1Q23A

Crystal structure of chloramphenicol acetyltransferase i complexed with fusidic acid at 2.18 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
214
structure length
214
Chain Sequence
ITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFLKTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSSLWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANMDNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Chloramphenicol acetyltransferase
publication title Crystal structure of Chloramphenicol acetyltransferase I in the apoenzyme form and complexed with fusidic acid at 2.18 A resolution
rcsb
source organism Escherichia coli
total genus 63
structure length 214
sequence length 214
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.3.1.28: Chloramphenicol O-acetyltransferase.
pdb deposition date 2003-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00302 CAT Chloramphenicol acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1q23A00
2I9DA 2CLAA 5FALA 3U9BA 2II5A 1DPBA 4N72A 1Q9JA 2RKVA 5T3EA 1QCAA 2II4A 1CLAA 3U9FA 4KE4A 4G2MA 3B2SA 2BGHA 5KJWA 1XMDA 1XL7A 2JGPA 2RKTA 2XR7A 4JN5A 1SCZA 5FANA 5KJTA 1XMCA 1C4TA 1Q23A 3B30A 1DPDA 3MAEA 3CLAA 4CLAA 1EAAA 1EADA 3FP0A 1DPCA 1NOCB 4G0BA 5KJSA 4G22A 1EAEA 3L60A 5DU9A 1PD5A 3FOTA 1L5AA 4KECA 1XL8A 5KJVA 2XHGA 2VSQA 1EACA 2E1VA 1EABA 2E1UA 2II3A 2IHWA 5DUAA 1EAFA 4JN3A 5KJUA 1E2OA 2ZBAA 2E1TA 4HVMA 1CIAA
chains in the Genus database with same CATH superfamily
1Q6XA 2FYOA 5T3EA 3U9FA 2II4A 4KE4A 1T7NA 1NM8A 2BGHA 2JGPA 2RKTA 2XR7A 4JN5A 2RCUA 1XMCA 3B30A 3CLAA 1EAAA 4G0BA 1EAEA 3FOTA 4KECA 1NDIA 5KJVA 2II3A 5DUAA 1E2OA 2I9DA 5FALA 1DPBA 1Q9JA 2RKVA 1QCAA 1CLAA 1T1UA 5KJWA 1NDBA 2H3PA 5FANA 5KJTA 3MAEA 1NOCB 5KJSA 1S5OA 4G22A 2FY5A 3L60A 1XL8A 2E1VA 1NDFA 4EPHA 2IHWA 2FY4A 5KJUA 2H4TA 1CIAA 2CLAA 4N72A 2DEBA 4G2MA 2H3WA 3B2SA 1XMDA 1T7OA 2FY2A 1SCZA 1C4TA 1DPDA 4CLAA 1EADA 2FY3A 2H3UA 2VSQA 1EABA 2E1UA 2ZBAA 2E1TA 4HVMA 3U9BA 2II5A 4EYWA 1XL7A 1Q23A 2FW3A 1T7QA 3FP0A 1DPCA 5DU9A 1PD5A 1L5AA 1EACA 4EP9A 1EAFA 4JN3A 2XHGA
chains in the Genus database with same CATH topology
2I9DA 2CLAA 5FALA 3U9BA 2II5A 1DPBA 4N72A 1Q9JA 2RKVA 5T3EA 1QCAA 2II4A 1CLAA 3U9FA 4KE4A 4G2MA 3B2SA 2BGHA 5KJWA 1XMDA 1XL7A 2JGPA 2RKTA 2XR7A 4JN5A 1SCZA 5FANA 5KJTA 1XMCA 1C4TA 1Q23A 3B30A 1DPDA 3MAEA 3CLAA 4CLAA 1EAAA 1EADA 3FP0A 1DPCA 1NOCB 4G0BA 5KJSA 4G22A 1EAEA 3L60A 5DU9A 1PD5A 3FOTA 1L5AA 4KECA 1XL8A 5KJVA 2XHGA 2VSQA 1EACA 2E1VA 1EABA 2E1UA 2II3A 2IHWA 5DUAA 1EAFA 4JN3A 5KJUA 1E2OA 2ZBAA 2E1TA 4HVMA 1CIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I9D A;  2CLA A;  5FAL A;  3U9B A;  2II5 A;  1DPB A;  4N72 A;  1Q9J A;  2RKV A;  5T3E A;  1QCA A;  2II4 A;  1CLA A;  3U9F A;  4KE4 A;  4G2M A;  3B2S A;  2BGH A;  5KJW A;  1XMD A;  1XL7 A;  2JGP A;  2RKT A;  2XR7 A;  4JN5 A;  1SCZ A;  5FAN A;  5KJT A;  1XMC A;  1C4T A;  1Q23 A;  3B30 A;  1DPD A;  3MAE A;  3CLA A;  4CLA A;  1EAA A;  1EAD A;  3FP0 A;  1DPC A;  1NOC B;  4G0B A;  5KJS A;  4G22 A;  1EAE A;  3L60 A;  5DU9 A;  1PD5 A;  3FOT A;  1L5A A;  4KEC A;  1XL8 A;  5KJV A;  2XHG A;  2VSQ A;  1EAC A;  2E1V A;  1EAB A;  2E1U A;  2II3 A;  2IHW A;  5DUA A;  1EAF A;  4JN3 A;  5KJU A;  1E2O A;  2ZBA A;  2E1T A;  4HVM A;  1CIA A; 
#chains in the Genus database with same CATH topology
 1Q6X A;  2FYO A;  5T3E A;  3U9F A;  2II4 A;  4KE4 A;  1T7N A;  1NM8 A;  2BGH A;  2JGP A;  2RKT A;  2XR7 A;  4JN5 A;  2RCU A;  1XMC A;  3B30 A;  3CLA A;  1EAA A;  4G0B A;  1EAE A;  3FOT A;  4KEC A;  1NDI A;  5KJV A;  2II3 A;  5DUA A;  1E2O A;  2I9D A;  5FAL A;  1DPB A;  1Q9J A;  2RKV A;  1QCA A;  1CLA A;  1T1U A;  5KJW A;  1NDB A;  2H3P A;  5FAN A;  5KJT A;  3MAE A;  1NOC B;  5KJS A;  1S5O A;  4G22 A;  2FY5 A;  3L60 A;  1XL8 A;  2E1V A;  1NDF A;  4EPH A;  2IHW A;  2FY4 A;  5KJU A;  2H4T A;  1CIA A;  2CLA A;  4N72 A;  2DEB A;  4G2M A;  2H3W A;  3B2S A;  1XMD A;  1T7O A;  2FY2 A;  1SCZ A;  1C4T A;  1DPD A;  4CLA A;  1EAD A;  2FY3 A;  2H3U A;  2VSQ A;  1EAB A;  2E1U A;  2ZBA A;  2E1T A;  4HVM A;  3U9B A;  2II5 A;  4EYW A;  1XL7 A;  1Q23 A;  2FW3 A;  1T7Q A;  3FP0 A;  1DPC A;  5DU9 A;  1PD5 A;  1L5A A;  1EAC A;  4EP9 A;  1EAF A;  4JN3 A;  2XHG A; 
#chains in the Genus database with same CATH homology
 2I9D A;  2CLA A;  5FAL A;  3U9B A;  2II5 A;  1DPB A;  4N72 A;  1Q9J A;  2RKV A;  5T3E A;  1QCA A;  2II4 A;  1CLA A;  3U9F A;  4KE4 A;  4G2M A;  3B2S A;  2BGH A;  5KJW A;  1XMD A;  1XL7 A;  2JGP A;  2RKT A;  2XR7 A;  4JN5 A;  1SCZ A;  5FAN A;  5KJT A;  1XMC A;  1C4T A;  1Q23 A;  3B30 A;  1DPD A;  3MAE A;  3CLA A;  4CLA A;  1EAA A;  1EAD A;  3FP0 A;  1DPC A;  1NOC B;  4G0B A;  5KJS A;  4G22 A;  1EAE A;  3L60 A;  5DU9 A;  1PD5 A;  3FOT A;  1L5A A;  4KEC A;  1XL8 A;  5KJV A;  2XHG A;  2VSQ A;  1EAC A;  2E1V A;  1EAB A;  2E1U A;  2II3 A;  2IHW A;  5DUA A;  1EAF A;  4JN3 A;  5KJU A;  1E2O A;  2ZBA A;  2E1T A;  4HVM A;  1CIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...