2RKTA

Crystal structure of apo f. graminearum tri101
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
452
structure length
437
Chain Sequence
SMAFKIQLDTLGQLPGIYTQISLLYPVSDSSQYPTIVSTFEQGLKRFSEAVPWVAGQVKAEGISEGNTGTSFIVPFEDVPRVVVKDLRDDPSAPTIEGMRKAGYPMAMFDENIIAPRKTLPIGPGTGPDDPKPVILLQLNFIKGGLILTVNGQHGAMDMVGQDAVIRLLSKACRNDPFTEEEMTAMNLDRKTIVPYLENYTIGPEVDHQIVKADVAGGPVSASWAFFTFSPKAMSELKDAATKTLFVSTDDALSAFIWKSASRVRLERIDGSAPTEFCRAVDARPAMGVSNNYPGLLQNMTYHNSTIGEIANESLGATASRLRSDPASMRQRTRGLATYLHNNPDKSNVSLTADADPSTSVMLSSWAKVGLWDYDFGLGLGKPETVRRPIFEPVESLMYFMPKKPDGEFCAALSLRDEDMDRLKADKEWTKYAQYVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trichothecene 3-O-acetyltransferase
publication title Structural and Functional Characterization of the TRI101 Trichothecene 3-O-Acetyltransferase from Fusarium sporotrichioides and Fusarium graminearum: KINETIC INSIGHTS TO COMBATING FUSARIUM HEAD BLIGHT
pubmed doi rcsb
source organism Gibberella zeae
molecule tags Transferase
total genus 141
structure length 437
sequence length 452
ec nomenclature
pdb deposition date 2007-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02458 Transferase Transferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 2rktA01
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 2rktA02
2IHWA 2RKVA 2II4A 3FP0A 4G0BA 1Q9JA 2ZBAA 4G2MA 3L60A 1EADA 5T3EA 1L5AA 4CLAA 5FALA 4JN3A 1XMDA 4N72A 5KJVA 5KJTA 5KJUA 4G22A 1E2OA 5DUAA 1XMCA 1EACA 2II5A 1XL8A 1EABA 2RKTA 2VSQA 5KJWA 1CLAA 1C4TA 2BGHA 2XHGA 1DPDA 3FOTA 3U9BA 1EAAA 1QCAA 2CLAA 2II3A 2JGPA 4HVMA 1CIAA 1DPCA 1SCZA 2E1VA 3CLAA 1EAEA 2XR7A 1PD5A 1XL7A 3B2SA 2E1TA 5KJSA 1EAFA 4KECA 3B30A 3U9FA 2E1UA 1NOCB 3MAEA 4JN5A 2I9DA 5DU9A 5FANA 1Q23A 1DPBA 4KE4A
chains in the Genus database with same CATH superfamily
1T7QA 4G2MA 4EYWA 1L5AA 4JN3A 2RCUA 5KJTA 1NDBA 1XL8A 1EABA 2RKTA 2VSQA 1CLAA 2FY4A 1DPDA 2JGPA 2CLAA 2DEBA 2FY2A 1PD5A 1T7NA 3U9FA 4KECA 3MAEA 2H3WA 4JN5A 5DU9A 5FANA 1DPBA 4KE4A 4CLAA 2II4A 5T3EA 2ZBAA 5KJVA 4EP9A 4G22A 1XMCA 2II5A 1Q6XA 1C4TA 2XHGA 3FOTA 1EAAA 2H4TA 1DPCA 3CLAA 3B2SA 5KJSA 1S5OA 1NOCB 2H3PA 1Q23A 1EAEA 5KJUA 2IHWA 2RKVA 1Q9JA 1NDFA 1XMDA 1E2OA 2FY3A 4EPHA 2FY5A 2BGHA 1T1UA 3U9BA 2II3A 2H3UA 2E1VA 2XR7A 3B30A 5FALA 3FP0A 4G0BA 3L60A 1EADA 1T7OA 4N72A 1NM8A 5DUAA 1EACA 5KJWA 1QCAA 4HVMA 2FYOA 1CIAA 1SCZA 2FW3A 1XL7A 2E1TA 1EAFA 1NDIA 2E1UA 2I9DA
chains in the Genus database with same CATH topology
2IHWA 2RKVA 2II4A 3FP0A 4G0BA 1Q9JA 2ZBAA 4G2MA 3L60A 1EADA 5T3EA 1L5AA 4CLAA 5FALA 4JN3A 1XMDA 4N72A 5KJVA 5KJTA 5KJUA 4G22A 1E2OA 5DUAA 1XMCA 1EACA 2II5A 1XL8A 1EABA 2RKTA 2VSQA 5KJWA 1CLAA 1C4TA 2BGHA 2XHGA 1DPDA 3FOTA 3U9BA 1EAAA 1QCAA 2CLAA 2II3A 2JGPA 4HVMA 1CIAA 1DPCA 1SCZA 2E1VA 3CLAA 1EAEA 2XR7A 1PD5A 1XL7A 3B2SA 2E1TA 5KJSA 1EAFA 4KECA 3B30A 3U9FA 2E1UA 1NOCB 3MAEA 4JN5A 2I9DA 5DU9A 5FANA 1Q23A 1DPBA 4KE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IHW A;  2RKV A;  2II4 A;  3FP0 A;  4G0B A;  1Q9J A;  2ZBA A;  4G2M A;  3L60 A;  1EAD A;  5T3E A;  1L5A A;  4CLA A;  5FAL A;  4JN3 A;  1XMD A;  4N72 A;  5KJV A;  5KJT A;  5KJU A;  4G22 A;  1E2O A;  5DUA A;  1XMC A;  1EAC A;  2II5 A;  1XL8 A;  1EAB A;  2RKT A;  2VSQ A;  5KJW A;  1CLA A;  1C4T A;  2BGH A;  2XHG A;  1DPD A;  3FOT A;  3U9B A;  1EAA A;  1QCA A;  2CLA A;  2II3 A;  2JGP A;  4HVM A;  1CIA A;  1DPC A;  1SCZ A;  2E1V A;  3CLA A;  1EAE A;  2XR7 A;  1PD5 A;  1XL7 A;  3B2S A;  2E1T A;  5KJS A;  1EAF A;  4KEC A;  3B30 A;  3U9F A;  2E1U A;  1NOC B;  3MAE A;  4JN5 A;  2I9D A;  5DU9 A;  5FAN A;  1Q23 A;  1DPB A;  4KE4 A; 
#chains in the Genus database with same CATH topology
 1T7Q A;  4G2M A;  4EYW A;  1L5A A;  4JN3 A;  2RCU A;  5KJT A;  1NDB A;  1XL8 A;  1EAB A;  2RKT A;  2VSQ A;  1CLA A;  2FY4 A;  1DPD A;  2JGP A;  2CLA A;  2DEB A;  2FY2 A;  1PD5 A;  1T7N A;  3U9F A;  4KEC A;  3MAE A;  2H3W A;  4JN5 A;  5DU9 A;  5FAN A;  1DPB A;  4KE4 A;  4CLA A;  2II4 A;  5T3E A;  2ZBA A;  5KJV A;  4EP9 A;  4G22 A;  1XMC A;  2II5 A;  1Q6X A;  1C4T A;  2XHG A;  3FOT A;  1EAA A;  2H4T A;  1DPC A;  3CLA A;  3B2S A;  5KJS A;  1S5O A;  1NOC B;  2H3P A;  1Q23 A;  1EAE A;  5KJU A;  2IHW A;  2RKV A;  1Q9J A;  1NDF A;  1XMD A;  1E2O A;  2FY3 A;  4EPH A;  2FY5 A;  2BGH A;  1T1U A;  3U9B A;  2II3 A;  2H3U A;  2E1V A;  2XR7 A;  3B30 A;  5FAL A;  3FP0 A;  4G0B A;  3L60 A;  1EAD A;  1T7O A;  4N72 A;  1NM8 A;  5DUA A;  1EAC A;  5KJW A;  1QCA A;  4HVM A;  2FYO A;  1CIA A;  1SCZ A;  2FW3 A;  1XL7 A;  2E1T A;  1EAF A;  1NDI A;  2E1U A;  2I9D A; 
#chains in the Genus database with same CATH homology
 2IHW A;  2RKV A;  2II4 A;  3FP0 A;  4G0B A;  1Q9J A;  2ZBA A;  4G2M A;  3L60 A;  1EAD A;  5T3E A;  1L5A A;  4CLA A;  5FAL A;  4JN3 A;  1XMD A;  4N72 A;  5KJV A;  5KJT A;  5KJU A;  4G22 A;  1E2O A;  5DUA A;  1XMC A;  1EAC A;  2II5 A;  1XL8 A;  1EAB A;  2RKT A;  2VSQ A;  5KJW A;  1CLA A;  1C4T A;  2BGH A;  2XHG A;  1DPD A;  3FOT A;  3U9B A;  1EAA A;  1QCA A;  2CLA A;  2II3 A;  2JGP A;  4HVM A;  1CIA A;  1DPC A;  1SCZ A;  2E1V A;  3CLA A;  1EAE A;  2XR7 A;  1PD5 A;  1XL7 A;  3B2S A;  2E1T A;  5KJS A;  1EAF A;  4KEC A;  3B30 A;  3U9F A;  2E1U A;  1NOC B;  3MAE A;  4JN5 A;  2I9D A;  5DU9 A;  5FAN A;  1Q23 A;  1DPB A;  4KE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...