1T1UA

Structural insights and functional implications of choline acetyltransferase
Total Genus 221
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
221
sequence length
597
structure length
597
Chain Sequence
ELDLPKLPVPPLQQTLATYLQCMQHLVPEEQFRKSQAIVKRFGAPGGLGETLQEKLLERQEKTANWVSEYWLNDMYLNNRLALPVNSSPAVIFARQHFQDTNDQLRFAACLISGVLSYKTLLDSHSLPTDWAKGQLSGQPLCMKQYYRLFSSYRLPGHTQDTLVAQKSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAKARTVLLKDSTNRDSLDMIERCICLVCLDGPGTGELSDTHRALQLLHGGGCSLNGANRWYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHMMTSNKKLVRADSVSELPAPRRLRWKCSPETQGHLASSAEKLQRIVKNLDFIVYKFDNYGKTFIKKQKYSPDGFIQVALQLAYYRLYQRLVPTYESASIRRFQEGRVDNIRSATPEALAFVQAMTDHKAAMPASEKLQLLQTAMQAQTEYTVMAITGMAIDNHLLALRELARDLCKEPPEMFMDETYLMSNRFVLSTSQVPTTMEMFCCYGPVVPNGYGACYNPQPEAITFCISSFHSCKETSSVEFAEAVGASLVDMRDLCSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Choline O-acetyltransferase
publication title Structural insights and functional implications of choline acetyltransferase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 221
structure length 597
sequence length 597
ec nomenclature ec 2.3.1.6: Choline O-acetyltransferase.
pdb deposition date 2004-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00755 Carn_acyltransf Choline/Carnitine o-acyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.40 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol Acetyltransferase 1t1uA01
3.30.559.70 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol Acetyltransferase 1t1uA02
2H3PA 1S5OA 1Q6XA 4EP9A 1NM8A 2FY2A 4EYWA 2H3WA 2FY4A 2H3UA 2FY3A 1NDFA 1T7OA 4EPHA 1NDBA 2RCUA 2H4TA 1T1UA 2DEBA 1T7QA 2FY5A 2FW3A 2FYOA 1NDIA 1T7NA
chains in the Genus database with same CATH superfamily
1S5OA 1EABA 4EP9A 5KJUA 4EYWA 1NOCB 2H3WA 1Q9JA 2H3UA 4G0BA 2E1VA 1QCAA 4N72A 5KJSA 1EAFA 5T3EA 4CLAA 1SCZA 2XR7A 2IHWA 1PD5A 2H3PA 4JN3A 2FY4A 2JGPA 3B30A 5KJVA 1EADA 4KECA 5DUAA 4G2MA 1Q23A 4KE4A 3B2SA 1DPBA 5FANA 1T1UA 3L60A 5FALA 5DU9A 2XHGA 3FP0A 3CLAA 1DPCA 1NM8A 1XMDA 1XL7A 1E2OA 1EACA 3U9BA 1CIAA 2I9DA 1NDFA 1CLAA 1DPDA 1NDBA 2E1UA 2II4A 5KJWA 1EAAA 2RCUA 1EAEA 2DEBA 1XMCA 3MAEA 2FY5A 1XL8A 2RKTA 2FYOA 4HVMA 1T7NA 1Q6XA 2FY2A 1C4TA 2RKVA 2II3A 2II5A 2CLAA 2VSQA 2BGHA 2FY3A 1T7OA 2E1TA 4EPHA 2H4TA 1T7QA 3FOTA 2ZBAA 4G22A 3U9FA 2FW3A 5KJTA 1L5AA 1NDIA 4JN5A
chains in the Genus database with same CATH topology
2H3PA 1S5OA 4JN3A 1Q6XA 4EP9A 1NM8A 2FY2A 4EYWA 2H3WA 2FY4A 1Q9JA 2H3UA 2JGPA 2VSQA 2FY3A 1NDFA 1T7OA 5DUAA 4EPHA 1NDBA 4HVMA 2RCUA 2H4TA 1T1UA 2DEBA 1T7QA 3FOTA 5T3EA 2FY5A 5DU9A 2FW3A 2XHGA 3FP0A 1L5AA 2FYOA 1NDIA 4JN5A 1T7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3P A;  1S5O A;  1Q6X A;  4EP9 A;  1NM8 A;  2FY2 A;  4EYW A;  2H3W A;  2FY4 A;  2H3U A;  2FY3 A;  1NDF A;  1T7O A;  4EPH A;  1NDB A;  2RCU A;  2H4T A;  1T1U A;  2DEB A;  1T7Q A;  2FY5 A;  2FW3 A;  2FYO A;  1NDI A;  1T7N A; 
#chains in the Genus database with same CATH topology
 1S5O A;  1EAB A;  4EP9 A;  5KJU A;  4EYW A;  1NOC B;  2H3W A;  1Q9J A;  2H3U A;  4G0B A;  2E1V A;  1QCA A;  4N72 A;  5KJS A;  1EAF A;  5T3E A;  4CLA A;  1SCZ A;  2XR7 A;  2IHW A;  1PD5 A;  2H3P A;  4JN3 A;  2FY4 A;  2JGP A;  3B30 A;  5KJV A;  1EAD A;  4KEC A;  5DUA A;  4G2M A;  1Q23 A;  4KE4 A;  3B2S A;  1DPB A;  5FAN A;  1T1U A;  3L60 A;  5FAL A;  5DU9 A;  2XHG A;  3FP0 A;  3CLA A;  1DPC A;  1NM8 A;  1XMD A;  1XL7 A;  1E2O A;  1EAC A;  3U9B A;  1CIA A;  2I9D A;  1NDF A;  1CLA A;  1DPD A;  1NDB A;  2E1U A;  2II4 A;  5KJW A;  1EAA A;  2RCU A;  1EAE A;  2DEB A;  1XMC A;  3MAE A;  2FY5 A;  1XL8 A;  2RKT A;  2FYO A;  4HVM A;  1T7N A;  1Q6X A;  2FY2 A;  1C4T A;  2RKV A;  2II3 A;  2II5 A;  2CLA A;  2VSQ A;  2BGH A;  2FY3 A;  1T7O A;  2E1T A;  4EPH A;  2H4T A;  1T7Q A;  3FOT A;  2ZBA A;  4G22 A;  3U9F A;  2FW3 A;  5KJT A;  1L5A A;  1NDI A;  4JN5 A; 
#chains in the Genus database with same CATH homology
 2H3P A;  1S5O A;  4JN3 A;  1Q6X A;  4EP9 A;  1NM8 A;  2FY2 A;  4EYW A;  2H3W A;  2FY4 A;  1Q9J A;  2H3U A;  2JGP A;  2VSQ A;  2FY3 A;  1NDF A;  1T7O A;  5DUA A;  4EPH A;  1NDB A;  4HVM A;  2RCU A;  2H4T A;  1T1U A;  2DEB A;  1T7Q A;  3FOT A;  5T3E A;  2FY5 A;  5DU9 A;  2FW3 A;  2XHG A;  3FP0 A;  1L5A A;  2FYO A;  1NDI A;  4JN5 A;  1T7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...