1Q23A

Crystal structure of chloramphenicol acetyltransferase i complexed with fusidic acid at 2.18 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
214
structure length
214
Chain Sequence
b'ITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFLKTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSSLWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANMDNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chloramphenicol acetyltransferase
publication title Crystal structure of Chloramphenicol acetyltransferase I in the apoenzyme form and complexed with fusidic acid at 2.18 A resolution
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 63
structure length 214
sequence length 214
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.3.1.28: Chloramphenicol O-acetyltransferase.
pdb deposition date 2003-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00302 CAT Chloramphenicol acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1q23A00
2XR7A 4KE4A 1EADA 2XHGA 4N72A 3B30A 5KJUA 5KJTA 5FANA 5KJSA 1EAAA 3U9BA 5FALA 4CLAA 1CLAA 1CIAA 2BGHA 2CLAA 2IHWA 1Q23A 2II4A 3CLAA 4G0BA 5DUAA 1EABA 2ZBAA 5KJWA 1C4TA 3B2SA 5KJVA 1DPBA 2E1UA 1QCAA 4HVMA 4JN5A 4JN3A 2RKTA 4KECA 1EAEA 5DU9A 1DPDA 1E2OA 1PD5A 3FOTA 2II3A 1NOCB 3U9FA 1DPCA 1XL8A 1XMCA 2JGPA 2E1TA 4G2MA 3L60A 3MAEA 4G22A 2II5A 1XMDA 1SCZA 2RKVA 1EACA 2VSQA 2E1VA 1XL7A 5T3EA 1L5AA 2I9DA 3FP0A 1EAFA 1Q9JA
chains in the Genus database with same CATH superfamily
2XR7A 1NDFA 4N72A 5FANA 1EAAA 4CLAA 1CLAA 4EPHA 2BGHA 2IHWA 2II4A 5KJWA 2ZBAA 2FY5A 2E1UA 1EAEA 2H3WA 1PD5A 3FOTA 2II3A 1XL8A 1XMCA 4G2MA 2FY2A 4G22A 2II5A 1T7NA 2I9DA 2FW3A 1EADA 2XHGA 2CLAA 1Q23A 2H4TA 1QCAA 4JN3A 1T1UA 4KECA 2H3PA 3L60A 1XMDA 2VSQA 2E1VA 1NDIA 5T3EA 1L5AA 3FP0A 2FYOA 1Q9JA 4KE4A 4EYWA 3B30A 5KJSA 3U9BA 2RCUA 2FY4A 1Q6XA 1NDBA 3CLAA 5DUAA 2H3UA 3B2SA 5KJVA 4HVMA 5DU9A 1DPDA 3U9FA 1DPCA 2E1TA 1SCZA 2RKVA 2FY3A 5KJUA 5KJTA 5FALA 1S5OA 1CIAA 1T7OA 4G0BA 1EABA 1C4TA 1DPBA 4JN5A 2RKTA 1E2OA 1NOCB 2DEBA 2JGPA 1T7QA 3MAEA 4EP9A 1NM8A 1EACA 1XL7A 1EAFA
chains in the Genus database with same CATH topology
2XR7A 4KE4A 1EADA 2XHGA 4N72A 3B30A 5KJUA 5KJTA 5FANA 5KJSA 1EAAA 3U9BA 5FALA 4CLAA 1CLAA 1CIAA 2BGHA 2CLAA 2IHWA 1Q23A 2II4A 3CLAA 4G0BA 5DUAA 1EABA 2ZBAA 5KJWA 1C4TA 3B2SA 5KJVA 1DPBA 2E1UA 1QCAA 4HVMA 4JN5A 4JN3A 2RKTA 4KECA 1EAEA 5DU9A 1DPDA 1E2OA 1PD5A 3FOTA 2II3A 1NOCB 3U9FA 1DPCA 1XL8A 1XMCA 2JGPA 2E1TA 4G2MA 3L60A 3MAEA 4G22A 2II5A 1XMDA 1SCZA 2RKVA 1EACA 2VSQA 2E1VA 1XL7A 5T3EA 1L5AA 2I9DA 3FP0A 1EAFA 1Q9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XR7 A;  4KE4 A;  1EAD A;  2XHG A;  4N72 A;  3B30 A;  5KJU A;  5KJT A;  5FAN A;  5KJS A;  1EAA A;  3U9B A;  5FAL A;  4CLA A;  1CLA A;  1CIA A;  2BGH A;  2CLA A;  2IHW A;  1Q23 A;  2II4 A;  3CLA A;  4G0B A;  5DUA A;  1EAB A;  2ZBA A;  5KJW A;  1C4T A;  3B2S A;  5KJV A;  1DPB A;  2E1U A;  1QCA A;  4HVM A;  4JN5 A;  4JN3 A;  2RKT A;  4KEC A;  1EAE A;  5DU9 A;  1DPD A;  1E2O A;  1PD5 A;  3FOT A;  2II3 A;  1NOC B;  3U9F A;  1DPC A;  1XL8 A;  1XMC A;  2JGP A;  2E1T A;  4G2M A;  3L60 A;  3MAE A;  4G22 A;  2II5 A;  1XMD A;  1SCZ A;  2RKV A;  1EAC A;  2VSQ A;  2E1V A;  1XL7 A;  5T3E A;  1L5A A;  2I9D A;  3FP0 A;  1EAF A;  1Q9J A; 
#chains in the Genus database with same CATH topology
 2XR7 A;  1NDF A;  4N72 A;  5FAN A;  1EAA A;  4CLA A;  1CLA A;  4EPH A;  2BGH A;  2IHW A;  2II4 A;  5KJW A;  2ZBA A;  2FY5 A;  2E1U A;  1EAE A;  2H3W A;  1PD5 A;  3FOT A;  2II3 A;  1XL8 A;  1XMC A;  4G2M A;  2FY2 A;  4G22 A;  2II5 A;  1T7N A;  2I9D A;  2FW3 A;  1EAD A;  2XHG A;  2CLA A;  1Q23 A;  2H4T A;  1QCA A;  4JN3 A;  1T1U A;  4KEC A;  2H3P A;  3L60 A;  1XMD A;  2VSQ A;  2E1V A;  1NDI A;  5T3E A;  1L5A A;  3FP0 A;  2FYO A;  1Q9J A;  4KE4 A;  4EYW A;  3B30 A;  5KJS A;  3U9B A;  2RCU A;  2FY4 A;  1Q6X A;  1NDB A;  3CLA A;  5DUA A;  2H3U A;  3B2S A;  5KJV A;  4HVM A;  5DU9 A;  1DPD A;  3U9F A;  1DPC A;  2E1T A;  1SCZ A;  2RKV A;  2FY3 A;  5KJU A;  5KJT A;  5FAL A;  1S5O A;  1CIA A;  1T7O A;  4G0B A;  1EAB A;  1C4T A;  1DPB A;  4JN5 A;  2RKT A;  1E2O A;  1NOC B;  2DEB A;  2JGP A;  1T7Q A;  3MAE A;  4EP9 A;  1NM8 A;  1EAC A;  1XL7 A;  1EAF A; 
#chains in the Genus database with same CATH homology
 2XR7 A;  4KE4 A;  1EAD A;  2XHG A;  4N72 A;  3B30 A;  5KJU A;  5KJT A;  5FAN A;  5KJS A;  1EAA A;  3U9B A;  5FAL A;  4CLA A;  1CLA A;  1CIA A;  2BGH A;  2CLA A;  2IHW A;  1Q23 A;  2II4 A;  3CLA A;  4G0B A;  5DUA A;  1EAB A;  2ZBA A;  5KJW A;  1C4T A;  3B2S A;  5KJV A;  1DPB A;  2E1U A;  1QCA A;  4HVM A;  4JN5 A;  4JN3 A;  2RKT A;  4KEC A;  1EAE A;  5DU9 A;  1DPD A;  1E2O A;  1PD5 A;  3FOT A;  2II3 A;  1NOC B;  3U9F A;  1DPC A;  1XL8 A;  1XMC A;  2JGP A;  2E1T A;  4G2M A;  3L60 A;  3MAE A;  4G22 A;  2II5 A;  1XMD A;  1SCZ A;  2RKV A;  1EAC A;  2VSQ A;  2E1V A;  1XL7 A;  5T3E A;  1L5A A;  2I9D A;  3FP0 A;  1EAF A;  1Q9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...