1Q6XA

Crystal structure of rat choline acetyltransferase
Total Genus 215
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
215
sequence length
600
structure length
600
Chain Sequence
WEELDLPKLPVPPLQQTLATYLQCMQHLVPEEQFRKSQAIVKRFGAPGGLGETLQEKLLERQEKTANWVSEYWLNDMYLNNRLALPVNSSPAVIFARQHFQDTNDQLRFAACLISGVLSYKTLLDSHSLPTDWAKGQLSGQPLCMKQYYRLFSSYRLPGHTQDTLVAQKSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAKARTVLLKDSTNRDSLDMIERCICLVCLDGPGTGELSDTHRALQLLHGGGCSLNGANRWYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHMMTSNKKLVRADSVSELPAPRRLRWKCSPETQGHLASSAEKLQRIVKNLDFIVYKFDNYGKTFIKKQKYSPDGFIQVALQLAYYRLYQRLVPTYESASIRRFQEGRVDNIRSATPEALAFVQAMTDHKAAMPASEKLQLLQTAMQAQTEYTVMAITGMAIDNHLLALRELARDLCKEPPEMFMDETYLMSNRFVLSTSQVPTTMEMFCCYGPVVPNGYGACYNPQPEAITFCISSFHSCKETSSVEFAEAVGASLVDMRDLCSSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords choline O-acetyltransferase
publication title Choline acetyltransferase structure reveals distribution of mutations that cause motor disorders.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 215
structure length 600
sequence length 600
chains with identical sequence B
ec nomenclature ec 2.3.1.6: Choline O-acetyltransferase.
pdb deposition date 2003-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00755 Carn_acyltransf Choline/Carnitine o-acyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.40 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol Acetyltransferase 1q6xA01
3.30.559.70 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol Acetyltransferase 1q6xA02
2FYOA 2FY3A 2H3WA 4EP9A 1T7NA 2FY4A 2H4TA 4EYWA 1T7QA 2FW3A 2DEBA 1NM8A 4EPHA 1T7OA 1T1UA 1Q6XA 2RCUA 1S5OA 1NDIA 2FY2A 2H3PA 2FY5A 1NDFA 1NDBA 2H3UA
chains in the Genus database with same CATH superfamily
1XL7A 1XMCA 3FP0A 3B30A 1NOCB 1E2OA 2BGHA 1SCZA 2JGPA 1CLAA 1EADA 5T3EA 2XR7A 4G0BA 2FY2A 1Q23A 1DPCA 3MAEA 2CLAA 1NDBA 2RKVA 4CLAA 2FYOA 3B2SA 2II5A 4EYWA 1T7QA 2E1VA 1NM8A 1DPDA 1XL8A 4KECA 4N72A 4G22A 1Q6XA 2RCUA 5KJUA 2E1TA 5FALA 2I9DA 1DPBA 1PD5A 3L60A 1EAFA 4KE4A 5KJVA 5KJWA 4EP9A 1T7NA 1CIAA 1XMDA 2H4TA 2II4A 3U9FA 4JN3A 1EABA 3U9BA 5KJSA 2RKTA 3CLAA 3FOTA 1C4TA 1QCAA 4HVMA 1EAEA 1T7OA 2XHGA 1L5AA 5KJTA 1NDFA 2II3A 2E1UA 2H3UA 2FY3A 2H3WA 5FANA 5DUAA 4G2MA 2FY4A 2ZBAA 2FW3A 2DEBA 1EAAA 2IHWA 4EPHA 4JN5A 1EACA 1T1UA 1Q9JA 1S5OA 5DU9A 2VSQA 1NDIA 2H3PA 2FY5A
chains in the Genus database with same CATH topology
2FYOA 2FY3A 3FP0A 2H3WA 5DUAA 4EP9A 1T7NA 2FY4A 2H4TA 4EYWA 1T7QA 2FW3A 2DEBA 4JN3A 2JGPA 1NM8A 3FOTA 4EPHA 4JN5A 5T3EA 4HVMA 1T7OA 1T1UA 1Q6XA 2RCUA 1Q9JA 1S5OA 5DU9A 2XHGA 2VSQA 1NDIA 1L5AA 2FY2A 2H3PA 2FY5A 1NDFA 1NDBA 2H3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYO A;  2FY3 A;  2H3W A;  4EP9 A;  1T7N A;  2FY4 A;  2H4T A;  4EYW A;  1T7Q A;  2FW3 A;  2DEB A;  1NM8 A;  4EPH A;  1T7O A;  1T1U A;  1Q6X A;  2RCU A;  1S5O A;  1NDI A;  2FY2 A;  2H3P A;  2FY5 A;  1NDF A;  1NDB A;  2H3U A; 
#chains in the Genus database with same CATH topology
 1XL7 A;  1XMC A;  3FP0 A;  3B30 A;  1NOC B;  1E2O A;  2BGH A;  1SCZ A;  2JGP A;  1CLA A;  1EAD A;  5T3E A;  2XR7 A;  4G0B A;  2FY2 A;  1Q23 A;  1DPC A;  3MAE A;  2CLA A;  1NDB A;  2RKV A;  4CLA A;  2FYO A;  3B2S A;  2II5 A;  4EYW A;  1T7Q A;  2E1V A;  1NM8 A;  1DPD A;  1XL8 A;  4KEC A;  4N72 A;  4G22 A;  1Q6X A;  2RCU A;  5KJU A;  2E1T A;  5FAL A;  2I9D A;  1DPB A;  1PD5 A;  3L60 A;  1EAF A;  4KE4 A;  5KJV A;  5KJW A;  4EP9 A;  1T7N A;  1CIA A;  1XMD A;  2H4T A;  2II4 A;  3U9F A;  4JN3 A;  1EAB A;  3U9B A;  5KJS A;  2RKT A;  3CLA A;  3FOT A;  1C4T A;  1QCA A;  4HVM A;  1EAE A;  1T7O A;  2XHG A;  1L5A A;  5KJT A;  1NDF A;  2II3 A;  2E1U A;  2H3U A;  2FY3 A;  2H3W A;  5FAN A;  5DUA A;  4G2M A;  2FY4 A;  2ZBA A;  2FW3 A;  2DEB A;  1EAA A;  2IHW A;  4EPH A;  4JN5 A;  1EAC A;  1T1U A;  1Q9J A;  1S5O A;  5DU9 A;  2VSQ A;  1NDI A;  2H3P A;  2FY5 A; 
#chains in the Genus database with same CATH homology
 2FYO A;  2FY3 A;  3FP0 A;  2H3W A;  5DUA A;  4EP9 A;  1T7N A;  2FY4 A;  2H4T A;  4EYW A;  1T7Q A;  2FW3 A;  2DEB A;  4JN3 A;  2JGP A;  1NM8 A;  3FOT A;  4EPH A;  4JN5 A;  5T3E A;  4HVM A;  1T7O A;  1T1U A;  1Q6X A;  2RCU A;  1Q9J A;  1S5O A;  5DU9 A;  2XHG A;  2VSQ A;  1NDI A;  1L5A A;  2FY2 A;  2H3P A;  2FY5 A;  1NDF A;  1NDB A;  2H3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...