1Q6XA

Crystal structure of rat choline acetyltransferase
Total Genus 215
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
215
sequence length
600
structure length
600
Chain Sequence
b'WEELDLPKLPVPPLQQTLATYLQCMQHLVPEEQFRKSQAIVKRFGAPGGLGETLQEKLLERQEKTANWVSEYWLNDMYLNNRLALPVNSSPAVIFARQHFQDTNDQLRFAACLISGVLSYKTLLDSHSLPTDWAKGQLSGQPLCMKQYYRLFSSYRLPGHTQDTLVAQKSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAKARTVLLKDSTNRDSLDMIERCICLVCLDGPGTGELSDTHRALQLLHGGGCSLNGANRWYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHMMTSNKKLVRADSVSELPAPRRLRWKCSPETQGHLASSAEKLQRIVKNLDFIVYKFDNYGKTFIKKQKYSPDGFIQVALQLAYYRLYQRLVPTYESASIRRFQEGRVDNIRSATPEALAFVQAMTDHKAAMPASEKLQLLQTAMQAQTEYTVMAITGMAIDNHLLALRELARDLCKEPPEMFMDETYLMSNRFVLSTSQVPTTMEMFCCYGPVVPNGYGACYNPQPEAITFCISSFHSCKETSSVEFAEAVGASLVDMRDLCSSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords choline O-acetyltransferase
publication title Choline acetyltransferase structure reveals distribution of mutations that cause motor disorders.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 215
structure length 600
sequence length 600
chains with identical sequence B
ec nomenclature ec 2.3.1.6: Choline O-acetyltransferase.
pdb deposition date 2003-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00755 Carn_acyltransf Choline/Carnitine o-acyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.40 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol Acetyltransferase 1q6xA01
3.30.559.70 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol Acetyltransferase 1q6xA02
2FY2A 2FY4A 2H4TA 2FY3A 2FW3A 2H3UA 1S5OA 2FYOA 1T7OA 1NDIA 1T7NA 1NDFA 1T7QA 2H3PA 4EYWA 2RCUA 1T1UA 1Q6XA 4EP9A 2DEBA 1NM8A 2H3WA 2FY5A 4EPHA 1NDBA
chains in the Genus database with same CATH superfamily
2FY2A 5DU9A 1EAFA 2VSQA 2FW3A 5T3EA 1S5OA 4N72A 2XR7A 3CLAA 2II4A 1CLAA 1Q23A 1EAEA 2E1UA 1NDFA 5KJVA 1PD5A 1EABA 1XMDA 2H3PA 2RKVA 3L60A 4G0BA 5FALA 5KJTA 1T1UA 3B30A 1QCAA 1XL8A 2JGPA 1EAAA 3B2SA 1DPBA 1DPDA 2H4TA 1EACA 2E1VA 2E1TA 1T7NA 2ZBAA 3FOTA 1CIAA 1Q9JA 2II3A 2H3WA 4JN5A 4G2MA 2I9DA 2FY3A 5FANA 5DUAA 1L5AA 2RKTA 5KJUA 1T7OA 1NDIA 1C4TA 1SCZA 4KECA 4CLAA 1T7QA 4KE4A 2II5A 2DEBA 1NM8A 5KJWA 2IHWA 2FY4A 2XHGA 3FP0A 3U9BA 2CLAA 2H3UA 1XMCA 3U9FA 1NDBA 2FYOA 1XL7A 1EADA 1NOCB 4G22A 4JN3A 4EYWA 1DPCA 5KJSA 4HVMA 2BGHA 1Q6XA 4EP9A 3MAEA 1E2OA 2FY5A 4EPHA 2RCUA
chains in the Genus database with same CATH topology
2FY2A 2FY4A 5DU9A 2H4TA 2XHGA 3FP0A 2VSQA 2FY3A 2FW3A 5DUAA 5T3EA 2H3UA 1S5OA 1L5AA 2FYOA 1T7OA 1NDIA 1T7NA 1NDFA 1T7QA 2H3PA 4JN3A 3FOTA 4EYWA 4HVMA 1Q9JA 1T1UA 2RCUA 1Q6XA 4EP9A 2DEBA 1NM8A 2JGPA 2H3WA 4JN5A 2FY5A 4EPHA 1NDBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FY2 A;  2FY4 A;  2H4T A;  2FY3 A;  2FW3 A;  2H3U A;  1S5O A;  2FYO A;  1T7O A;  1NDI A;  1T7N A;  1NDF A;  1T7Q A;  2H3P A;  4EYW A;  2RCU A;  1T1U A;  1Q6X A;  4EP9 A;  2DEB A;  1NM8 A;  2H3W A;  2FY5 A;  4EPH A;  1NDB A; 
#chains in the Genus database with same CATH topology
 2FY2 A;  5DU9 A;  1EAF A;  2VSQ A;  2FW3 A;  5T3E A;  1S5O A;  4N72 A;  2XR7 A;  3CLA A;  2II4 A;  1CLA A;  1Q23 A;  1EAE A;  2E1U A;  1NDF A;  5KJV A;  1PD5 A;  1EAB A;  1XMD A;  2H3P A;  2RKV A;  3L60 A;  4G0B A;  5FAL A;  5KJT A;  1T1U A;  3B30 A;  1QCA A;  1XL8 A;  2JGP A;  1EAA A;  3B2S A;  1DPB A;  1DPD A;  2H4T A;  1EAC A;  2E1V A;  2E1T A;  1T7N A;  2ZBA A;  3FOT A;  1CIA A;  1Q9J A;  2II3 A;  2H3W A;  4JN5 A;  4G2M A;  2I9D A;  2FY3 A;  5FAN A;  5DUA A;  1L5A A;  2RKT A;  5KJU A;  1T7O A;  1NDI A;  1C4T A;  1SCZ A;  4KEC A;  4CLA A;  1T7Q A;  4KE4 A;  2II5 A;  2DEB A;  1NM8 A;  5KJW A;  2IHW A;  2FY4 A;  2XHG A;  3FP0 A;  3U9B A;  2CLA A;  2H3U A;  1XMC A;  3U9F A;  1NDB A;  2FYO A;  1XL7 A;  1EAD A;  1NOC B;  4G22 A;  4JN3 A;  4EYW A;  1DPC A;  5KJS A;  4HVM A;  2BGH A;  1Q6X A;  4EP9 A;  3MAE A;  1E2O A;  2FY5 A;  4EPH A;  2RCU A; 
#chains in the Genus database with same CATH homology
 2FY2 A;  2FY4 A;  5DU9 A;  2H4T A;  2XHG A;  3FP0 A;  2VSQ A;  2FY3 A;  2FW3 A;  5DUA A;  5T3E A;  2H3U A;  1S5O A;  1L5A A;  2FYO A;  1T7O A;  1NDI A;  1T7N A;  1NDF A;  1T7Q A;  2H3P A;  4JN3 A;  3FOT A;  4EYW A;  4HVM A;  1Q9J A;  1T1U A;  2RCU A;  1Q6X A;  4EP9 A;  2DEB A;  1NM8 A;  2JGP A;  2H3W A;  4JN5 A;  2FY5 A;  4EPH A;  1NDB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...