5KJWA

Crystal structure of coleus blumei hct in complex with 3-hydroxyacetophenone
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
427
structure length
425
Chain Sequence
MKIHVRDSTLVRPSAATPAVSLWNSNVDLVVPNFHTPSVYFYRPSGADNFFDTAVMKAALGRALVSFYPMAGRLKRDEDGRVEIDCNAEGVLFVEAESDGTVDDYGDFAPSLELRRLIPAVDYSQGISAYPLLVLQVTFFKCGGVSLGVGMQHHAADGFSGLHFINTWSDMARGLDITLPPFIDRTLLSARDPPQPQFKHVEYQPPPAMKTYEPAETVVSIFKLTKDQLTTLKAKSKEDGNTYSSYEMLSGHVWRCTCLARGLPEEQETKLYIATDGRSRLQPQLPPGYFGNVIFTATPLAVAGDLGSKPVWYAASKIHDALARMDNDYLRSALDFLELQPDLKALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFVLPSPTNDGSLSVAISLQAEHMKLFEKLLYQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxycinnamoyl transferase
publication title Dynamic Conformational States Dictate Selectivity toward the Native Substrate in a Substrate-Permissive Acyltransferase.
pubmed doi rcsb
source organism Solenostemon scutellarioides
molecule tags Transferase
total genus 127
structure length 425
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.3.1.133: Shikimate O-hydroxycinnamoyltransferase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02458 Transferase Transferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 5kjwA02
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 5kjwA01
1XMDA 3B30A 1NOCB 4JN5A 2E1TA 2XR7A 4CLAA 2RKVA 4KECA 1EADA 2BGHA 4KE4A 2E1VA 1DPDA 1Q23A 4G0BA 1C4TA 1XL8A 4JN3A 3U9FA 1EAEA 5FANA 5KJTA 3CLAA 2I9DA 5DU9A 1L5AA 3U9BA 1E2OA 4G2MA 4N72A 5KJUA 5KJVA 1XL7A 1EAAA 3FOTA 2II5A 1SCZA 2IHWA 2ZBAA 1EAFA 1Q9JA 1DPCA 1EABA 1EACA 1QCAA 2CLAA 3B2SA 3MAEA 2XHGA 4HVMA 1DPBA 5KJWA 1CIAA 2VSQA 5DUAA 2RKTA 3FP0A 1CLAA 2E1UA 3L60A 5KJSA 2JGPA 4G22A 5T3EA 2II4A 2II3A 1XMCA 5FALA 1PD5A
chains in the Genus database with same CATH superfamily
1T1UA 2E1TA 2E1VA 4G0BA 4JN3A 3CLAA 2I9DA 2FY5A 1NM8A 4G2MA 2H3PA 3FOTA 1SCZA 1DPCA 2CLAA 3MAEA 4EPHA 2FY2A 4EP9A 5KJSA 2RCUA 1XMDA 2FYOA 4JN5A 4KECA 2BGHA 4KE4A 1DPDA 1T7QA 1T7OA 5DU9A 1L5AA 1E2OA 1S5OA 2IHWA 3B2SA 1EACA 1QCAA 5KJWA 2RKTA 3FP0A 1CLAA 2II4A 1NDBA 2H3UA 5FALA 2H3WA 1EADA 2FY4A 1Q23A 1C4TA 1EAEA 2DEBA 3U9BA 1NDFA 4N72A 5KJUA 5KJVA 1XL7A 1EAAA 1EAFA 2XHGA 4HVMA 1DPBA 1CIAA 5DUAA 1NDIA 1T7NA 2JGPA 2VSQA 2II3A 1XMCA 5KJTA 1PD5A 3B30A 1NOCB 2XR7A 4CLAA 2RKVA 1Q6XA 2FY3A 1XL8A 3U9FA 5FANA 2FW3A 2II5A 2ZBAA 2H4TA 1Q9JA 1EABA 4EYWA 2E1UA 3L60A 4G22A 5T3EA
chains in the Genus database with same CATH topology
1XMDA 3B30A 1NOCB 4JN5A 2E1TA 2XR7A 4CLAA 2RKVA 4KECA 1EADA 2BGHA 4KE4A 2E1VA 1DPDA 1Q23A 4G0BA 1C4TA 1XL8A 4JN3A 3U9FA 1EAEA 5FANA 5KJTA 3CLAA 2I9DA 5DU9A 1L5AA 3U9BA 1E2OA 4G2MA 4N72A 5KJUA 5KJVA 1XL7A 1EAAA 3FOTA 2II5A 1SCZA 2IHWA 2ZBAA 1EAFA 1Q9JA 1DPCA 1EABA 1EACA 1QCAA 2CLAA 3B2SA 3MAEA 2XHGA 4HVMA 1DPBA 5KJWA 1CIAA 2VSQA 5DUAA 2RKTA 3FP0A 1CLAA 2E1UA 3L60A 5KJSA 2JGPA 4G22A 5T3EA 2II4A 2II3A 1XMCA 5FALA 1PD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMD A;  3B30 A;  1NOC B;  4JN5 A;  2E1T A;  2XR7 A;  4CLA A;  2RKV A;  4KEC A;  1EAD A;  2BGH A;  4KE4 A;  2E1V A;  1DPD A;  1Q23 A;  4G0B A;  1C4T A;  1XL8 A;  4JN3 A;  3U9F A;  1EAE A;  5FAN A;  5KJT A;  3CLA A;  2I9D A;  5DU9 A;  1L5A A;  3U9B A;  1E2O A;  4G2M A;  4N72 A;  5KJU A;  5KJV A;  1XL7 A;  1EAA A;  3FOT A;  2II5 A;  1SCZ A;  2IHW A;  2ZBA A;  1EAF A;  1Q9J A;  1DPC A;  1EAB A;  1EAC A;  1QCA A;  2CLA A;  3B2S A;  3MAE A;  2XHG A;  4HVM A;  1DPB A;  5KJW A;  1CIA A;  2VSQ A;  5DUA A;  2RKT A;  3FP0 A;  1CLA A;  2E1U A;  3L60 A;  5KJS A;  2JGP A;  4G22 A;  5T3E A;  2II4 A;  2II3 A;  1XMC A;  5FAL A;  1PD5 A; 
#chains in the Genus database with same CATH topology
 1T1U A;  2E1T A;  2E1V A;  4G0B A;  4JN3 A;  3CLA A;  2I9D A;  2FY5 A;  1NM8 A;  4G2M A;  2H3P A;  3FOT A;  1SCZ A;  1DPC A;  2CLA A;  3MAE A;  4EPH A;  2FY2 A;  4EP9 A;  5KJS A;  2RCU A;  1XMD A;  2FYO A;  4JN5 A;  4KEC A;  2BGH A;  4KE4 A;  1DPD A;  1T7Q A;  1T7O A;  5DU9 A;  1L5A A;  1E2O A;  1S5O A;  2IHW A;  3B2S A;  1EAC A;  1QCA A;  5KJW A;  2RKT A;  3FP0 A;  1CLA A;  2II4 A;  1NDB A;  2H3U A;  5FAL A;  2H3W A;  1EAD A;  2FY4 A;  1Q23 A;  1C4T A;  1EAE A;  2DEB A;  3U9B A;  1NDF A;  4N72 A;  5KJU A;  5KJV A;  1XL7 A;  1EAA A;  1EAF A;  2XHG A;  4HVM A;  1DPB A;  1CIA A;  5DUA A;  1NDI A;  1T7N A;  2JGP A;  2VSQ A;  2II3 A;  1XMC A;  5KJT A;  1PD5 A;  3B30 A;  1NOC B;  2XR7 A;  4CLA A;  2RKV A;  1Q6X A;  2FY3 A;  1XL8 A;  3U9F A;  5FAN A;  2FW3 A;  2II5 A;  2ZBA A;  2H4T A;  1Q9J A;  1EAB A;  4EYW A;  2E1U A;  3L60 A;  4G22 A;  5T3E A; 
#chains in the Genus database with same CATH homology
 1XMD A;  3B30 A;  1NOC B;  4JN5 A;  2E1T A;  2XR7 A;  4CLA A;  2RKV A;  4KEC A;  1EAD A;  2BGH A;  4KE4 A;  2E1V A;  1DPD A;  1Q23 A;  4G0B A;  1C4T A;  1XL8 A;  4JN3 A;  3U9F A;  1EAE A;  5FAN A;  5KJT A;  3CLA A;  2I9D A;  5DU9 A;  1L5A A;  3U9B A;  1E2O A;  4G2M A;  4N72 A;  5KJU A;  5KJV A;  1XL7 A;  1EAA A;  3FOT A;  2II5 A;  1SCZ A;  2IHW A;  2ZBA A;  1EAF A;  1Q9J A;  1DPC A;  1EAB A;  1EAC A;  1QCA A;  2CLA A;  3B2S A;  3MAE A;  2XHG A;  4HVM A;  1DPB A;  5KJW A;  1CIA A;  2VSQ A;  5DUA A;  2RKT A;  3FP0 A;  1CLA A;  2E1U A;  3L60 A;  5KJS A;  2JGP A;  4G22 A;  5T3E A;  2II4 A;  2II3 A;  1XMC A;  5FAL A;  1PD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...