;  4JN3 A;  3CLA A;  3FP0 A;  2II4 A;  1EAA A;  1NDI A;  2H3W A;  1EAB A;  2I9D A;  5KJW A;  1XMD A; 
#chains in the Genus database with same CATH homology
 1Q23 A;  3L60 A;  3MAE A;  2JGP A;  4JN5 A;  1CIA A;  1XL8 A;  1EAE A;  5FAL A;  1EAD A;  4KE4 A;  1XL7 A;  1QCA A;  1CLA A;  2RKV A;  4N72 A;  2E1T A;  1C4T A;  3U9B A;  1EAC A;  5FAN A;  2II3 A;  1DPB A;  3FOT A;  2XR7 A;  5KJS A;  2E1U A;  1L5A A;  2XHG A;  1DPC A;  4G2M A;  3B2S A;  5KJU A;  2RKT A;  3U9F A;  2BGH A;  1DPD A;  1PD5 A;  1NOC B;  3B30 A;  5T3E A;  1Q9J A;  3CLA A;  4G0B A;  4JN3 A;  4HVM A;  4KEC A;  2E1V A;  2ZBA A;  4G22 A;  5KJT A;  1XMC A;  1EAF A;  2II5 A;  1EAA A;  2CLA A;  2IHW A;  2II4 A;  3FP0 A;  5DU9 A;  1E2O A;  4CLA A;  1EAB A;  5DUA A;  2VSQ A;  1SCZ A;  2I9D A;  5KJW A;  1XMD A;  5KJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...