1NOCB

Murine inducible nitric oxide synthase oxygenase domain (delta 114) complexed with type i e. coli chloramphenicol acetyl transferase and imidazole
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
213
structure length
213
Chain Sequence
ITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFLKTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSSLWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANMDNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INDUCIBLE NITRIC OXIDE SYNTHASE
publication title The structure of nitric oxide synthase oxygenase domain and inhibitor complexes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (oxidoreductase/transferase)
total genus 45
structure length 213
sequence length 213
ec nomenclature ec 2.3.1.28: Chloramphenicol O-acetyltransferase.
pdb deposition date 1997-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00302 CAT Chloramphenicol acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1nocB00
2IHWA 1XL7A 3FP0A 1CLAA 2II5A 2II3A 5KJSA 2JGPA 2II4A 5DUAA 1L5AA 2XR7A 1EAEA 1EACA 2E1TA 2I9DA 3L60A 4HVMA 1EAFA 3CLAA 4G2MA 1Q23A 3MAEA 2E1UA 2XHGA 1SCZA 1C4TA 4N72A 3FOTA 4JN5A 1DPCA 1EABA 1PD5A 2E1VA 3U9BA 5KJUA 5KJTA 2BGHA 2VSQA 1NOCB 4KECA 4G22A 4G0BA 2ZBAA 5KJWA 5T3EA 1DPDA 5KJVA 1QCAA 2RKTA 4KE4A 4CLAA 4JN3A 2RKVA 1DPBA 1EADA 5FANA 1E2OA 2CLAA 1CIAA 1XMDA 5DU9A 3U9FA 5FALA 1Q9JA 1XL8A 3B30A 1EAAA 3B2SA 1XMCA
chains in the Genus database with same CATH superfamily
1XL7A 2II5A 2H4TA 3L60A 1EAFA 3MAEA 2E1UA 2XHGA 4N72A 3FOTA 1EABA 2E1VA 5KJTA 4EP9A 2FY3A 2H3UA 5T3EA 1QCAA 4KE4A 1EADA 1T7NA 1T7OA 2CLAA 1CIAA 5FALA 3U9FA 1Q9JA 5FANA 3B2SA 1T1UA 2IHWA 3FP0A 1S5OA 2DEBA 1Q6XA 1EAEA 1EACA 2E1TA 2FY5A 4G2MA 1SCZA 1NDIA 2H3WA 2RCUA 3U9BA 5KJUA 2BGHA 4EPHA 1NOCB 2FY2A 5KJWA 1DPBA 5DU9A 1XL8A 2FYOA 1EAAA 2FW3A 4EYWA 1CLAA 5KJSA 2JGPA 2II4A 1L5AA 2XR7A 2H3PA 4HVMA 2I9DA 3CLAA 1C4TA 1NDBA 4G22A 4G0BA 1DPDA 2FY4A 4JN3A 2RKVA 1XMDA 3B30A 1XMCA 5KJVA 2II3A 5DUAA 1Q23A 4JN5A 1DPCA 1PD5A 2VSQA 1T7QA 1NDFA 4KECA 2ZBAA 2RKTA 4CLAA 1NM8A 1E2OA
chains in the Genus database with same CATH topology
2IHWA 1XL7A 3FP0A 1CLAA 2II5A 2II3A 5KJSA 2JGPA 2II4A 5DUAA 1L5AA 2XR7A 1EAEA 1EACA 2E1TA 2I9DA 3L60A 4HVMA 1EAFA 3CLAA 4G2MA 1Q23A 3MAEA 2E1UA 2XHGA 1SCZA 1C4TA 4N72A 3FOTA 4JN5A 1DPCA 1EABA 1PD5A 2E1VA 3U9BA 5KJUA 5KJTA 2BGHA 2VSQA 1NOCB 4KECA 4G22A 4G0BA 2ZBAA 5KJWA 5T3EA 1DPDA 5KJVA 1QCAA 2RKTA 4KE4A 4CLAA 4JN3A 2RKVA 1DPBA 1EADA 5FANA 1E2OA 2CLAA 1CIAA 1XMDA 5DU9A 3U9FA 5FALA 1Q9JA 1XL8A 3B30A 1EAAA 3B2SA 1XMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IHW A;  1XL7 A;  3FP0 A;  1CLA A;  2II5 A;  2II3 A;  5KJS A;  2JGP A;  2II4 A;  5DUA A;  1L5A A;  2XR7 A;  1EAE A;  1EAC A;  2E1T A;  2I9D A;  3L60 A;  4HVM A;  1EAF A;  3CLA A;  4G2M A;  1Q23 A;  3MAE A;  2E1U A;  2XHG A;  1SCZ A;  1C4T A;  4N72 A;  3FOT A;  4JN5 A;  1DPC A;  1EAB A;  1PD5 A;  2E1V A;  3U9B A;  5KJU A;  5KJT A;  2BGH A;  2VSQ A;  1NOC B;  4KEC A;  4G22 A;  4G0B A;  2ZBA A;  5KJW A;  5T3E A;  1DPD A;  5KJV A;  1QCA A;  2RKT A;  4KE4 A;  4CLA A;  4JN3 A;  2RKV A;  1DPB A;  1EAD A;  5FAN A;  1E2O A;  2CLA A;  1CIA A;  1XMD A;  5DU9 A;  3U9F A;  5FAL A;  1Q9J A;  1XL8 A;  3B30 A;  1EAA A;  3B2S A;  1XMC A; 
#chains in the Genus database with same CATH topology
 1XL7 A;  2II5 A;  2H4T A;  3L60 A;  1EAF A;  3MAE A;  2E1U A;  2XHG A;  4N72 A;  3FOT A;  1EAB A;  2E1V A;  5KJT A;  4EP9 A;  2FY3 A;  2H3U A;  5T3E A;  1QCA A;  4KE4 A;  1EAD A;  1T7N A;  1T7O A;  2CLA A;  1CIA A;  5FAL A;  3U9F A;  1Q9J A;  5FAN A;  3B2S A;  1T1U A;  2IHW A;  3FP0 A;  1S5O A;  2DEB A;  1Q6X A;  1EAE A;  1EAC A;  2E1T A;  2FY5 A;  4G2M A;  1SCZ A;  1NDI A;  2H3W A;  2RCU A;  3U9B A;  5KJU A;  2BGH A;  4EPH A;  1NOC B;  2FY2 A;  5KJW A;  1DPB A;  5DU9 A;  1XL8 A;  2FYO A;  1EAA A;  2FW3 A;  4EYW A;  1CLA A;  5KJS A;  2JGP A;  2II4 A;  1L5A A;  2XR7 A;  2H3P A;  4HVM A;  2I9D A;  3CLA A;  1C4T A;  1NDB A;  4G22 A;  4G0B A;  1DPD A;  2FY4 A;  4JN3 A;  2RKV A;  1XMD A;  3B30 A;  1XMC A;  5KJV A;  2II3 A;  5DUA A;  1Q23 A;  4JN5 A;  1DPC A;  1PD5 A;  2VSQ A;  1T7Q A;  1NDF A;  4KEC A;  2ZBA A;  2RKT A;  4CLA A;  1NM8 A;  1E2O A; 
#chains in the Genus database with same CATH homology
 2IHW A;  1XL7 A;  3FP0 A;  1CLA A;  2II5 A;  2II3 A;  5KJS A;  2JGP A;  2II4 A;  5DUA A;  1L5A A;  2XR7 A;  1EAE A;  1EAC A;  2E1T A;  2I9D A;  3L60 A;  4HVM A;  1EAF A;  3CLA A;  4G2M A;  1Q23 A;  3MAE A;  2E1U A;  2XHG A;  1SCZ A;  1C4T A;  4N72 A;  3FOT A;  4JN5 A;  1DPC A;  1EAB A;  1PD5 A;  2E1V A;  3U9B A;  5KJU A;  5KJT A;  2BGH A;  2VSQ A;  1NOC B;  4KEC A;  4G22 A;  4G0B A;  2ZBA A;  5KJW A;  5T3E A;  1DPD A;  5KJV A;  1QCA A;  2RKT A;  4KE4 A;  4CLA A;  4JN3 A;  2RKV A;  1DPB A;  1EAD A;  5FAN A;  1E2O A;  2CLA A;  1CIA A;  1XMD A;  5DU9 A;  3U9F A;  5FAL A;  1Q9J A;  1XL8 A;  3B30 A;  1EAA A;  3B2S A;  1XMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...