1Q6XA

Crystal structure of rat choline acetyltransferase
Total Genus 215
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
215
sequence length
600
structure length
600
Chain Sequence
WEELDLPKLPVPPLQQTLATYLQCMQHLVPEEQFRKSQAIVKRFGAPGGLGETLQEKLLERQEKTANWVSEYWLNDMYLNNRLALPVNSSPAVIFARQHFQDTNDQLRFAACLISGVLSYKTLLDSHSLPTDWAKGQLSGQPLCMKQYYRLFSSYRLPGHTQDTLVAQKSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAKARTVLLKDSTNRDSLDMIERCICLVCLDGPGTGELSDTHRALQLLHGGGCSLNGANRWYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHMMTSNKKLVRADSVSELPAPRRLRWKCSPETQGHLASSAEKLQRIVKNLDFIVYKFDNYGKTFIKKQKYSPDGFIQVALQLAYYRLYQRLVPTYESASIRRFQEGRVDNIRSATPEALAFVQAMTDHKAAMPASEKLQLLQTAMQAQTEYTVMAITGMAIDNHLLALRELARDLCKEPPEMFMDETYLMSNRFVLSTSQVPTTMEMFCCYGPVVPNGYGACYNPQPEAITFCISSFHSCKETSSVEFAEAVGASLVDMRDLCSSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords choline O-acetyltransferase
publication title Choline acetyltransferase structure reveals distribution of mutations that cause motor disorders.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 215
structure length 600
sequence length 600
chains with identical sequence B
ec nomenclature ec 2.3.1.6: Choline O-acetyltransferase.
pdb deposition date 2003-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00755 Carn_acyltransf Choline/Carnitine o-acyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.40 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol Acetyltransferase 1q6xA01
3.30.559.70 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol Acetyltransferase 1q6xA02
2FW3A 1T1UA 2FYOA 2H3WA 2H3UA 1NDIA 2H3PA 4EPHA 2FY3A 1NM8A 2FY5A 1T7NA 4EYWA 2H4TA 2FY2A 1T7OA 1NDFA 2FY4A 1Q6XA 2RCUA 2DEBA 1T7QA 1NDBA 1S5OA 4EP9A
chains in the Genus database with same CATH superfamily
5KJVA 1NDIA 1QCAA 2I9DA 5T3EA 2RKTA 1EAFA 4G2MA 1XMDA 2II4A 2XHGA 1T7OA 1DPBA 1EADA 1SCZA 4CLAA 2DEBA 2II5A 1NOCB 1NDBA 4JN5A 1CIAA 2JGPA 1DPCA 2FY3A 1NM8A 2FY5A 1T7NA 3L60A 2XR7A 2VSQA 1E2OA 3B2SA 2FY4A 1XMCA 5KJWA 5DU9A 3CLAA 2IHWA 2E1TA 1CLAA 3FP0A 1EABA 4G22A 3U9BA 1T1UA 1EAEA 2H3WA 2H3UA 2E1VA 2H3PA 5KJUA 1XL7A 5DUAA 4EYWA 4G0BA 2ZBAA 2E1UA 1C4TA 3MAEA 1Q6XA 2RCUA 4HVMA 1T7QA 1Q23A 1DPDA 1S5OA 1L5AA 4EP9A 4KECA 2RKVA 2FW3A 2FYOA 4N72A 1XL8A 4EPHA 1EACA 3B30A 4KE4A 1PD5A 3FOTA 1Q9JA 5FANA 2H4TA 2FY2A 1NDFA 2II3A 5FALA 5KJTA 1EAAA 4JN3A 5KJSA 2BGHA 3U9FA 2CLAA
chains in the Genus database with same CATH topology
2FW3A 2JGPA 1T1UA 2FYOA 2H3WA 2H3UA 1NDIA 5T3EA 2H3PA 4EPHA 2FY3A 1NM8A 2FY5A 1T7NA 5DUAA 4EP9A 3FOTA 1Q9JA 4EYWA 2H4TA 2VSQA 2XHGA 2FY2A 1T7OA 1NDFA 2FY4A 1L5AA 1Q6XA 2RCUA 5DU9A 2DEBA 4HVMA 4JN3A 1T7QA 1NDBA 4JN5A 1S5OA 3FP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FW3 A;  1T1U A;  2FYO A;  2H3W A;  2H3U A;  1NDI A;  2H3P A;  4EPH A;  2FY3 A;  1NM8 A;  2FY5 A;  1T7N A;  4EYW A;  2H4T A;  2FY2 A;  1T7O A;  1NDF A;  2FY4 A;  1Q6X A;  2RCU A;  2DEB A;  1T7Q A;  1NDB A;  1S5O A;  4EP9 A; 
#chains in the Genus database with same CATH topology
 5KJV A;  1NDI A;  1QCA A;  2I9D A;  5T3E A;  2RKT A;  1EAF A;  4G2M A;  1XMD A;  2II4 A;  2XHG A;  1T7O A;  1DPB A;  1EAD A;  1SCZ A;  4CLA A;  2DEB A;  2II5 A;  1NOC B;  1NDB A;  4JN5 A;  1CIA A;  2JGP A;  1DPC A;  2FY3 A;  1NM8 A;  2FY5 A;  1T7N A;  3L60 A;  2XR7 A;  2VSQ A;  1E2O A;  3B2S A;  2FY4 A;  1XMC A;  5KJW A;  5DU9 A;  3CLA A;  2IHW A;  2E1T A;  1CLA A;  3FP0 A;  1EAB A;  4G22 A;  3U9B A;  1T1U A;  1EAE A;  2H3W A;  2H3U A;  2E1V A;  2H3P A;  5KJU A;  1XL7 A;  5DUA A;  4EYW A;  4G0B A;  2ZBA A;  2E1U A;  1C4T A;  3MAE A;  1Q6X A;  2RCU A;  4HVM A;  1T7Q A;  1Q23 A;  1DPD A;  1S5O A;  1L5A A;  4EP9 A;  4KEC A;  2RKV A;  2FW3 A;  2FYO A;  4N72 A;  1XL8 A;  4EPH A;  1EAC A;  3B30 A;  4KE4 A;  1PD5 A;  3FOT A;  1Q9J A;  5FAN A;  2H4T A;  2FY2 A;  1NDF A;  2II3 A;  5FAL A;  5KJT A;  1EAA A;  4JN3 A;  5KJS A;  2BGH A;  3U9F A;  2CLA A; 
#chains in the Genus database with same CATH homology
 2FW3 A;  2JGP A;  1T1U A;  2FYO A;  2H3W A;  2H3U A;  1NDI A;  5T3E A;  2H3P A;  4EPH A;  2FY3 A;  1NM8 A;  2FY5 A;  1T7N A;  5DUA A;  4EP9 A;  3FOT A;  1Q9J A;  4EYW A;  2H4T A;  2VSQ A;  2XHG A;  2FY2 A;  1T7O A;  1NDF A;  2FY4 A;  1L5A A;  1Q6X A;  2RCU A;  5DU9 A;  2DEB A;  4HVM A;  4JN3 A;  1T7Q A;  1NDB A;  4JN5 A;  1S5O A;  3FP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...