3U9BA

Structure of apo-cati
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
216
structure length
216
Chain Sequence
EKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFLKTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSSLWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANMDNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chloramphenicol acetyltransferase
publication title The structural basis for substrate versatility of chloramphenicol acetyltransferase CAT(I).
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 51
structure length 216
sequence length 216
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature ec 2.3.1.28: Chloramphenicol O-acetyltransferase.
pdb deposition date 2011-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00302 CAT Chloramphenicol acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 3u9bA00
3FP0A 4N72A 1Q9JA 2I9DA 5FANA 1EAAA 3L60A 1EADA 4G2MA 1Q23A 1EAEA 2RKTA 1EABA 2II5A 2CLAA 1PD5A 2VSQA 1DPBA 2ZBAA 5T3EA 1EAFA 3U9FA 4JN5A 4JN3A 1XL8A 5KJVA 1DPDA 1XMCA 1EACA 4HVMA 1SCZA 2E1TA 1XL7A 5FALA 3MAEA 1C4TA 1QCAA 2IHWA 3B30A 1NOCB 3U9BA 2E1UA 2E1VA 2RKVA 3CLAA 1CIAA 1XMDA 3FOTA 2XHGA 5DU9A 4KE4A 2BGHA 4G22A 2II4A 4KECA 5DUAA 4CLAA 5KJSA 4G0BA 1L5AA 5KJUA 2JGPA 5KJWA 1CLAA 2XR7A 3B2SA 2II3A 1DPCA 5KJTA 1E2OA
chains in the Genus database with same CATH superfamily
1Q9JA 1EAAA 1EADA 2CLAA 1EAFA 5KJVA 4JN3A 1XL8A 2H3WA 5FALA 1CIAA 5DU9A 4KE4A 2BGHA 2H3PA 1CLAA 2II3A 2FYOA 3FP0A 4N72A 1EABA 2II5A 1T1UA 2H4TA 2FW3A 1NDFA 4EP9A 1T7QA 1SCZA 3MAEA 2DEBA 3B30A 3U9BA 2E1VA 2XHGA 4G22A 2II4A 1T7NA 5KJSA 4G0BA 5KJWA 2XR7A 3B2SA 5FANA 1Q23A 5T3EA 1L5AA 2VSQA 1DPBA 2FY4A 4JN5A 1XMCA 4EPHA 1EACA 4EYWA 4HVMA 2RCUA 2E1TA 1XL7A 1C4TA 1NDIA 5DUAA 1T7OA 4CLAA 2FY3A 3FOTA 1E2OA 5KJTA 2I9DA 3L60A 4G2MA 1EAEA 1NDBA 2RKTA 1PD5A 2ZBAA 3U9FA 1DPDA 1Q6XA 1S5OA 2FY2A 1QCAA 2IHWA 1NOCB 2H3UA 2E1UA 2RKVA 3CLAA 1XMDA 4KECA 1NM8A 5KJUA 2JGPA 1DPCA 2FY5A
chains in the Genus database with same CATH topology
3FP0A 4N72A 1Q9JA 2I9DA 5FANA 1EAAA 3L60A 1EADA 4G2MA 1Q23A 1EAEA 2RKTA 1EABA 2II5A 2CLAA 1PD5A 2VSQA 1DPBA 2ZBAA 5T3EA 1EAFA 3U9FA 4JN5A 4JN3A 1XL8A 5KJVA 1DPDA 1XMCA 1EACA 4HVMA 1SCZA 2E1TA 1XL7A 5FALA 3MAEA 1C4TA 1QCAA 2IHWA 3B30A 1NOCB 3U9BA 2E1UA 2E1VA 2RKVA 3CLAA 1CIAA 1XMDA 3FOTA 2XHGA 5DU9A 4KE4A 2BGHA 4G22A 2II4A 4KECA 5DUAA 4CLAA 5KJSA 4G0BA 1L5AA 5KJUA 2JGPA 5KJWA 1CLAA 2XR7A 3B2SA 2II3A 1DPCA 5KJTA 1E2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FP0 A;  4N72 A;  1Q9J A;  2I9D A;  5FAN A;  1EAA A;  3L60 A;  1EAD A;  4G2M A;  1Q23 A;  1EAE A;  2RKT A;  1EAB A;  2II5 A;  2CLA A;  1PD5 A;  2VSQ A;  1DPB A;  2ZBA A;  5T3E A;  1EAF A;  3U9F A;  4JN5 A;  4JN3 A;  1XL8 A;  5KJV A;  1DPD A;  1XMC A;  1EAC A;  4HVM A;  1SCZ A;  2E1T A;  1XL7 A;  5FAL A;  3MAE A;  1C4T A;  1QCA A;  2IHW A;  3B30 A;  1NOC B;  3U9B A;  2E1U A;  2E1V A;  2RKV A;  3CLA A;  1CIA A;  1XMD A;  3FOT A;  2XHG A;  5DU9 A;  4KE4 A;  2BGH A;  4G22 A;  2II4 A;  4KEC A;  5DUA A;  4CLA A;  5KJS A;  4G0B A;  1L5A A;  5KJU A;  2JGP A;  5KJW A;  1CLA A;  2XR7 A;  3B2S A;  2II3 A;  1DPC A;  5KJT A;  1E2O A; 
#chains in the Genus database with same CATH topology
 1Q9J A;  1EAA A;  1EAD A;  2CLA A;  1EAF A;  5KJV A;  4JN3 A;  1XL8 A;  2H3W A;  5FAL A;  1CIA A;  5DU9 A;  4KE4 A;  2BGH A;  2H3P A;  1CLA A;  2II3 A;  2FYO A;  3FP0 A;  4N72 A;  1EAB A;  2II5 A;  1T1U A;  2H4T A;  2FW3 A;  1NDF A;  4EP9 A;  1T7Q A;  1SCZ A;  3MAE A;  2DEB A;  3B30 A;  3U9B A;  2E1V A;  2XHG A;  4G22 A;  2II4 A;  1T7N A;  5KJS A;  4G0B A;  5KJW A;  2XR7 A;  3B2S A;  5FAN A;  1Q23 A;  5T3E A;  1L5A A;  2VSQ A;  1DPB A;  2FY4 A;  4JN5 A;  1XMC A;  4EPH A;  1EAC A;  4EYW A;  4HVM A;  2RCU A;  2E1T A;  1XL7 A;  1C4T A;  1NDI A;  5DUA A;  1T7O A;  4CLA A;  2FY3 A;  3FOT A;  1E2O A;  5KJT A;  2I9D A;  3L60 A;  4G2M A;  1EAE A;  1NDB A;  2RKT A;  1PD5 A;  2ZBA A;  3U9F A;  1DPD A;  1Q6X A;  1S5O A;  2FY2 A;  1QCA A;  2IHW A;  1NOC B;  2H3U A;  2E1U A;  2RKV A;  3CLA A;  1XMD A;  4KEC A;  1NM8 A;  5KJU A;  2JGP A;  1DPC A;  2FY5 A; 
#chains in the Genus database with same CATH homology
 3FP0 A;  4N72 A;  1Q9J A;  2I9D A;  5FAN A;  1EAA A;  3L60 A;  1EAD A;  4G2M A;  1Q23 A;  1EAE A;  2RKT A;  1EAB A;  2II5 A;  2CLA A;  1PD5 A;  2VSQ A;  1DPB A;  2ZBA A;  5T3E A;  1EAF A;  3U9F A;  4JN5 A;  4JN3 A;  1XL8 A;  5KJV A;  1DPD A;  1XMC A;  1EAC A;  4HVM A;  1SCZ A;  2E1T A;  1XL7 A;  5FAL A;  3MAE A;  1C4T A;  1QCA A;  2IHW A;  3B30 A;  1NOC B;  3U9B A;  2E1U A;  2E1V A;  2RKV A;  3CLA A;  1CIA A;  1XMD A;  3FOT A;  2XHG A;  5DU9 A;  4KE4 A;  2BGH A;  4G22 A;  2II4 A;  4KEC A;  5DUA A;  4CLA A;  5KJS A;  4G0B A;  1L5A A;  5KJU A;  2JGP A;  5KJW A;  1CLA A;  2XR7 A;  3B2S A;  2II3 A;  1DPC A;  5KJT A;  1E2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...