4N72A

Catalytic domain from dihydrolipoamide acetyltransferase of pyruvate dehydrogenase from escherichia coli
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
246
structure length
246
Chain Sequence
PGMLPWPKVDFSKFGEIEEVELGRIQKISGANLSRNWVMIPHVTHFDKTDITELEAFRKQQNEEAAKRKLDVKITPVVFIMKAVAAALEQMPRFNSSLSEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKGIIELSRELMTISKKARDGKLTAGEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMLPISLSFDHRVIDGADGARFITIINNTLSDIRRLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pyruvate dehydrogenase (Dihydrolipoyltransacetylase componen
publication title Structure and Function of the Catalytic Domain of the Dihydrolipoyl Acetyltransferase Component in Escherichia coli Pyruvate Dehydrogenase Complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 71
structure length 246
sequence length 246
chains with identical sequence B, C
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2013-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 4n72A00
4KECA 1XL7A 3U9FA 2XR7A 1XL8A 5KJWA 1EACA 1L5AA 2JGPA 4CLAA 1EAAA 4G2MA 4JN5A 2E1TA 1Q9JA 1CIAA 1EAEA 4HVMA 1NOCB 2RKVA 1EAFA 1DPBA 2I9DA 2XHGA 2ZBAA 4JN3A 4G22A 3FOTA 1DPCA 3L60A 5FANA 2IHWA 2II5A 1EADA 1XMDA 2CLAA 5KJTA 1DPDA 2II4A 2RKTA 2E1VA 5T3EA 1XMCA 3MAEA 2VSQA 5DU9A 3FP0A 5FALA 1Q23A 2II3A 1C4TA 2E1UA 4KE4A 1SCZA 4N72A 3U9BA 5KJVA 1EABA 1PD5A 1QCAA 5KJUA 3B2SA 4G0BA 2BGHA 5DUAA 3B30A 1CLAA 3CLAA 5KJSA 1E2OA
chains in the Genus database with same CATH superfamily
1L5AA 1NDFA 1NDBA 1NM8A 1EAEA 4HVMA 1EAFA 2H3PA 1T1UA 1DPCA 5FANA 1EADA 2FYOA 5FALA 4KE4A 5KJUA 4G0BA 3B30A 1E2OA 2H4TA 2XR7A 4JN5A 1T7OA 1NDIA 1Q9JA 1CIAA 4EYWA 2ZBAA 4JN3A 2II5A 1DPDA 5T3EA 1XMCA 2VSQA 3FP0A 1Q23A 1C4TA 1SCZA 3U9BA 1EABA 2BGHA 3CLAA 4KECA 1T7QA 1XL7A 3U9FA 5KJWA 4EPHA 1EACA 2JGPA 4G2MA 2DEBA 2E1TA 2FY4A 1DPBA 3FOTA 3L60A 4EP9A 2IHWA 2CLAA 2RKTA 1S5OA 2E1UA 1PD5A 1QCAA 2FY2A 3B2SA 5DUAA 2E1VA 2FY3A 1XL8A 1Q6XA 4CLAA 1EAAA 1NOCB 2RKVA 2I9DA 2FW3A 2RCUA 2XHGA 4G22A 2H3WA 5KJTA 2FY5A 1XMDA 2H3UA 2II4A 3MAEA 1T7NA 5DU9A 2II3A 4N72A 5KJVA 1CLAA 5KJSA
chains in the Genus database with same CATH topology
4KECA 1XL7A 3U9FA 2XR7A 1XL8A 5KJWA 1EACA 1L5AA 2JGPA 4CLAA 1EAAA 4G2MA 4JN5A 2E1TA 1Q9JA 1CIAA 1EAEA 4HVMA 1NOCB 2RKVA 1EAFA 1DPBA 2I9DA 2XHGA 2ZBAA 4JN3A 4G22A 3FOTA 1DPCA 3L60A 5FANA 2IHWA 2II5A 1EADA 1XMDA 2CLAA 5KJTA 1DPDA 2II4A 2RKTA 2E1VA 5T3EA 1XMCA 3MAEA 2VSQA 5DU9A 3FP0A 5FALA 1Q23A 2II3A 1C4TA 2E1UA 4KE4A 1SCZA 4N72A 3U9BA 5KJVA 1EABA 1PD5A 1QCAA 5KJUA 3B2SA 4G0BA 2BGHA 5DUAA 3B30A 1CLAA 3CLAA 5KJSA 1E2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KEC A;  1XL7 A;  3U9F A;  2XR7 A;  1XL8 A;  5KJW A;  1EAC A;  1L5A A;  2JGP A;  4CLA A;  1EAA A;  4G2M A;  4JN5 A;  2E1T A;  1Q9J A;  1CIA A;  1EAE A;  4HVM A;  1NOC B;  2RKV A;  1EAF A;  1DPB A;  2I9D A;  2XHG A;  2ZBA A;  4JN3 A;  4G22 A;  3FOT A;  1DPC A;  3L60 A;  5FAN A;  2IHW A;  2II5 A;  1EAD A;  1XMD A;  2CLA A;  5KJT A;  1DPD A;  2II4 A;  2RKT A;  2E1V A;  5T3E A;  1XMC A;  3MAE A;  2VSQ A;  5DU9 A;  3FP0 A;  5FAL A;  1Q23 A;  2II3 A;  1C4T A;  2E1U A;  4KE4 A;  1SCZ A;  4N72 A;  3U9B A;  5KJV A;  1EAB A;  1PD5 A;  1QCA A;  5KJU A;  3B2S A;  4G0B A;  2BGH A;  5DUA A;  3B30 A;  1CLA A;  3CLA A;  5KJS A;  1E2O A; 
#chains in the Genus database with same CATH topology
 1L5A A;  1NDF A;  1NDB A;  1NM8 A;  1EAE A;  4HVM A;  1EAF A;  2H3P A;  1T1U A;  1DPC A;  5FAN A;  1EAD A;  2FYO A;  5FAL A;  4KE4 A;  5KJU A;  4G0B A;  3B30 A;  1E2O A;  2H4T A;  2XR7 A;  4JN5 A;  1T7O A;  1NDI A;  1Q9J A;  1CIA A;  4EYW A;  2ZBA A;  4JN3 A;  2II5 A;  1DPD A;  5T3E A;  1XMC A;  2VSQ A;  3FP0 A;  1Q23 A;  1C4T A;  1SCZ A;  3U9B A;  1EAB A;  2BGH A;  3CLA A;  4KEC A;  1T7Q A;  1XL7 A;  3U9F A;  5KJW A;  4EPH A;  1EAC A;  2JGP A;  4G2M A;  2DEB A;  2E1T A;  2FY4 A;  1DPB A;  3FOT A;  3L60 A;  4EP9 A;  2IHW A;  2CLA A;  2RKT A;  1S5O A;  2E1U A;  1PD5 A;  1QCA A;  2FY2 A;  3B2S A;  5DUA A;  2E1V A;  2FY3 A;  1XL8 A;  1Q6X A;  4CLA A;  1EAA A;  1NOC B;  2RKV A;  2I9D A;  2FW3 A;  2RCU A;  2XHG A;  4G22 A;  2H3W A;  5KJT A;  2FY5 A;  1XMD A;  2H3U A;  2II4 A;  3MAE A;  1T7N A;  5DU9 A;  2II3 A;  4N72 A;  5KJV A;  1CLA A;  5KJS A; 
#chains in the Genus database with same CATH homology
 4KEC A;  1XL7 A;  3U9F A;  2XR7 A;  1XL8 A;  5KJW A;  1EAC A;  1L5A A;  2JGP A;  4CLA A;  1EAA A;  4G2M A;  4JN5 A;  2E1T A;  1Q9J A;  1CIA A;  1EAE A;  4HVM A;  1NOC B;  2RKV A;  1EAF A;  1DPB A;  2I9D A;  2XHG A;  2ZBA A;  4JN3 A;  4G22 A;  3FOT A;  1DPC A;  3L60 A;  5FAN A;  2IHW A;  2II5 A;  1EAD A;  1XMD A;  2CLA A;  5KJT A;  1DPD A;  2II4 A;  2RKT A;  2E1V A;  5T3E A;  1XMC A;  3MAE A;  2VSQ A;  5DU9 A;  3FP0 A;  5FAL A;  1Q23 A;  2II3 A;  1C4T A;  2E1U A;  4KE4 A;  1SCZ A;  4N72 A;  3U9B A;  5KJV A;  1EAB A;  1PD5 A;  1QCA A;  5KJU A;  3B2S A;  4G0B A;  2BGH A;  5DUA A;  3B30 A;  1CLA A;  3CLA A;  5KJS A;  1E2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...