2RKTA

Crystal structure of apo f. graminearum tri101
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
452
structure length
437
Chain Sequence
SMAFKIQLDTLGQLPGIYTQISLLYPVSDSSQYPTIVSTFEQGLKRFSEAVPWVAGQVKAEGISEGNTGTSFIVPFEDVPRVVVKDLRDDPSAPTIEGMRKAGYPMAMFDENIIAPRKTLPIGPGTGPDDPKPVILLQLNFIKGGLILTVNGQHGAMDMVGQDAVIRLLSKACRNDPFTEEEMTAMNLDRKTIVPYLENYTIGPEVDHQIVKADVAGGPVSASWAFFTFSPKAMSELKDAATKTLFVSTDDALSAFIWKSASRVRLERIDGSAPTEFCRAVDARPAMGVSNNYPGLLQNMTYHNSTIGEIANESLGATASRLRSDPASMRQRTRGLATYLHNNPDKSNVSLTADADPSTSVMLSSWAKVGLWDYDFGLGLGKPETVRRPIFEPVESLMYFMPKKPDGEFCAALSLRDEDMDRLKADKEWTKYAQYVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trichothecene 3-O-acetyltransferase
publication title Structural and Functional Characterization of the TRI101 Trichothecene 3-O-Acetyltransferase from Fusarium sporotrichioides and Fusarium graminearum: KINETIC INSIGHTS TO COMBATING FUSARIUM HEAD BLIGHT
pubmed doi rcsb
source organism Gibberella zeae
molecule tags Transferase
total genus 141
structure length 437
sequence length 452
ec nomenclature
pdb deposition date 2007-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02458 Transferase Transferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 2rktA01
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 2rktA02
1E2OA 3FP0A 1CIAA 1L5AA 2BGHA 2ZBAA 1EABA 5KJVA 1DPBA 1NOCB 4KE4A 1QCAA 1PD5A 4G2MA 1DPDA 1CLAA 2II3A 2II4A 3MAEA 5KJWA 2I9DA 1XL8A 1EAFA 2RKVA 5DU9A 3U9FA 2E1UA 2RKTA 3L60A 4G22A 2XHGA 1XMDA 1C4TA 3CLAA 1XL7A 5T3EA 4KECA 2CLAA 2II5A 4JN5A 5FANA 4CLAA 2JGPA 1EAEA 4G0BA 1Q9JA 3B30A 1Q23A 2IHWA 2XR7A 2VSQA 4N72A 5KJSA 3B2SA 4JN3A 1EADA 2E1TA 2E1VA 1EACA 5KJTA 3U9BA 5DUAA 4HVMA 1SCZA 1EAAA 3FOTA 5FALA 1DPCA 1XMCA 5KJUA
chains in the Genus database with same CATH superfamily
1S5OA 3FP0A 1CIAA 1NDIA 1NOCB 4G2MA 2II4A 2I9DA 1XL8A 2RKVA 2E1UA 2RKTA 3L60A 4G22A 1C4TA 4EP9A 5FANA 3B30A 2IHWA 2XR7A 3B2SA 4JN3A 1EACA 4HVMA 2FYOA 2RCUA 3FOTA 1T7NA 1DPCA 1XMCA 2BGHA 5KJVA 1QCAA 1PD5A 1DPDA 1CLAA 3MAEA 5KJWA 5DU9A 4EPHA 2FY2A 2XHGA 2FY4A 1XL7A 4KECA 2H3PA 2II5A 4CLAA 1NDBA 1Q9JA 5KJSA 2VSQA 1Q6XA 1NM8A 1EADA 2FW3A 3U9BA 1EAAA 2DEBA 5KJUA 1T7QA 1EABA 4EYWA 1EAFA 2H3UA 1EAEA 1Q23A 1T1UA 4N72A 5KJTA 2H3WA 5FALA 1NDFA 1E2OA 2H4TA 1L5AA 2ZBAA 1DPBA 4KE4A 2II3A 3U9FA 1T7OA 1XMDA 3CLAA 2FY3A 5T3EA 2CLAA 4JN5A 2JGPA 4G0BA 2FY5A 2E1TA 2E1VA 5DUAA 1SCZA
chains in the Genus database with same CATH topology
1E2OA 3FP0A 1CIAA 1L5AA 2BGHA 2ZBAA 1EABA 5KJVA 1DPBA 1NOCB 4KE4A 1QCAA 1PD5A 4G2MA 1DPDA 1CLAA 2II3A 2II4A 3MAEA 5KJWA 2I9DA 1XL8A 1EAFA 2RKVA 5DU9A 3U9FA 2E1UA 2RKTA 3L60A 4G22A 2XHGA 1XMDA 1C4TA 3CLAA 1XL7A 5T3EA 4KECA 2CLAA 2II5A 4JN5A 5FANA 4CLAA 2JGPA 1EAEA 4G0BA 1Q9JA 3B30A 1Q23A 2IHWA 2XR7A 2VSQA 4N72A 5KJSA 3B2SA 4JN3A 1EADA 2E1TA 2E1VA 1EACA 5KJTA 3U9BA 5DUAA 4HVMA 1SCZA 1EAAA 3FOTA 5FALA 1DPCA 1XMCA 5KJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E2O A;  3FP0 A;  1CIA A;  1L5A A;  2BGH A;  2ZBA A;  1EAB A;  5KJV A;  1DPB A;  1NOC B;  4KE4 A;  1QCA A;  1PD5 A;  4G2M A;  1DPD A;  1CLA A;  2II3 A;  2II4 A;  3MAE A;  5KJW A;  2I9D A;  1XL8 A;  1EAF A;  2RKV A;  5DU9 A;  3U9F A;  2E1U A;  2RKT A;  3L60 A;  4G22 A;  2XHG A;  1XMD A;  1C4T A;  3CLA A;  1XL7 A;  5T3E A;  4KEC A;  2CLA A;  2II5 A;  4JN5 A;  5FAN A;  4CLA A;  2JGP A;  1EAE A;  4G0B A;  1Q9J A;  3B30 A;  1Q23 A;  2IHW A;  2XR7 A;  2VSQ A;  4N72 A;  5KJS A;  3B2S A;  4JN3 A;  1EAD A;  2E1T A;  2E1V A;  1EAC A;  5KJT A;  3U9B A;  5DUA A;  4HVM A;  1SCZ A;  1EAA A;  3FOT A;  5FAL A;  1DPC A;  1XMC A;  5KJU A; 
#chains in the Genus database with same CATH topology
 1S5O A;  3FP0 A;  1CIA A;  1NDI A;  1NOC B;  4G2M A;  2II4 A;  2I9D A;  1XL8 A;  2RKV A;  2E1U A;  2RKT A;  3L60 A;  4G22 A;  1C4T A;  4EP9 A;  5FAN A;  3B30 A;  2IHW A;  2XR7 A;  3B2S A;  4JN3 A;  1EAC A;  4HVM A;  2FYO A;  2RCU A;  3FOT A;  1T7N A;  1DPC A;  1XMC A;  2BGH A;  5KJV A;  1QCA A;  1PD5 A;  1DPD A;  1CLA A;  3MAE A;  5KJW A;  5DU9 A;  4EPH A;  2FY2 A;  2XHG A;  2FY4 A;  1XL7 A;  4KEC A;  2H3P A;  2II5 A;  4CLA A;  1NDB A;  1Q9J A;  5KJS A;  2VSQ A;  1Q6X A;  1NM8 A;  1EAD A;  2FW3 A;  3U9B A;  1EAA A;  2DEB A;  5KJU A;  1T7Q A;  1EAB A;  4EYW A;  1EAF A;  2H3U A;  1EAE A;  1Q23 A;  1T1U A;  4N72 A;  5KJT A;  2H3W A;  5FAL A;  1NDF A;  1E2O A;  2H4T A;  1L5A A;  2ZBA A;  1DPB A;  4KE4 A;  2II3 A;  3U9F A;  1T7O A;  1XMD A;  3CLA A;  2FY3 A;  5T3E A;  2CLA A;  4JN5 A;  2JGP A;  4G0B A;  2FY5 A;  2E1T A;  2E1V A;  5DUA A;  1SCZ A; 
#chains in the Genus database with same CATH homology
 1E2O A;  3FP0 A;  1CIA A;  1L5A A;  2BGH A;  2ZBA A;  1EAB A;  5KJV A;  1DPB A;  1NOC B;  4KE4 A;  1QCA A;  1PD5 A;  4G2M A;  1DPD A;  1CLA A;  2II3 A;  2II4 A;  3MAE A;  5KJW A;  2I9D A;  1XL8 A;  1EAF A;  2RKV A;  5DU9 A;  3U9F A;  2E1U A;  2RKT A;  3L60 A;  4G22 A;  2XHG A;  1XMD A;  1C4T A;  3CLA A;  1XL7 A;  5T3E A;  4KEC A;  2CLA A;  2II5 A;  4JN5 A;  5FAN A;  4CLA A;  2JGP A;  1EAE A;  4G0B A;  1Q9J A;  3B30 A;  1Q23 A;  2IHW A;  2XR7 A;  2VSQ A;  4N72 A;  5KJS A;  3B2S A;  4JN3 A;  1EAD A;  2E1T A;  2E1V A;  1EAC A;  5KJT A;  3U9B A;  5DUA A;  4HVM A;  1SCZ A;  1EAA A;  3FOT A;  5FAL A;  1DPC A;  1XMC A;  5KJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...