2RKVA

Crystal structure of f. graminearum tri101 complexed with coenzyme a and t-2 mycotoxin
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
450
structure length
443
Chain Sequence
AFKIQLDTLGQLPGLLSIYTQISLLYPVSDSSQYPTIVSTFEQGLKRFSEAVPWVAGQVKAEGISEGNTGTSFIVPFEDVPRVVVKDLRDDPSAPTIEGMRKAGYPMAMFDENIIAPRKTLPIGPGTGPDDPKPVILLQLNFIKGGLILTVNGQHGAMDMVGQDAVIRLLSKACRNDPFTEEEMTAMNLDRKTIVPYLENYTIGPEVDHQIVKADVAGVSASWAFFTFSPKAMSELKDAATKTLDASTKFVSTDDALSAFIWKSASRVRLERIDGSAPTEFCRAVDARPAMGVSNNYPGLLQNMTYHNSTIGEIANESLGATASRLRSELDPASMRQRTRGLATYLHNNPDKSNVSLTADADPSTSVMLSSWAKVGLWDYDFGLGLGKPETVRRPIFEPVESLMYFMPKKPDGEFCAALSLRDEDMDRLKADKEWTKYAQYVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Trichothecene 3-O-acetyltransferase
publication title Structural and Functional Characterization of the TRI101 Trichothecene 3-O-Acetyltransferase from Fusarium sporotrichioides and Fusarium graminearum: KINETIC INSIGHTS TO COMBATING FUSARIUM HEAD BLIGHT
pubmed doi rcsb
source organism Gibberella zeae
total genus 162
structure length 443
sequence length 450
ec nomenclature
pdb deposition date 2007-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02458 Transferase Transferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 2rkvA01
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 2rkvA02
3U9BA 1Q9JA 4G0BA 5DUAA 1SCZA 2IHWA 1DPCA 1E2OA 1NOCB 2E1TA 2VSQA 3B30A 4CLAA 3MAEA 2E1VA 1EACA 5KJUA 3U9FA 5T3EA 1CLAA 3FOTA 1DPDA 1CIAA 1XL8A 1EAAA 5KJTA 4JN3A 2ZBAA 1L5AA 5FALA 1XMCA 3B2SA 4G22A 1PD5A 4G2MA 2CLAA 5KJVA 5FANA 1XMDA 2E1UA 2II3A 1XL7A 2II5A 1EABA 3L60A 4JN5A 1C4TA 1QCAA 1DPBA 4KECA 4N72A 2RKVA 2I9DA 5KJWA 1EADA 2II4A 2RKTA 2BGHA 3CLAA 2JGPA 5DU9A 5KJSA 2XHGA 2XR7A 1EAFA 1Q23A 4KE4A 4HVMA 3FP0A 1EAEA
chains in the Genus database with same CATH superfamily
1DPCA 2H3UA 2E1VA 5T3EA 2H3WA 2FY2A 1DPDA 1CIAA 5KJTA 4JN3A 1L5AA 5FALA 1PD5A 5KJVA 2FY4A 5FANA 1XMDA 2II3A 1XL7A 1EABA 4JN5A 4KECA 4N72A 2RKVA 5KJWA 3CLAA 5KJSA 4KE4A 1EAEA 1T1UA 3MAEA 1CLAA 3FOTA 1XL8A 2ZBAA 1XMCA 3B2SA 4G2MA 1NDIA 1S5OA 2FW3A 1QCAA 2RKTA 2DEBA 1EAFA 1DPBA 3FP0A 4EPHA 1Q9JA 5DUAA 1SCZA 1E2OA 2E1TA 2FY5A 2FY3A 3U9FA 1Q6XA 2CLAA 1NM8A 2H3PA 1T7OA 1NDBA 3L60A 2I9DA 2II4A 5DU9A 2JGPA 2H4TA 2XHGA 2XR7A 1Q23A 4EYWA 4HVMA 3U9BA 4G0BA 2IHWA 2VSQA 4CLAA 1NOCB 3B30A 5KJUA 1EACA 1T7NA 1T7QA 1EAAA 4EP9A 4G22A 1NDFA 2FYOA 2E1UA 2RCUA 2II5A 1C4TA 1EADA 2BGHA
chains in the Genus database with same CATH topology
3U9BA 1Q9JA 4G0BA 5DUAA 1SCZA 2IHWA 1DPCA 1E2OA 1NOCB 2E1TA 2VSQA 3B30A 4CLAA 3MAEA 2E1VA 1EACA 5KJUA 3U9FA 5T3EA 1CLAA 3FOTA 1DPDA 1CIAA 1XL8A 1EAAA 5KJTA 4JN3A 2ZBAA 1L5AA 5FALA 1XMCA 3B2SA 4G22A 1PD5A 4G2MA 2CLAA 5KJVA 5FANA 1XMDA 2E1UA 2II3A 1XL7A 2II5A 1EABA 3L60A 4JN5A 1C4TA 1QCAA 1DPBA 4KECA 4N72A 2RKVA 2I9DA 5KJWA 1EADA 2II4A 2RKTA 2BGHA 3CLAA 2JGPA 5DU9A 5KJSA 2XHGA 2XR7A 1EAFA 1Q23A 4KE4A 4HVMA 3FP0A 1EAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U9B A;  1Q9J A;  4G0B A;  5DUA A;  1SCZ A;  2IHW A;  1DPC A;  1E2O A;  1NOC B;  2E1T A;  2VSQ A;  3B30 A;  4CLA A;  3MAE A;  2E1V A;  1EAC A;  5KJU A;  3U9F A;  5T3E A;  1CLA A;  3FOT A;  1DPD A;  1CIA A;  1XL8 A;  1EAA A;  5KJT A;  4JN3 A;  2ZBA A;  1L5A A;  5FAL A;  1XMC A;  3B2S A;  4G22 A;  1PD5 A;  4G2M A;  2CLA A;  5KJV A;  5FAN A;  1XMD A;  2E1U A;  2II3 A;  1XL7 A;  2II5 A;  1EAB A;  3L60 A;  4JN5 A;  1C4T A;  1QCA A;  1DPB A;  4KEC A;  4N72 A;  2RKV A;  2I9D A;  5KJW A;  1EAD A;  2II4 A;  2RKT A;  2BGH A;  3CLA A;  2JGP A;  5DU9 A;  5KJS A;  2XHG A;  2XR7 A;  1EAF A;  1Q23 A;  4KE4 A;  4HVM A;  3FP0 A;  1EAE A; 
#chains in the Genus database with same CATH topology
 1DPC A;  2H3U A;  2E1V A;  5T3E A;  2H3W A;  2FY2 A;  1DPD A;  1CIA A;  5KJT A;  4JN3 A;  1L5A A;  5FAL A;  1PD5 A;  5KJV A;  2FY4 A;  5FAN A;  1XMD A;  2II3 A;  1XL7 A;  1EAB A;  4JN5 A;  4KEC A;  4N72 A;  2RKV A;  5KJW A;  3CLA A;  5KJS A;  4KE4 A;  1EAE A;  1T1U A;  3MAE A;  1CLA A;  3FOT A;  1XL8 A;  2ZBA A;  1XMC A;  3B2S A;  4G2M A;  1NDI A;  1S5O A;  2FW3 A;  1QCA A;  2RKT A;  2DEB A;  1EAF A;  1DPB A;  3FP0 A;  4EPH A;  1Q9J A;  5DUA A;  1SCZ A;  1E2O A;  2E1T A;  2FY5 A;  2FY3 A;  3U9F A;  1Q6X A;  2CLA A;  1NM8 A;  2H3P A;  1T7O A;  1NDB A;  3L60 A;  2I9D A;  2II4 A;  5DU9 A;  2JGP A;  2H4T A;  2XHG A;  2XR7 A;  1Q23 A;  4EYW A;  4HVM A;  3U9B A;  4G0B A;  2IHW A;  2VSQ A;  4CLA A;  1NOC B;  3B30 A;  5KJU A;  1EAC A;  1T7N A;  1T7Q A;  1EAA A;  4EP9 A;  4G22 A;  1NDF A;  2FYO A;  2E1U A;  2RCU A;  2II5 A;  1C4T A;  1EAD A;  2BGH A; 
#chains in the Genus database with same CATH homology
 3U9B A;  1Q9J A;  4G0B A;  5DUA A;  1SCZ A;  2IHW A;  1DPC A;  1E2O A;  1NOC B;  2E1T A;  2VSQ A;  3B30 A;  4CLA A;  3MAE A;  2E1V A;  1EAC A;  5KJU A;  3U9F A;  5T3E A;  1CLA A;  3FOT A;  1DPD A;  1CIA A;  1XL8 A;  1EAA A;  5KJT A;  4JN3 A;  2ZBA A;  1L5A A;  5FAL A;  1XMC A;  3B2S A;  4G22 A;  1PD5 A;  4G2M A;  2CLA A;  5KJV A;  5FAN A;  1XMD A;  2E1U A;  2II3 A;  1XL7 A;  2II5 A;  1EAB A;  3L60 A;  4JN5 A;  1C4T A;  1QCA A;  1DPB A;  4KEC A;  4N72 A;  2RKV A;  2I9D A;  5KJW A;  1EAD A;  2II4 A;  2RKT A;  2BGH A;  3CLA A;  2JGP A;  5DU9 A;  5KJS A;  2XHG A;  2XR7 A;  1EAF A;  1Q23 A;  4KE4 A;  4HVM A;  3FP0 A;  1EAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...