5KJWA

Crystal structure of coleus blumei hct in complex with 3-hydroxyacetophenone
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
427
structure length
425
Chain Sequence
MKIHVRDSTLVRPSAATPAVSLWNSNVDLVVPNFHTPSVYFYRPSGADNFFDTAVMKAALGRALVSFYPMAGRLKRDEDGRVEIDCNAEGVLFVEAESDGTVDDYGDFAPSLELRRLIPAVDYSQGISAYPLLVLQVTFFKCGGVSLGVGMQHHAADGFSGLHFINTWSDMARGLDITLPPFIDRTLLSARDPPQPQFKHVEYQPPPAMKTYEPAETVVSIFKLTKDQLTTLKAKSKEDGNTYSSYEMLSGHVWRCTCLARGLPEEQETKLYIATDGRSRLQPQLPPGYFGNVIFTATPLAVAGDLGSKPVWYAASKIHDALARMDNDYLRSALDFLELQPDLKALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFVLPSPTNDGSLSVAISLQAEHMKLFEKLLYQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Hydroxycinnamoyl transferase
publication title Dynamic Conformational States Dictate Selectivity toward the Native Substrate in a Substrate-Permissive Acyltransferase.
pubmed doi rcsb
source organism Solenostemon scutellarioides
total genus 127
structure length 425
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.3.1.133: Shikimate O-hydroxycinnamoyltransferase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02458 Transferase Transferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 5kjwA02
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 5kjwA01
4G2MA 4HVMA 2VSQA 4JN5A 3MAEA 5KJSA 1E2OA 1EAFA 1XL8A 2II4A 3FP0A 2BGHA 1EAEA 1CIAA 1SCZA 4KE4A 1PD5A 2E1VA 3FOTA 5FANA 4G0BA 3B2SA 4CLAA 5KJVA 5KJTA 4JN3A 1DPCA 2II3A 2XHGA 5DUAA 2XR7A 1CLAA 1XL7A 4G22A 1XMDA 5T3EA 3B30A 1EADA 2CLAA 2JGPA 1EABA 2ZBAA 3U9BA 1DPDA 1L5AA 2IHWA 3L60A 5KJWA 2I9DA 4KECA 1C4TA 1QCAA 3CLAA 2E1UA 3U9FA 1EACA 1DPBA 5KJUA 5FALA 2RKVA 2E1TA 2II5A 2RKTA 5DU9A 4N72A 1EAAA 1NOCB 1Q9JA 1Q23A 1XMCA
chains in the Genus database with same CATH superfamily
1E2OA 1NDIA 1XL8A 3FP0A 2BGHA 1CIAA 1SCZA 5KJTA 3FOTA 4JN3A 1DPCA 2II3A 1CLAA 1XMDA 2FY3A 2JGPA 4EP9A 3U9BA 1DPDA 1S5OA 1L5AA 2IHWA 3L60A 1C4TA 3CLAA 2FY4A 2II5A 4N72A 4HVMA 2VSQA 1T7QA 3MAEA 1EAFA 2II4A 2E1VA 3B2SA 5DUAA 1NDBA 2XR7A 4EYWA 1XL7A 1EADA 2ZBAA 1Q6XA 5KJWA 2E1UA 3U9FA 1EACA 2RKVA 2H3UA 1XMCA 1Q23A 2H3WA 2FW3A 1PD5A 4CLAA 4G0BA 2XHGA 2CLAA 1EABA 4EPHA 2DEBA 2I9DA 4KECA 1QCAA 2FY2A 2RCUA 5KJUA 1NDFA 5DU9A 4JN5A 1NM8A 4G2MA 5KJSA 1T7NA 1EAEA 5FANA 5KJVA 5T3EA 4G22A 3B30A 1T7OA 2H4TA 2H3PA 2FYOA 2FY5A 1DPBA 5FALA 1T1UA 2E1TA 2RKTA 1EAAA 1NOCB 1Q9JA 4KE4A
chains in the Genus database with same CATH topology
4G2MA 4HVMA 2VSQA 4JN5A 3MAEA 5KJSA 1E2OA 1EAFA 1XL8A 2II4A 3FP0A 2BGHA 1EAEA 1CIAA 1SCZA 4KE4A 1PD5A 2E1VA 3FOTA 5FANA 4G0BA 3B2SA 4CLAA 5KJVA 5KJTA 4JN3A 1DPCA 2II3A 2XHGA 5DUAA 2XR7A 1CLAA 1XL7A 4G22A 1XMDA 5T3EA 3B30A 1EADA 2CLAA 2JGPA 1EABA 2ZBAA 3U9BA 1DPDA 1L5AA 2IHWA 3L60A 5KJWA 2I9DA 4KECA 1C4TA 1QCAA 3CLAA 2E1UA 3U9FA 1EACA 1DPBA 5KJUA 5FALA 2RKVA 2E1TA 2II5A 2RKTA 5DU9A 4N72A 1EAAA 1NOCB 1Q9JA 1Q23A 1XMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G2M A;  4HVM A;  2VSQ A;  4JN5 A;  3MAE A;  5KJS A;  1E2O A;  1EAF A;  1XL8 A;  2II4 A;  3FP0 A;  2BGH A;  1EAE A;  1CIA A;  1SCZ A;  4KE4 A;  1PD5 A;  2E1V A;  3FOT A;  5FAN A;  4G0B A;  3B2S A;  4CLA A;  5KJV A;  5KJT A;  4JN3 A;  1DPC A;  2II3 A;  2XHG A;  5DUA A;  2XR7 A;  1CLA A;  1XL7 A;  4G22 A;  1XMD A;  5T3E A;  3B30 A;  1EAD A;  2CLA A;  2JGP A;  1EAB A;  2ZBA A;  3U9B A;  1DPD A;  1L5A A;  2IHW A;  3L60 A;  5KJW A;  2I9D A;  4KEC A;  1C4T A;  1QCA A;  3CLA A;  2E1U A;  3U9F A;  1EAC A;  1DPB A;  5KJU A;  5FAL A;  2RKV A;  2E1T A;  2II5 A;  2RKT A;  5DU9 A;  4N72 A;  1EAA A;  1NOC B;  1Q9J A;  1Q23 A;  1XMC A; 
#chains in the Genus database with same CATH topology
 1E2O A;  1NDI A;  1XL8 A;  3FP0 A;  2BGH A;  1CIA A;  1SCZ A;  5KJT A;  3FOT A;  4JN3 A;  1DPC A;  2II3 A;  1CLA A;  1XMD A;  2FY3 A;  2JGP A;  4EP9 A;  3U9B A;  1DPD A;  1S5O A;  1L5A A;  2IHW A;  3L60 A;  1C4T A;  3CLA A;  2FY4 A;  2II5 A;  4N72 A;  4HVM A;  2VSQ A;  1T7Q A;  3MAE A;  1EAF A;  2II4 A;  2E1V A;  3B2S A;  5DUA A;  1NDB A;  2XR7 A;  4EYW A;  1XL7 A;  1EAD A;  2ZBA A;  1Q6X A;  5KJW A;  2E1U A;  3U9F A;  1EAC A;  2RKV A;  2H3U A;  1XMC A;  1Q23 A;  2H3W A;  2FW3 A;  1PD5 A;  4CLA A;  4G0B A;  2XHG A;  2CLA A;  1EAB A;  4EPH A;  2DEB A;  2I9D A;  4KEC A;  1QCA A;  2FY2 A;  2RCU A;  5KJU A;  1NDF A;  5DU9 A;  4JN5 A;  1NM8 A;  4G2M A;  5KJS A;  1T7N A;  1EAE A;  5FAN A;  5KJV A;  5T3E A;  4G22 A;  3B30 A;  1T7O A;  2H4T A;  2H3P A;  2FYO A;  2FY5 A;  1DPB A;  5FAL A;  1T1U A;  2E1T A;  2RKT A;  1EAA A;  1NOC B;  1Q9J A;  4KE4 A; 
#chains in the Genus database with same CATH homology
 4G2M A;  4HVM A;  2VSQ A;  4JN5 A;  3MAE A;  5KJS A;  1E2O A;  1EAF A;  1XL8 A;  2II4 A;  3FP0 A;  2BGH A;  1EAE A;  1CIA A;  1SCZ A;  4KE4 A;  1PD5 A;  2E1V A;  3FOT A;  5FAN A;  4G0B A;  3B2S A;  4CLA A;  5KJV A;  5KJT A;  4JN3 A;  1DPC A;  2II3 A;  2XHG A;  5DUA A;  2XR7 A;  1CLA A;  1XL7 A;  4G22 A;  1XMD A;  5T3E A;  3B30 A;  1EAD A;  2CLA A;  2JGP A;  1EAB A;  2ZBA A;  3U9B A;  1DPD A;  1L5A A;  2IHW A;  3L60 A;  5KJW A;  2I9D A;  4KEC A;  1C4T A;  1QCA A;  3CLA A;  2E1U A;  3U9F A;  1EAC A;  1DPB A;  5KJU A;  5FAL A;  2RKV A;  2E1T A;  2II5 A;  2RKT A;  5DU9 A;  4N72 A;  1EAA A;  1NOC B;  1Q9J A;  1Q23 A;  1XMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...