1NOCB

Murine inducible nitric oxide synthase oxygenase domain (delta 114) complexed with type i e. coli chloramphenicol acetyl transferase and imidazole
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
213
structure length
213
Chain Sequence
ITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFLKTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSSLWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANMDNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (oxidoreductase/transferase)
molecule keywords INDUCIBLE NITRIC OXIDE SYNTHASE
publication title The structure of nitric oxide synthase oxygenase domain and inhibitor complexes.
pubmed doi rcsb
source organism Mus musculus
total genus 45
structure length 213
sequence length 213
ec nomenclature ec 2.3.1.28: Chloramphenicol O-acetyltransferase.
pdb deposition date 1997-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00302 CAT Chloramphenicol acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1nocB00
2RKTA 4JN5A 1DPDA 3L60A 4KECA 1XL7A 1NOCB 2VSQA 4G0BA 1PD5A 2RKVA 3FP0A 2II5A 1EABA 2II4A 5FALA 3MAEA 1EACA 3CLAA 4JN3A 1XMDA 2I9DA 2XHGA 4G22A 3B2SA 5T3EA 5KJWA 1CIAA 1EAEA 5FANA 3U9BA 5KJTA 4G2MA 5DU9A 1XMCA 1EAFA 2BGHA 3FOTA 4KE4A 1DPCA 5KJSA 2JGPA 1C4TA 2E1VA 5KJUA 4CLAA 2ZBAA 1CLAA 1E2OA 1SCZA 3B30A 1XL8A 3U9FA 1Q23A 5KJVA 2E1UA 4N72A 1DPBA 2II3A 2XR7A 1EAAA 1EADA 2IHWA 2CLAA 1QCAA 1Q9JA 2E1TA 1L5AA 5DUAA 4HVMA
chains in the Genus database with same CATH superfamily
1XL7A 1NOCB 4G0BA 4G22A 3B2SA 1CIAA 5FANA 5KJTA 5KJSA 1EAFA 1DPCA 2JGPA 3B30A 3U9FA 1Q23A 2FW3A 1EAAA 2IHWA 1Q9JA 2E1TA 4JN5A 4KECA 1PD5A 2RKVA 1EABA 2II4A 1NM8A 1EACA 2FY3A 5T3EA 1EAEA 4G2MA 1T7NA 1XMCA 1C4TA 1CLAA 1E2OA 2RCUA 1S5OA 5KJVA 4N72A 2FY4A 2FY2A 1EADA 1L5AA 5DUAA 1NDBA 2FY5A 2H4TA 1DPDA 4EYWA 3FP0A 5FALA 1NDFA 5KJWA 2H3PA 2BGHA 4KE4A 2E1VA 1T1UA 5KJUA 4CLAA 1Q6XA 1XL8A 2E1UA 1QCAA 1NDIA 2RKTA 5DU9A 3L60A 2VSQA 1T7QA 2II5A 3MAEA 3CLAA 4JN3A 1XMDA 2I9DA 2XHGA 2H3UA 2DEBA 3U9BA 3FOTA 1T7OA 2ZBAA 1SCZA 4EP9A 2FYOA 1DPBA 2II3A 2H3WA 2XR7A 4EPHA 2CLAA 4HVMA
chains in the Genus database with same CATH topology
2RKTA 4JN5A 1DPDA 3L60A 4KECA 1XL7A 1NOCB 2VSQA 4G0BA 1PD5A 2RKVA 3FP0A 2II5A 1EABA 2II4A 5FALA 3MAEA 1EACA 3CLAA 4JN3A 1XMDA 2I9DA 2XHGA 4G22A 3B2SA 5T3EA 5KJWA 1CIAA 1EAEA 5FANA 3U9BA 5KJTA 4G2MA 5DU9A 1XMCA 1EAFA 2BGHA 3FOTA 4KE4A 1DPCA 5KJSA 2JGPA 1C4TA 2E1VA 5KJUA 4CLAA 2ZBAA 1CLAA 1E2OA 1SCZA 3B30A 1XL8A 3U9FA 1Q23A 5KJVA 2E1UA 4N72A 1DPBA 2II3A 2XR7A 1EAAA 1EADA 2IHWA 2CLAA 1QCAA 1Q9JA 2E1TA 1L5AA 5DUAA 4HVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RKT A;  4JN5 A;  1DPD A;  3L60 A;  4KEC A;  1XL7 A;  1NOC B;  2VSQ A;  4G0B A;  1PD5 A;  2RKV A;  3FP0 A;  2II5 A;  1EAB A;  2II4 A;  5FAL A;  3MAE A;  1EAC A;  3CLA A;  4JN3 A;  1XMD A;  2I9D A;  2XHG A;  4G22 A;  3B2S A;  5T3E A;  5KJW A;  1CIA A;  1EAE A;  5FAN A;  3U9B A;  5KJT A;  4G2M A;  5DU9 A;  1XMC A;  1EAF A;  2BGH A;  3FOT A;  4KE4 A;  1DPC A;  5KJS A;  2JGP A;  1C4T A;  2E1V A;  5KJU A;  4CLA A;  2ZBA A;  1CLA A;  1E2O A;  1SCZ A;  3B30 A;  1XL8 A;  3U9F A;  1Q23 A;  5KJV A;  2E1U A;  4N72 A;  1DPB A;  2II3 A;  2XR7 A;  1EAA A;  1EAD A;  2IHW A;  2CLA A;  1QCA A;  1Q9J A;  2E1T A;  1L5A A;  5DUA A;  4HVM A; 
#chains in the Genus database with same CATH topology
 1XL7 A;  1NOC B;  4G0B A;  4G22 A;  3B2S A;  1CIA A;  5FAN A;  5KJT A;  5KJS A;  1EAF A;  1DPC A;  2JGP A;  3B30 A;  3U9F A;  1Q23 A;  2FW3 A;  1EAA A;  2IHW A;  1Q9J A;  2E1T A;  4JN5 A;  4KEC A;  1PD5 A;  2RKV A;  1EAB A;  2II4 A;  1NM8 A;  1EAC A;  2FY3 A;  5T3E A;  1EAE A;  4G2M A;  1T7N A;  1XMC A;  1C4T A;  1CLA A;  1E2O A;  2RCU A;  1S5O A;  5KJV A;  4N72 A;  2FY4 A;  2FY2 A;  1EAD A;  1L5A A;  5DUA A;  1NDB A;  2FY5 A;  2H4T A;  1DPD A;  4EYW A;  3FP0 A;  5FAL A;  1NDF A;  5KJW A;  2H3P A;  2BGH A;  4KE4 A;  2E1V A;  1T1U A;  5KJU A;  4CLA A;  1Q6X A;  1XL8 A;  2E1U A;  1QCA A;  1NDI A;  2RKT A;  5DU9 A;  3L60 A;  2VSQ A;  1T7Q A;  2II5 A;  3MAE A;  3CLA A;  4JN3 A;  1XMD A;  2I9D A;  2XHG A;  2H3U A;  2DEB A;  3U9B A;  3FOT A;  1T7O A;  2ZBA A;  1SCZ A;  4EP9 A;  2FYO A;  1DPB A;  2II3 A;  2H3W A;  2XR7 A;  4EPH A;  2CLA A;  4HVM A; 
#chains in the Genus database with same CATH homology
 2RKT A;  4JN5 A;  1DPD A;  3L60 A;  4KEC A;  1XL7 A;  1NOC B;  2VSQ A;  4G0B A;  1PD5 A;  2RKV A;  3FP0 A;  2II5 A;  1EAB A;  2II4 A;  5FAL A;  3MAE A;  1EAC A;  3CLA A;  4JN3 A;  1XMD A;  2I9D A;  2XHG A;  4G22 A;  3B2S A;  5T3E A;  5KJW A;  1CIA A;  1EAE A;  5FAN A;  3U9B A;  5KJT A;  4G2M A;  5DU9 A;  1XMC A;  1EAF A;  2BGH A;  3FOT A;  4KE4 A;  1DPC A;  5KJS A;  2JGP A;  1C4T A;  2E1V A;  5KJU A;  4CLA A;  2ZBA A;  1CLA A;  1E2O A;  1SCZ A;  3B30 A;  1XL8 A;  3U9F A;  1Q23 A;  5KJV A;  2E1U A;  4N72 A;  1DPB A;  2II3 A;  2XR7 A;  1EAA A;  1EAD A;  2IHW A;  2CLA A;  1QCA A;  1Q9J A;  2E1T A;  1L5A A;  5DUA A;  4HVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...