1NOCB

Murine inducible nitric oxide synthase oxygenase domain (delta 114) complexed with type i e. coli chloramphenicol acetyl transferase and imidazole
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
213
structure length
213
Chain Sequence
ITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFLKTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSSLWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANMDNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INDUCIBLE NITRIC OXIDE SYNTHASE
publication title The structure of nitric oxide synthase oxygenase domain and inhibitor complexes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (oxidoreductase/transferase)
total genus 45
structure length 213
sequence length 213
ec nomenclature ec 2.3.1.28: Chloramphenicol O-acetyltransferase.
pdb deposition date 1997-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00302 CAT Chloramphenicol acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1nocB00
2JGPA 4G22A 1EAEA 2E1UA 2E1VA 1QCAA 2II5A 2VSQA 1XMDA 4JN5A 5DU9A 3U9BA 3FOTA 4N72A 2RKVA 1CIAA 3B30A 1XMCA 1EADA 2E1TA 3CLAA 5FANA 5KJTA 1EAFA 2CLAA 1DPDA 3U9FA 3FP0A 5FALA 1EAAA 3MAEA 2XR7A 1E2OA 1PD5A 1EACA 5DUAA 4HVMA 2BGHA 4KE4A 1CLAA 2I9DA 5T3EA 4G2MA 4CLAA 5KJVA 1SCZA 3L60A 4G0BA 1Q9JA 2RKTA 1XL7A 2II3A 1C4TA 2II4A 1Q23A 1EABA 3B2SA 4KECA 5KJSA 5KJUA 1DPBA 1XL8A 1L5AA 5KJWA 1DPCA 2IHWA 2XHGA 1NOCB 2ZBAA 4JN3A
chains in the Genus database with same CATH superfamily
1EAEA 1XMDA 4N72A 1CIAA 4EYWA 5FANA 2FY2A 1DPDA 2XR7A 1E2OA 1PD5A 1EACA 2I9DA 4CLAA 1NDBA 1SCZA 2H3WA 1Q9JA 1C4TA 2FY5A 4EP9A 1T7NA 1DPCA 1Q6XA 4G22A 4JN5A 1NDIA 1XMCA 3CLAA 5KJTA 1NDFA 2CLAA 5FALA 3FP0A 1EAAA 4KE4A 4G0BA 1T7QA 2H3UA 2II3A 1EABA 2H3PA 1DPBA 5KJWA 2XHGA 2ZBAA 2E1UA 2E1VA 2VSQA 3U9BA 2H4TA 3FOTA 1NM8A 1T7OA 2RCUA 3U9FA 2DEBA 5DUAA 2FY4A 5T3EA 4G2MA 5KJVA 3L60A 4EPHA 2RKTA 1T1UA 2FYOA 2FY3A 5KJUA 1XL8A 1S5OA 1NOCB 4JN3A 2JGPA 2II5A 1QCAA 5DU9A 2RKVA 3B30A 1EADA 2E1TA 1EAFA 3MAEA 4HVMA 2BGHA 1CLAA 1XL7A 2FW3A 2II4A 1Q23A 5KJSA 3B2SA 1L5AA 2IHWA 4KECA
chains in the Genus database with same CATH topology
2JGPA 4G22A 1EAEA 2E1UA 2E1VA 1QCAA 2II5A 2VSQA 1XMDA 4JN5A 5DU9A 3U9BA 3FOTA 4N72A 2RKVA 1CIAA 3B30A 1XMCA 1EADA 2E1TA 3CLAA 5FANA 5KJTA 1EAFA 2CLAA 1DPDA 3U9FA 3FP0A 5FALA 1EAAA 3MAEA 2XR7A 1E2OA 1PD5A 1EACA 5DUAA 4HVMA 2BGHA 4KE4A 1CLAA 2I9DA 5T3EA 4G2MA 4CLAA 5KJVA 1SCZA 3L60A 4G0BA 1Q9JA 2RKTA 1XL7A 2II3A 1C4TA 2II4A 1Q23A 1EABA 3B2SA 4KECA 5KJSA 5KJUA 1DPBA 1XL8A 1L5AA 5KJWA 1DPCA 2IHWA 2XHGA 1NOCB 2ZBAA 4JN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JGP A;  4G22 A;  1EAE A;  2E1U A;  2E1V A;  1QCA A;  2II5 A;  2VSQ A;  1XMD A;  4JN5 A;  5DU9 A;  3U9B A;  3FOT A;  4N72 A;  2RKV A;  1CIA A;  3B30 A;  1XMC A;  1EAD A;  2E1T A;  3CLA A;  5FAN A;  5KJT A;  1EAF A;  2CLA A;  1DPD A;  3U9F A;  3FP0 A;  5FAL A;  1EAA A;  3MAE A;  2XR7 A;  1E2O A;  1PD5 A;  1EAC A;  5DUA A;  4HVM A;  2BGH A;  4KE4 A;  1CLA A;  2I9D A;  5T3E A;  4G2M A;  4CLA A;  5KJV A;  1SCZ A;  3L60 A;  4G0B A;  1Q9J A;  2RKT A;  1XL7 A;  2II3 A;  1C4T A;  2II4 A;  1Q23 A;  1EAB A;  3B2S A;  4KEC A;  5KJS A;  5KJU A;  1DPB A;  1XL8 A;  1L5A A;  5KJW A;  1DPC A;  2IHW A;  2XHG A;  1NOC B;  2ZBA A;  4JN3 A; 
#chains in the Genus database with same CATH topology
 1EAE A;  1XMD A;  4N72 A;  1CIA A;  4EYW A;  5FAN A;  2FY2 A;  1DPD A;  2XR7 A;  1E2O A;  1PD5 A;  1EAC A;  2I9D A;  4CLA A;  1NDB A;  1SCZ A;  2H3W A;  1Q9J A;  1C4T A;  2FY5 A;  4EP9 A;  1T7N A;  1DPC A;  1Q6X A;  4G22 A;  4JN5 A;  1NDI A;  1XMC A;  3CLA A;  5KJT A;  1NDF A;  2CLA A;  5FAL A;  3FP0 A;  1EAA A;  4KE4 A;  4G0B A;  1T7Q A;  2H3U A;  2II3 A;  1EAB A;  2H3P A;  1DPB A;  5KJW A;  2XHG A;  2ZBA A;  2E1U A;  2E1V A;  2VSQ A;  3U9B A;  2H4T A;  3FOT A;  1NM8 A;  1T7O A;  2RCU A;  3U9F A;  2DEB A;  5DUA A;  2FY4 A;  5T3E A;  4G2M A;  5KJV A;  3L60 A;  4EPH A;  2RKT A;  1T1U A;  2FYO A;  2FY3 A;  5KJU A;  1XL8 A;  1S5O A;  1NOC B;  4JN3 A;  2JGP A;  2II5 A;  1QCA A;  5DU9 A;  2RKV A;  3B30 A;  1EAD A;  2E1T A;  1EAF A;  3MAE A;  4HVM A;  2BGH A;  1CLA A;  1XL7 A;  2FW3 A;  2II4 A;  1Q23 A;  5KJS A;  3B2S A;  1L5A A;  2IHW A;  4KEC A; 
#chains in the Genus database with same CATH homology
 2JGP A;  4G22 A;  1EAE A;  2E1U A;  2E1V A;  1QCA A;  2II5 A;  2VSQ A;  1XMD A;  4JN5 A;  5DU9 A;  3U9B A;  3FOT A;  4N72 A;  2RKV A;  1CIA A;  3B30 A;  1XMC A;  1EAD A;  2E1T A;  3CLA A;  5FAN A;  5KJT A;  1EAF A;  2CLA A;  1DPD A;  3U9F A;  3FP0 A;  5FAL A;  1EAA A;  3MAE A;  2XR7 A;  1E2O A;  1PD5 A;  1EAC A;  5DUA A;  4HVM A;  2BGH A;  4KE4 A;  1CLA A;  2I9D A;  5T3E A;  4G2M A;  4CLA A;  5KJV A;  1SCZ A;  3L60 A;  4G0B A;  1Q9J A;  2RKT A;  1XL7 A;  2II3 A;  1C4T A;  2II4 A;  1Q23 A;  1EAB A;  3B2S A;  4KEC A;  5KJS A;  5KJU A;  1DPB A;  1XL8 A;  1L5A A;  5KJW A;  1DPC A;  2IHW A;  2XHG A;  1NOC B;  2ZBA A;  4JN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...