1Q23A

Crystal structure of chloramphenicol acetyltransferase i complexed with fusidic acid at 2.18 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
214
structure length
214
Chain Sequence
ITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFLKTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSSLWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANMDNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chloramphenicol acetyltransferase
publication title Crystal structure of Chloramphenicol acetyltransferase I in the apoenzyme form and complexed with fusidic acid at 2.18 A resolution
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 63
structure length 214
sequence length 214
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.3.1.28: Chloramphenicol O-acetyltransferase.
pdb deposition date 2003-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00302 CAT Chloramphenicol acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1q23A00
5DUAA 2II5A 1CIAA 1EAFA 2RKVA 4CLAA 1SCZA 1EAEA 2E1TA 2II4A 1XL7A 4G0BA 2RKTA 5DU9A 1EAAA 2BGHA 1DPDA 1DPBA 1Q23A 4JN5A 3L60A 3U9BA 3B2SA 1PD5A 1L5AA 1DPCA 2JGPA 1QCAA 3U9FA 1Q9JA 3FP0A 4KECA 1XMCA 1NOCB 4N72A 2E1UA 2II3A 2IHWA 3CLAA 2XHGA 2ZBAA 1C4TA 1XL8A 5T3EA 5FALA 4JN3A 2I9DA 1CLAA 3MAEA 2E1VA 5KJVA 2CLAA 3B30A 1XMDA 4G2MA 5KJWA 4HVMA 1EABA 2XR7A 2VSQA 1E2OA 5KJUA 4KE4A 5FANA 5KJSA 4G22A 1EACA 5KJTA 3FOTA 1EADA
chains in the Genus database with same CATH superfamily
2RKVA 1SCZA 1EAEA 2E1TA 4G0BA 1DPDA 4JN5A 1Q23A 2H3PA 3L60A 2FYOA 1DPCA 1Q9JA 1NDIA 3FP0A 1NOCB 2E1UA 2H3WA 3CLAA 2H3UA 1C4TA 5T3EA 4JN3A 3MAEA 2E1VA 2FY4A 4HVMA 2RCUA 2FW3A 1EACA 4CLAA 2II4A 2RKTA 1EAAA 2FY3A 3U9BA 1T7OA 2JGPA 4EPHA 3U9FA 4KECA 4EP9A 2IHWA 2I9DA 1CLAA 4G2MA 1EABA 2VSQA 1E2OA 5KJUA 5FANA 4G22A 5KJTA 1EADA 1CIAA 5DU9A 1XL7A 1NM8A 3B2SA 4EYWA 2FY5A 1QCAA 1XMCA 2II3A 2XHGA 5FALA 5KJVA 2CLAA 1XMDA 1Q6XA 2XR7A 1NDFA 4KE4A 5KJSA 1T7QA 5DUAA 2II5A 1EAFA 2FY2A 2BGHA 1DPBA 1PD5A 1L5AA 1T7NA 4N72A 2ZBAA 1NDBA 1XL8A 2DEBA 1T1UA 2H4TA 3B30A 5KJWA 1S5OA 3FOTA
chains in the Genus database with same CATH topology
5DUAA 2II5A 1CIAA 1EAFA 2RKVA 4CLAA 1SCZA 1EAEA 2E1TA 2II4A 1XL7A 4G0BA 2RKTA 5DU9A 1EAAA 2BGHA 1DPDA 1DPBA 1Q23A 4JN5A 3L60A 3U9BA 3B2SA 1PD5A 1L5AA 1DPCA 2JGPA 1QCAA 3U9FA 1Q9JA 3FP0A 4KECA 1XMCA 1NOCB 4N72A 2E1UA 2II3A 2IHWA 3CLAA 2XHGA 2ZBAA 1C4TA 1XL8A 5T3EA 5FALA 4JN3A 2I9DA 1CLAA 3MAEA 2E1VA 5KJVA 2CLAA 3B30A 1XMDA 4G2MA 5KJWA 4HVMA 1EABA 2XR7A 2VSQA 1E2OA 5KJUA 4KE4A 5FANA 5KJSA 4G22A 1EACA 5KJTA 3FOTA 1EADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DUA A;  2II5 A;  1CIA A;  1EAF A;  2RKV A;  4CLA A;  1SCZ A;  1EAE A;  2E1T A;  2II4 A;  1XL7 A;  4G0B A;  2RKT A;  5DU9 A;  1EAA A;  2BGH A;  1DPD A;  1DPB A;  1Q23 A;  4JN5 A;  3L60 A;  3U9B A;  3B2S A;  1PD5 A;  1L5A A;  1DPC A;  2JGP A;  1QCA A;  3U9F A;  1Q9J A;  3FP0 A;  4KEC A;  1XMC A;  1NOC B;  4N72 A;  2E1U A;  2II3 A;  2IHW A;  3CLA A;  2XHG A;  2ZBA A;  1C4T A;  1XL8 A;  5T3E A;  5FAL A;  4JN3 A;  2I9D A;  1CLA A;  3MAE A;  2E1V A;  5KJV A;  2CLA A;  3B30 A;  1XMD A;  4G2M A;  5KJW A;  4HVM A;  1EAB A;  2XR7 A;  2VSQ A;  1E2O A;  5KJU A;  4KE4 A;  5FAN A;  5KJS A;  4G22 A;  1EAC A;  5KJT A;  3FOT A;  1EAD A; 
#chains in the Genus database with same CATH topology
 2RKV A;  1SCZ A;  1EAE A;  2E1T A;  4G0B A;  1DPD A;  4JN5 A;  1Q23 A;  2H3P A;  3L60 A;  2FYO A;  1DPC A;  1Q9J A;  1NDI A;  3FP0 A;  1NOC B;  2E1U A;  2H3W A;  3CLA A;  2H3U A;  1C4T A;  5T3E A;  4JN3 A;  3MAE A;  2E1V A;  2FY4 A;  4HVM A;  2RCU A;  2FW3 A;  1EAC A;  4CLA A;  2II4 A;  2RKT A;  1EAA A;  2FY3 A;  3U9B A;  1T7O A;  2JGP A;  4EPH A;  3U9F A;  4KEC A;  4EP9 A;  2IHW A;  2I9D A;  1CLA A;  4G2M A;  1EAB A;  2VSQ A;  1E2O A;  5KJU A;  5FAN A;  4G22 A;  5KJT A;  1EAD A;  1CIA A;  5DU9 A;  1XL7 A;  1NM8 A;  3B2S A;  4EYW A;  2FY5 A;  1QCA A;  1XMC A;  2II3 A;  2XHG A;  5FAL A;  5KJV A;  2CLA A;  1XMD A;  1Q6X A;  2XR7 A;  1NDF A;  4KE4 A;  5KJS A;  1T7Q A;  5DUA A;  2II5 A;  1EAF A;  2FY2 A;  2BGH A;  1DPB A;  1PD5 A;  1L5A A;  1T7N A;  4N72 A;  2ZBA A;  1NDB A;  1XL8 A;  2DEB A;  1T1U A;  2H4T A;  3B30 A;  5KJW A;  1S5O A;  3FOT A; 
#chains in the Genus database with same CATH homology
 5DUA A;  2II5 A;  1CIA A;  1EAF A;  2RKV A;  4CLA A;  1SCZ A;  1EAE A;  2E1T A;  2II4 A;  1XL7 A;  4G0B A;  2RKT A;  5DU9 A;  1EAA A;  2BGH A;  1DPD A;  1DPB A;  1Q23 A;  4JN5 A;  3L60 A;  3U9B A;  3B2S A;  1PD5 A;  1L5A A;  1DPC A;  2JGP A;  1QCA A;  3U9F A;  1Q9J A;  3FP0 A;  4KEC A;  1XMC A;  1NOC B;  4N72 A;  2E1U A;  2II3 A;  2IHW A;  3CLA A;  2XHG A;  2ZBA A;  1C4T A;  1XL8 A;  5T3E A;  5FAL A;  4JN3 A;  2I9D A;  1CLA A;  3MAE A;  2E1V A;  5KJV A;  2CLA A;  3B30 A;  1XMD A;  4G2M A;  5KJW A;  4HVM A;  1EAB A;  2XR7 A;  2VSQ A;  1E2O A;  5KJU A;  4KE4 A;  5FAN A;  5KJS A;  4G22 A;  1EAC A;  5KJT A;  3FOT A;  1EAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...