3U9BA

Structure of apo-cati
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
216
structure length
216
Chain Sequence
b'EKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFLKTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSSLWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANMDNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chloramphenicol acetyltransferase
publication title The structural basis for substrate versatility of chloramphenicol acetyltransferase CAT(I).
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 51
structure length 216
sequence length 216
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature ec 2.3.1.28: Chloramphenicol O-acetyltransferase.
pdb deposition date 2011-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00302 CAT Chloramphenicol acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 3u9bA00
1EACA 1CLAA 1XL8A 2I9DA 2E1VA 2II4A 4G22A 1EAAA 1XL7A 4G2MA 5KJUA 3CLAA 5DU9A 4G0BA 5DUAA 2BGHA 3FOTA 3U9FA 3MAEA 2VSQA 1L5AA 1E2OA 2JGPA 1DPDA 2XHGA 3B30A 1Q23A 3L60A 1XMCA 1EADA 4HVMA 3U9BA 1Q9JA 5FALA 3FP0A 5KJTA 2ZBAA 1PD5A 1DPBA 1NOCB 1QCAA 2II5A 1EAFA 2RKTA 3B2SA 5KJVA 2E1TA 1DPCA 1SCZA 4KECA 2CLAA 4CLAA 5KJWA 1C4TA 1EAEA 4JN3A 2RKVA 2E1UA 1EABA 1CIAA 2XR7A 4KE4A 5FANA 5T3EA 2II3A 5KJSA 4JN5A 2IHWA 4N72A 1XMDA
chains in the Genus database with same CATH superfamily
1T7NA 4G2MA 2FY5A 3CLAA 3L60A 1XMCA 4HVMA 1Q9JA 5KJTA 2ZBAA 1T1UA 2FY2A 5KJVA 4KECA 2CLAA 1C4TA 2RKVA 5T3EA 5KJSA 4JN5A 2IHWA 1XL8A 2I9DA 2H3WA 2E1VA 1EAAA 4EPHA 5KJUA 5DU9A 3FOTA 3MAEA 2VSQA 1L5AA 2JGPA 1Q23A 3U9BA 1Q6XA 1NOCB 2RKTA 3B2SA 1EAFA 2E1TA 4CLAA 2FY4A 1EAEA 2XR7A 1EABA 4KE4A 2II3A 4N72A 1EACA 1S5OA 2II4A 2H3PA 4G0BA 5DUAA 2BGHA 3U9FA 2XHGA 1EADA 2FYOA 1PD5A 4EYWA 1NDIA 1SCZA 5KJWA 2H4TA 5FANA 2E1UA 1CIAA 1NM8A 1CLAA 4G22A 1XL7A 2DEBA 2FY3A 4EP9A 1E2OA 1DPDA 3B30A 1T7QA 5FALA 2RCUA 3FP0A 1DPBA 1QCAA 2II5A 2H3UA 1DPCA 2FW3A 1NDBA 1NDFA 4JN3A 1T7OA 1XMDA
chains in the Genus database with same CATH topology
1EACA 1CLAA 1XL8A 2I9DA 2E1VA 2II4A 4G22A 1EAAA 1XL7A 4G2MA 5KJUA 3CLAA 5DU9A 4G0BA 5DUAA 2BGHA 3FOTA 3U9FA 3MAEA 2VSQA 1L5AA 1E2OA 2JGPA 1DPDA 2XHGA 3B30A 1Q23A 3L60A 1XMCA 1EADA 4HVMA 3U9BA 1Q9JA 5FALA 3FP0A 5KJTA 2ZBAA 1PD5A 1DPBA 1NOCB 1QCAA 2II5A 1EAFA 2RKTA 3B2SA 5KJVA 2E1TA 1DPCA 1SCZA 4KECA 2CLAA 4CLAA 5KJWA 1C4TA 1EAEA 4JN3A 2RKVA 2E1UA 1EABA 1CIAA 2XR7A 4KE4A 5FANA 5T3EA 2II3A 5KJSA 4JN5A 2IHWA 4N72A 1XMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EAC A;  1CLA A;  1XL8 A;  2I9D A;  2E1V A;  2II4 A;  4G22 A;  1EAA A;  1XL7 A;  4G2M A;  5KJU A;  3CLA A;  5DU9 A;  4G0B A;  5DUA A;  2BGH A;  3FOT A;  3U9F A;  3MAE A;  2VSQ A;  1L5A A;  1E2O A;  2JGP A;  1DPD A;  2XHG A;  3B30 A;  1Q23 A;  3L60 A;  1XMC A;  1EAD A;  4HVM A;  3U9B A;  1Q9J A;  5FAL A;  3FP0 A;  5KJT A;  2ZBA A;  1PD5 A;  1DPB A;  1NOC B;  1QCA A;  2II5 A;  1EAF A;  2RKT A;  3B2S A;  5KJV A;  2E1T A;  1DPC A;  1SCZ A;  4KEC A;  2CLA A;  4CLA A;  5KJW A;  1C4T A;  1EAE A;  4JN3 A;  2RKV A;  2E1U A;  1EAB A;  1CIA A;  2XR7 A;  4KE4 A;  5FAN A;  5T3E A;  2II3 A;  5KJS A;  4JN5 A;  2IHW A;  4N72 A;  1XMD A; 
#chains in the Genus database with same CATH topology
 1T7N A;  4G2M A;  2FY5 A;  3CLA A;  3L60 A;  1XMC A;  4HVM A;  1Q9J A;  5KJT A;  2ZBA A;  1T1U A;  2FY2 A;  5KJV A;  4KEC A;  2CLA A;  1C4T A;  2RKV A;  5T3E A;  5KJS A;  4JN5 A;  2IHW A;  1XL8 A;  2I9D A;  2H3W A;  2E1V A;  1EAA A;  4EPH A;  5KJU A;  5DU9 A;  3FOT A;  3MAE A;  2VSQ A;  1L5A A;  2JGP A;  1Q23 A;  3U9B A;  1Q6X A;  1NOC B;  2RKT A;  3B2S A;  1EAF A;  2E1T A;  4CLA A;  2FY4 A;  1EAE A;  2XR7 A;  1EAB A;  4KE4 A;  2II3 A;  4N72 A;  1EAC A;  1S5O A;  2II4 A;  2H3P A;  4G0B A;  5DUA A;  2BGH A;  3U9F A;  2XHG A;  1EAD A;  2FYO A;  1PD5 A;  4EYW A;  1NDI A;  1SCZ A;  5KJW A;  2H4T A;  5FAN A;  2E1U A;  1CIA A;  1NM8 A;  1CLA A;  4G22 A;  1XL7 A;  2DEB A;  2FY3 A;  4EP9 A;  1E2O A;  1DPD A;  3B30 A;  1T7Q A;  5FAL A;  2RCU A;  3FP0 A;  1DPB A;  1QCA A;  2II5 A;  2H3U A;  1DPC A;  2FW3 A;  1NDB A;  1NDF A;  4JN3 A;  1T7O A;  1XMD A; 
#chains in the Genus database with same CATH homology
 1EAC A;  1CLA A;  1XL8 A;  2I9D A;  2E1V A;  2II4 A;  4G22 A;  1EAA A;  1XL7 A;  4G2M A;  5KJU A;  3CLA A;  5DU9 A;  4G0B A;  5DUA A;  2BGH A;  3FOT A;  3U9F A;  3MAE A;  2VSQ A;  1L5A A;  1E2O A;  2JGP A;  1DPD A;  2XHG A;  3B30 A;  1Q23 A;  3L60 A;  1XMC A;  1EAD A;  4HVM A;  3U9B A;  1Q9J A;  5FAL A;  3FP0 A;  5KJT A;  2ZBA A;  1PD5 A;  1DPB A;  1NOC B;  1QCA A;  2II5 A;  1EAF A;  2RKT A;  3B2S A;  5KJV A;  2E1T A;  1DPC A;  1SCZ A;  4KEC A;  2CLA A;  4CLA A;  5KJW A;  1C4T A;  1EAE A;  4JN3 A;  2RKV A;  2E1U A;  1EAB A;  1CIA A;  2XR7 A;  4KE4 A;  5FAN A;  5T3E A;  2II3 A;  5KJS A;  4JN5 A;  2IHW A;  4N72 A;  1XMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...