5KJWA

Crystal structure of coleus blumei hct in complex with 3-hydroxyacetophenone
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
427
structure length
425
Chain Sequence
b'MKIHVRDSTLVRPSAATPAVSLWNSNVDLVVPNFHTPSVYFYRPSGADNFFDTAVMKAALGRALVSFYPMAGRLKRDEDGRVEIDCNAEGVLFVEAESDGTVDDYGDFAPSLELRRLIPAVDYSQGISAYPLLVLQVTFFKCGGVSLGVGMQHHAADGFSGLHFINTWSDMARGLDITLPPFIDRTLLSARDPPQPQFKHVEYQPPPAMKTYEPAETVVSIFKLTKDQLTTLKAKSKEDGNTYSSYEMLSGHVWRCTCLARGLPEEQETKLYIATDGRSRLQPQLPPGYFGNVIFTATPLAVAGDLGSKPVWYAASKIHDALARMDNDYLRSALDFLELQPDLKALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFVLPSPTNDGSLSVAISLQAEHMKLFEKLLYQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxycinnamoyl transferase
publication title Dynamic Conformational States Dictate Selectivity toward the Native Substrate in a Substrate-Permissive Acyltransferase.
pubmed doi rcsb
source organism Solenostemon scutellarioides
molecule tags Transferase
total genus 127
structure length 425
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.3.1.133: Shikimate O-hydroxycinnamoyltransferase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02458 Transferase Transferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 5kjwA02
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 5kjwA01
3FOTA 1E2OA 5DU9A 1Q9JA 3L60A 4G22A 1CIAA 2ZBAA 1DPCA 1EAFA 4JN3A 2VSQA 4CLAA 1XMCA 4HVMA 2E1VA 5KJTA 1NOCB 1CLAA 3B2SA 2CLAA 3CLAA 4KECA 3U9BA 1C4TA 5KJWA 1SCZA 5FALA 5KJSA 1DPDA 5KJVA 2II3A 2JGPA 1EACA 1EABA 4G0BA 4G2MA 5DUAA 1EADA 1PD5A 1XL7A 2E1UA 2I9DA 2IHWA 3B30A 1QCAA 3U9FA 2RKTA 3FP0A 1L5AA 5KJUA 1EAAA 4N72A 2BGHA 2XHGA 1Q23A 1EAEA 2II5A 2II4A 4KE4A 1XMDA 2XR7A 1DPBA 4JN5A 5T3EA 3MAEA 5FANA 2E1TA 1XL8A 2RKVA
chains in the Genus database with same CATH superfamily
3FOTA 2FY3A 5DU9A 1CIAA 5KJTA 5KJSA 2JGPA 2RCUA 1T7QA 5DUAA 1T7OA 1EADA 2DEBA 2IHWA 1L5AA 1EAAA 1NDFA 2FW3A 1DPBA 4JN5A 2FY5A 2FYOA 1XL8A 3U9BA 1NM8A 2RKVA 1EAFA 4JN3A 2VSQA 3B2SA 5KJVA 1EABA 4G0BA 2E1UA 2I9DA 1S5OA 1QCAA 3FP0A 2BGHA 1EAEA 2II5A 4KE4A 1XMDA 3MAEA 2H4TA 2E1TA 1Q9JA 4G22A 2ZBAA 4CLAA 1XMCA 1T7NA 2FY2A 1CLAA 4KECA 2CLAA 3CLAA 1SCZA 5FALA 2II3A 2H3PA 1XL7A 1NDBA 2H3UA 2RKTA 5KJUA 2FY4A 2II4A 2H3WA 4EPHA 2XR7A 5FANA 1Q6XA 1E2OA 3L60A 4EYWA 1NDIA 4HVMA 1DPCA 4EP9A 2E1VA 1NOCB 5KJWA 1C4TA 1DPDA 1EACA 4G2MA 1PD5A 3B30A 3U9FA 1T1UA 4N72A 2XHGA 1Q23A 5T3EA
chains in the Genus database with same CATH topology
3FOTA 1E2OA 5DU9A 1Q9JA 3L60A 4G22A 1CIAA 2ZBAA 1DPCA 1EAFA 4JN3A 2VSQA 4CLAA 1XMCA 4HVMA 2E1VA 5KJTA 1NOCB 1CLAA 3B2SA 2CLAA 3CLAA 4KECA 3U9BA 1C4TA 5KJWA 1SCZA 5FALA 5KJSA 1DPDA 5KJVA 2II3A 2JGPA 1EACA 1EABA 4G0BA 4G2MA 5DUAA 1EADA 1PD5A 1XL7A 2E1UA 2I9DA 2IHWA 3B30A 1QCAA 3U9FA 2RKTA 3FP0A 1L5AA 5KJUA 1EAAA 4N72A 2BGHA 2XHGA 1Q23A 1EAEA 2II5A 2II4A 4KE4A 1XMDA 2XR7A 1DPBA 4JN5A 5T3EA 3MAEA 5FANA 2E1TA 1XL8A 2RKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FOT A;  1E2O A;  5DU9 A;  1Q9J A;  3L60 A;  4G22 A;  1CIA A;  2ZBA A;  1DPC A;  1EAF A;  4JN3 A;  2VSQ A;  4CLA A;  1XMC A;  4HVM A;  2E1V A;  5KJT A;  1NOC B;  1CLA A;  3B2S A;  2CLA A;  3CLA A;  4KEC A;  3U9B A;  1C4T A;  5KJW A;  1SCZ A;  5FAL A;  5KJS A;  1DPD A;  5KJV A;  2II3 A;  2JGP A;  1EAC A;  1EAB A;  4G0B A;  4G2M A;  5DUA A;  1EAD A;  1PD5 A;  1XL7 A;  2E1U A;  2I9D A;  2IHW A;  3B30 A;  1QCA A;  3U9F A;  2RKT A;  3FP0 A;  1L5A A;  5KJU A;  1EAA A;  4N72 A;  2BGH A;  2XHG A;  1Q23 A;  1EAE A;  2II5 A;  2II4 A;  4KE4 A;  1XMD A;  2XR7 A;  1DPB A;  4JN5 A;  5T3E A;  3MAE A;  5FAN A;  2E1T A;  1XL8 A;  2RKV A; 
#chains in the Genus database with same CATH topology
 3FOT A;  2FY3 A;  5DU9 A;  1CIA A;  5KJT A;  5KJS A;  2JGP A;  2RCU A;  1T7Q A;  5DUA A;  1T7O A;  1EAD A;  2DEB A;  2IHW A;  1L5A A;  1EAA A;  1NDF A;  2FW3 A;  1DPB A;  4JN5 A;  2FY5 A;  2FYO A;  1XL8 A;  3U9B A;  1NM8 A;  2RKV A;  1EAF A;  4JN3 A;  2VSQ A;  3B2S A;  5KJV A;  1EAB A;  4G0B A;  2E1U A;  2I9D A;  1S5O A;  1QCA A;  3FP0 A;  2BGH A;  1EAE A;  2II5 A;  4KE4 A;  1XMD A;  3MAE A;  2H4T A;  2E1T A;  1Q9J A;  4G22 A;  2ZBA A;  4CLA A;  1XMC A;  1T7N A;  2FY2 A;  1CLA A;  4KEC A;  2CLA A;  3CLA A;  1SCZ A;  5FAL A;  2II3 A;  2H3P A;  1XL7 A;  1NDB A;  2H3U A;  2RKT A;  5KJU A;  2FY4 A;  2II4 A;  2H3W A;  4EPH A;  2XR7 A;  5FAN A;  1Q6X A;  1E2O A;  3L60 A;  4EYW A;  1NDI A;  4HVM A;  1DPC A;  4EP9 A;  2E1V A;  1NOC B;  5KJW A;  1C4T A;  1DPD A;  1EAC A;  4G2M A;  1PD5 A;  3B30 A;  3U9F A;  1T1U A;  4N72 A;  2XHG A;  1Q23 A;  5T3E A; 
#chains in the Genus database with same CATH homology
 3FOT A;  1E2O A;  5DU9 A;  1Q9J A;  3L60 A;  4G22 A;  1CIA A;  2ZBA A;  1DPC A;  1EAF A;  4JN3 A;  2VSQ A;  4CLA A;  1XMC A;  4HVM A;  2E1V A;  5KJT A;  1NOC B;  1CLA A;  3B2S A;  2CLA A;  3CLA A;  4KEC A;  3U9B A;  1C4T A;  5KJW A;  1SCZ A;  5FAL A;  5KJS A;  1DPD A;  5KJV A;  2II3 A;  2JGP A;  1EAC A;  1EAB A;  4G0B A;  4G2M A;  5DUA A;  1EAD A;  1PD5 A;  1XL7 A;  2E1U A;  2I9D A;  2IHW A;  3B30 A;  1QCA A;  3U9F A;  2RKT A;  3FP0 A;  1L5A A;  5KJU A;  1EAA A;  4N72 A;  2BGH A;  2XHG A;  1Q23 A;  1EAE A;  2II5 A;  2II4 A;  4KE4 A;  1XMD A;  2XR7 A;  1DPB A;  4JN5 A;  5T3E A;  3MAE A;  5FAN A;  2E1T A;  1XL8 A;  2RKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...