1T1UA

Structural insights and functional implications of choline acetyltransferase
Total Genus 221
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
221
sequence length
597
structure length
597
Chain Sequence
ELDLPKLPVPPLQQTLATYLQCMQHLVPEEQFRKSQAIVKRFGAPGGLGETLQEKLLERQEKTANWVSEYWLNDMYLNNRLALPVNSSPAVIFARQHFQDTNDQLRFAACLISGVLSYKTLLDSHSLPTDWAKGQLSGQPLCMKQYYRLFSSYRLPGHTQDTLVAQKSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAKARTVLLKDSTNRDSLDMIERCICLVCLDGPGTGELSDTHRALQLLHGGGCSLNGANRWYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHMMTSNKKLVRADSVSELPAPRRLRWKCSPETQGHLASSAEKLQRIVKNLDFIVYKFDNYGKTFIKKQKYSPDGFIQVALQLAYYRLYQRLVPTYESASIRRFQEGRVDNIRSATPEALAFVQAMTDHKAAMPASEKLQLLQTAMQAQTEYTVMAITGMAIDNHLLALRELARDLCKEPPEMFMDETYLMSNRFVLSTSQVPTTMEMFCCYGPVVPNGYGACYNPQPEAITFCISSFHSCKETSSVEFAEAVGASLVDMRDLCSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Choline O-acetyltransferase
publication title Structural insights and functional implications of choline acetyltransferase
pubmed doi rcsb
source organism Rattus norvegicus
total genus 221
structure length 597
sequence length 597
ec nomenclature ec 2.3.1.6: Choline O-acetyltransferase.
pdb deposition date 2004-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00755 Carn_acyltransf Choline/Carnitine o-acyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.40 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol Acetyltransferase 1t1uA01
3.30.559.70 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol Acetyltransferase 1t1uA02
1NDIA 1Q6XA 2DEBA 2H3PA 1NDBA 2H3UA 2FY2A 1T7QA 2FY5A 1NM8A 1T7NA 4EYWA 2H3WA 1T7OA 4EPHA 2FY4A 2FYOA 1S5OA 2FW3A 4EP9A 1T1UA 2RCUA 2H4TA 1NDFA 2FY3A
chains in the Genus database with same CATH superfamily
2RKVA 1QCAA 4CLAA 3FP0A 2H3UA 1XMDA 1XL8A 1EAAA 1DPBA 1PD5A 5KJTA 4KECA 5FALA 4EPHA 3MAEA 2FY4A 3L60A 3FOTA 1SCZA 1T1UA 1XMCA 2E1TA 3B30A 1E2OA 4G22A 1NDIA 1Q6XA 2XHGA 2CLAA 4N72A 1EAFA 2H3PA 2FY2A 1Q9JA 1T7QA 2FY5A 1EACA 1T7NA 3U9BA 2H3WA 5FANA 3B2SA 1C4TA 2ZBAA 2FW3A 1DPDA 2RKTA 2RCUA 2FY3A 2E1VA 2DEBA 2IHWA 1EADA 1NDBA 4KE4A 1NOCB 2II3A 1Q23A 4EYWA 2I9DA 1L5AA 1EABA 2XR7A 5KJSA 2II4A 2JGPA 3U9FA 4G2MA 1S5OA 1DPCA 5KJVA 4JN3A 5DUAA 2H4TA 1NDFA 4HVMA 2BGHA 5KJWA 2E1UA 5DU9A 5T3EA 1NM8A 1XL7A 1T7OA 2VSQA 2II5A 1CIAA 1CLAA 2FYOA 1EAEA 3CLAA 4EP9A 5KJUA 4G0BA 4JN5A
chains in the Genus database with same CATH topology
4HVMA 1NDIA 1Q6XA 2XHGA 2DEBA 3FP0A 2H3PA 1NDBA 2H3UA 5DU9A 2FY2A 1Q9JA 1T7QA 2FY5A 5T3EA 1NM8A 1T7NA 4EYWA 1L5AA 2H3WA 1T7OA 2VSQA 4EPHA 2JGPA 2FY4A 2FYOA 1S5OA 2FW3A 3FOTA 4EP9A 4JN5A 4JN3A 1T1UA 5DUAA 2RCUA 2H4TA 1NDFA 2FY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NDI A;  1Q6X A;  2DEB A;  2H3P A;  1NDB A;  2H3U A;  2FY2 A;  1T7Q A;  2FY5 A;  1NM8 A;  1T7N A;  4EYW A;  2H3W A;  1T7O A;  4EPH A;  2FY4 A;  2FYO A;  1S5O A;  2FW3 A;  4EP9 A;  1T1U A;  2RCU A;  2H4T A;  1NDF A;  2FY3 A; 
#chains in the Genus database with same CATH topology
 2RKV A;  1QCA A;  4CLA A;  3FP0 A;  2H3U A;  1XMD A;  1XL8 A;  1EAA A;  1DPB A;  1PD5 A;  5KJT A;  4KEC A;  5FAL A;  4EPH A;  3MAE A;  2FY4 A;  3L60 A;  3FOT A;  1SCZ A;  1T1U A;  1XMC A;  2E1T A;  3B30 A;  1E2O A;  4G22 A;  1NDI A;  1Q6X A;  2XHG A;  2CLA A;  4N72 A;  1EAF A;  2H3P A;  2FY2 A;  1Q9J A;  1T7Q A;  2FY5 A;  1EAC A;  1T7N A;  3U9B A;  2H3W A;  5FAN A;  3B2S A;  1C4T A;  2ZBA A;  2FW3 A;  1DPD A;  2RKT A;  2RCU A;  2FY3 A;  2E1V A;  2DEB A;  2IHW A;  1EAD A;  1NDB A;  4KE4 A;  1NOC B;  2II3 A;  1Q23 A;  4EYW A;  2I9D A;  1L5A A;  1EAB A;  2XR7 A;  5KJS A;  2II4 A;  2JGP A;  3U9F A;  4G2M A;  1S5O A;  1DPC A;  5KJV A;  4JN3 A;  5DUA A;  2H4T A;  1NDF A;  4HVM A;  2BGH A;  5KJW A;  2E1U A;  5DU9 A;  5T3E A;  1NM8 A;  1XL7 A;  1T7O A;  2VSQ A;  2II5 A;  1CIA A;  1CLA A;  2FYO A;  1EAE A;  3CLA A;  4EP9 A;  5KJU A;  4G0B A;  4JN5 A; 
#chains in the Genus database with same CATH homology
 4HVM A;  1NDI A;  1Q6X A;  2XHG A;  2DEB A;  3FP0 A;  2H3P A;  1NDB A;  2H3U A;  5DU9 A;  2FY2 A;  1Q9J A;  1T7Q A;  2FY5 A;  5T3E A;  1NM8 A;  1T7N A;  4EYW A;  1L5A A;  2H3W A;  1T7O A;  2VSQ A;  4EPH A;  2JGP A;  2FY4 A;  2FYO A;  1S5O A;  2FW3 A;  3FOT A;  4EP9 A;  4JN5 A;  4JN3 A;  1T1U A;  5DUA A;  2RCU A;  2H4T A;  1NDF A;  2FY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...