2RKVA

Crystal structure of f. graminearum tri101 complexed with coenzyme a and t-2 mycotoxin
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
450
structure length
443
Chain Sequence
AFKIQLDTLGQLPGLLSIYTQISLLYPVSDSSQYPTIVSTFEQGLKRFSEAVPWVAGQVKAEGISEGNTGTSFIVPFEDVPRVVVKDLRDDPSAPTIEGMRKAGYPMAMFDENIIAPRKTLPIGPGTGPDDPKPVILLQLNFIKGGLILTVNGQHGAMDMVGQDAVIRLLSKACRNDPFTEEEMTAMNLDRKTIVPYLENYTIGPEVDHQIVKADVAGVSASWAFFTFSPKAMSELKDAATKTLDASTKFVSTDDALSAFIWKSASRVRLERIDGSAPTEFCRAVDARPAMGVSNNYPGLLQNMTYHNSTIGEIANESLGATASRLRSELDPASMRQRTRGLATYLHNNPDKSNVSLTADADPSTSVMLSSWAKVGLWDYDFGLGLGKPETVRRPIFEPVESLMYFMPKKPDGEFCAALSLRDEDMDRLKADKEWTKYAQYVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Trichothecene 3-O-acetyltransferase
publication title Structural and Functional Characterization of the TRI101 Trichothecene 3-O-Acetyltransferase from Fusarium sporotrichioides and Fusarium graminearum: KINETIC INSIGHTS TO COMBATING FUSARIUM HEAD BLIGHT
pubmed doi rcsb
source organism Gibberella zeae
molecule tags Transferase
total genus 162
structure length 443
sequence length 450
ec nomenclature
pdb deposition date 2007-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02458 Transferase Transferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 2rkvA01
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 2rkvA02
2ZBAA 2II5A 1L5AA 5KJVA 5FALA 4KECA 5KJSA 2VSQA 1C4TA 2XHGA 5DUAA 1SCZA 5DU9A 2II3A 1EAAA 1DPCA 3B2SA 3MAEA 2IHWA 2JGPA 3U9BA 2BGHA 1E2OA 1NOCB 5KJTA 4HVMA 4G2MA 1XL7A 3U9FA 4JN5A 1XL8A 1DPBA 1CLAA 3B30A 1XMDA 5KJUA 1CIAA 2E1TA 3FP0A 1DPDA 1Q9JA 2I9DA 4G0BA 3FOTA 5T3EA 2II4A 3L60A 3CLAA 4JN3A 1EABA 1EACA 1EADA 2RKVA 4N72A 2CLAA 1PD5A 4G22A 5KJWA 1XMCA 4KE4A 4CLAA 1QCAA 2XR7A 2E1UA 2E1VA 1EAEA 5FANA 1EAFA 1Q23A 2RKTA
chains in the Genus database with same CATH superfamily
5DUAA 1SCZA 2II3A 3B2SA 1DPCA 2DEBA 2H4TA 1E2OA 1NOCB 1NDIA 4HVMA 4G2MA 1Q6XA 3U9FA 2FY3A 5KJUA 1CIAA 2E1TA 3FP0A 1DPDA 2FW3A 5T3EA 3FOTA 1EACA 1XMCA 1EAEA 1EAFA 2H3PA 5KJVA 5FALA 4KECA 5KJSA 1NDBA 1C4TA 1S5OA 2FY4A 1NDFA 4JN5A 3B30A 1Q9JA 4JN3A 2RKVA 4CLAA 2E1VA 5FANA 1Q23A 2RKTA 5KJWA 1T7OA 1L5AA 4EYWA 2IHWA 1T1UA 4EP9A 4EPHA 2FY5A 1XL7A 1XL8A 1DPBA 2I9DA 4G0BA 3L60A 4N72A 3CLAA 1EABA 1EADA 1NM8A 2FY2A 4G22A 1T7QA 2ZBAA 2II5A 2VSQA 2XHGA 2H3UA 2FYOA 5DU9A 1EAAA 3MAEA 2JGPA 2BGHA 5KJTA 1T7NA 1CLAA 2RCUA 1XMDA 2II4A 2H3WA 2CLAA 1PD5A 4KE4A 1QCAA 2XR7A 2E1UA 3U9BA
chains in the Genus database with same CATH topology
2ZBAA 2II5A 1L5AA 5KJVA 5FALA 4KECA 5KJSA 2VSQA 1C4TA 2XHGA 5DUAA 1SCZA 5DU9A 2II3A 1EAAA 1DPCA 3B2SA 3MAEA 2IHWA 2JGPA 3U9BA 2BGHA 1E2OA 1NOCB 5KJTA 4HVMA 4G2MA 1XL7A 3U9FA 4JN5A 1XL8A 1DPBA 1CLAA 3B30A 1XMDA 5KJUA 1CIAA 2E1TA 3FP0A 1DPDA 1Q9JA 2I9DA 4G0BA 3FOTA 5T3EA 2II4A 3L60A 3CLAA 4JN3A 1EABA 1EACA 1EADA 2RKVA 4N72A 2CLAA 1PD5A 4G22A 5KJWA 1XMCA 4KE4A 4CLAA 1QCAA 2XR7A 2E1UA 2E1VA 1EAEA 5FANA 1EAFA 1Q23A 2RKTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZBA A;  2II5 A;  1L5A A;  5KJV A;  5FAL A;  4KEC A;  5KJS A;  2VSQ A;  1C4T A;  2XHG A;  5DUA A;  1SCZ A;  5DU9 A;  2II3 A;  1EAA A;  1DPC A;  3B2S A;  3MAE A;  2IHW A;  2JGP A;  3U9B A;  2BGH A;  1E2O A;  1NOC B;  5KJT A;  4HVM A;  4G2M A;  1XL7 A;  3U9F A;  4JN5 A;  1XL8 A;  1DPB A;  1CLA A;  3B30 A;  1XMD A;  5KJU A;  1CIA A;  2E1T A;  3FP0 A;  1DPD A;  1Q9J A;  2I9D A;  4G0B A;  3FOT A;  5T3E A;  2II4 A;  3L60 A;  3CLA A;  4JN3 A;  1EAB A;  1EAC A;  1EAD A;  2RKV A;  4N72 A;  2CLA A;  1PD5 A;  4G22 A;  5KJW A;  1XMC A;  4KE4 A;  4CLA A;  1QCA A;  2XR7 A;  2E1U A;  2E1V A;  1EAE A;  5FAN A;  1EAF A;  1Q23 A;  2RKT A; 
#chains in the Genus database with same CATH topology
 5DUA A;  1SCZ A;  2II3 A;  3B2S A;  1DPC A;  2DEB A;  2H4T A;  1E2O A;  1NOC B;  1NDI A;  4HVM A;  4G2M A;  1Q6X A;  3U9F A;  2FY3 A;  5KJU A;  1CIA A;  2E1T A;  3FP0 A;  1DPD A;  2FW3 A;  5T3E A;  3FOT A;  1EAC A;  1XMC A;  1EAE A;  1EAF A;  2H3P A;  5KJV A;  5FAL A;  4KEC A;  5KJS A;  1NDB A;  1C4T A;  1S5O A;  2FY4 A;  1NDF A;  4JN5 A;  3B30 A;  1Q9J A;  4JN3 A;  2RKV A;  4CLA A;  2E1V A;  5FAN A;  1Q23 A;  2RKT A;  5KJW A;  1T7O A;  1L5A A;  4EYW A;  2IHW A;  1T1U A;  4EP9 A;  4EPH A;  2FY5 A;  1XL7 A;  1XL8 A;  1DPB A;  2I9D A;  4G0B A;  3L60 A;  4N72 A;  3CLA A;  1EAB A;  1EAD A;  1NM8 A;  2FY2 A;  4G22 A;  1T7Q A;  2ZBA A;  2II5 A;  2VSQ A;  2XHG A;  2H3U A;  2FYO A;  5DU9 A;  1EAA A;  3MAE A;  2JGP A;  2BGH A;  5KJT A;  1T7N A;  1CLA A;  2RCU A;  1XMD A;  2II4 A;  2H3W A;  2CLA A;  1PD5 A;  4KE4 A;  1QCA A;  2XR7 A;  2E1U A;  3U9B A; 
#chains in the Genus database with same CATH homology
 2ZBA A;  2II5 A;  1L5A A;  5KJV A;  5FAL A;  4KEC A;  5KJS A;  2VSQ A;  1C4T A;  2XHG A;  5DUA A;  1SCZ A;  5DU9 A;  2II3 A;  1EAA A;  1DPC A;  3B2S A;  3MAE A;  2IHW A;  2JGP A;  3U9B A;  2BGH A;  1E2O A;  1NOC B;  5KJT A;  4HVM A;  4G2M A;  1XL7 A;  3U9F A;  4JN5 A;  1XL8 A;  1DPB A;  1CLA A;  3B30 A;  1XMD A;  5KJU A;  1CIA A;  2E1T A;  3FP0 A;  1DPD A;  1Q9J A;  2I9D A;  4G0B A;  3FOT A;  5T3E A;  2II4 A;  3L60 A;  3CLA A;  4JN3 A;  1EAB A;  1EAC A;  1EAD A;  2RKV A;  4N72 A;  2CLA A;  1PD5 A;  4G22 A;  5KJW A;  1XMC A;  4KE4 A;  4CLA A;  1QCA A;  2XR7 A;  2E1U A;  2E1V A;  1EAE A;  5FAN A;  1EAF A;  1Q23 A;  2RKT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...