4N72A

Catalytic domain from dihydrolipoamide acetyltransferase of pyruvate dehydrogenase from escherichia coli
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
246
structure length
246
Chain Sequence
b'PGMLPWPKVDFSKFGEIEEVELGRIQKISGANLSRNWVMIPHVTHFDKTDITELEAFRKQQNEEAAKRKLDVKITPVVFIMKAVAAALEQMPRFNSSLSEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKGIIELSRELMTISKKARDGKLTAGEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMLPISLSFDHRVIDGADGARFITIINNTLSDIRRLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pyruvate dehydrogenase (Dihydrolipoyltransacetylase componen
publication title Structure and Function of the Catalytic Domain of the Dihydrolipoyl Acetyltransferase Component in Escherichia coli Pyruvate Dehydrogenase Complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 71
structure length 246
sequence length 246
chains with identical sequence B, C
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2013-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 4n72A00
2E1TA 4G22A 1EAFA 2II3A 4KE4A 2I9DA 5KJTA 5DU9A 2XHGA 2XR7A 1NOCB 1Q23A 5FANA 3CLAA 1DPCA 4G0BA 5KJUA 1QCAA 2ZBAA 3FOTA 2CLAA 3U9BA 2II4A 1XL8A 1XMDA 4G2MA 2RKTA 1EAAA 2IHWA 1SCZA 3B30A 3FP0A 4JN3A 1XMCA 2II5A 2VSQA 5KJVA 4HVMA 1CLAA 2RKVA 3B2SA 1EABA 1EADA 5KJWA 3L60A 4CLAA 5FALA 1E2OA 4JN5A 5KJSA 4KECA 1EAEA 1XL7A 2E1UA 5DUAA 3U9FA 1DPBA 3MAEA 5T3EA 2BGHA 1Q9JA 1C4TA 1CIAA 1DPDA 4N72A 1L5AA 1EACA 2E1VA 2JGPA 1PD5A
chains in the Genus database with same CATH superfamily
2E1TA 4EYWA 2H3PA 2I9DA 1NOCB 3CLAA 1DPCA 4G0BA 5KJUA 2ZBAA 2CLAA 2H3UA 1XMDA 4G2MA 2IHWA 2FYOA 1EABA 3L60A 4JN5A 4KECA 2E1UA 5T3EA 2BGHA 1C4TA 2E1VA 1EAFA 4KE4A 5KJTA 5FANA 4EPHA 1QCAA 1XL8A 1T7NA 1NDBA 4JN3A 2II5A 4HVMA 1CLAA 2H4TA 3B2SA 1EADA 4CLAA 1E2OA 5KJSA 1S5OA 4N72A 2XR7A 2JGPA 2H3WA 4EP9A 2FW3A 2XHGA 1Q23A 2FY5A 3U9BA 2RKTA 3FP0A 1SCZA 1T7QA 1XMCA 5KJWA 1EAEA 1XL7A 1T1UA 1DPBA 3MAEA 1CIAA 1NM8A 1Q6XA 3B30A 1PD5A 2DEBA 4G22A 2II3A 5DU9A 3FOTA 2II4A 1NDFA 1EAAA 5KJVA 2VSQA 2FY4A 2RKVA 5FALA 5DUAA 3U9FA 1T7OA 2FY2A 2RCUA 2FY3A 1Q9JA 1DPDA 1NDIA 1L5AA 1EACA
chains in the Genus database with same CATH topology
2E1TA 4G22A 1EAFA 2II3A 4KE4A 2I9DA 5KJTA 5DU9A 2XHGA 2XR7A 1NOCB 1Q23A 5FANA 3CLAA 1DPCA 4G0BA 5KJUA 1QCAA 2ZBAA 3FOTA 2CLAA 3U9BA 2II4A 1XL8A 1XMDA 4G2MA 2RKTA 1EAAA 2IHWA 1SCZA 3B30A 3FP0A 4JN3A 1XMCA 2II5A 2VSQA 5KJVA 4HVMA 1CLAA 2RKVA 3B2SA 1EABA 1EADA 5KJWA 3L60A 4CLAA 5FALA 1E2OA 4JN5A 5KJSA 4KECA 1EAEA 1XL7A 2E1UA 5DUAA 3U9FA 1DPBA 3MAEA 5T3EA 2BGHA 1Q9JA 1C4TA 1CIAA 1DPDA 4N72A 1L5AA 1EACA 2E1VA 2JGPA 1PD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E1T A;  4G22 A;  1EAF A;  2II3 A;  4KE4 A;  2I9D A;  5KJT A;  5DU9 A;  2XHG A;  2XR7 A;  1NOC B;  1Q23 A;  5FAN A;  3CLA A;  1DPC A;  4G0B A;  5KJU A;  1QCA A;  2ZBA A;  3FOT A;  2CLA A;  3U9B A;  2II4 A;  1XL8 A;  1XMD A;  4G2M A;  2RKT A;  1EAA A;  2IHW A;  1SCZ A;  3B30 A;  3FP0 A;  4JN3 A;  1XMC A;  2II5 A;  2VSQ A;  5KJV A;  4HVM A;  1CLA A;  2RKV A;  3B2S A;  1EAB A;  1EAD A;  5KJW A;  3L60 A;  4CLA A;  5FAL A;  1E2O A;  4JN5 A;  5KJS A;  4KEC A;  1EAE A;  1XL7 A;  2E1U A;  5DUA A;  3U9F A;  1DPB A;  3MAE A;  5T3E A;  2BGH A;  1Q9J A;  1C4T A;  1CIA A;  1DPD A;  4N72 A;  1L5A A;  1EAC A;  2E1V A;  2JGP A;  1PD5 A; 
#chains in the Genus database with same CATH topology
 2E1T A;  4EYW A;  2H3P A;  2I9D A;  1NOC B;  3CLA A;  1DPC A;  4G0B A;  5KJU A;  2ZBA A;  2CLA A;  2H3U A;  1XMD A;  4G2M A;  2IHW A;  2FYO A;  1EAB A;  3L60 A;  4JN5 A;  4KEC A;  2E1U A;  5T3E A;  2BGH A;  1C4T A;  2E1V A;  1EAF A;  4KE4 A;  5KJT A;  5FAN A;  4EPH A;  1QCA A;  1XL8 A;  1T7N A;  1NDB A;  4JN3 A;  2II5 A;  4HVM A;  1CLA A;  2H4T A;  3B2S A;  1EAD A;  4CLA A;  1E2O A;  5KJS A;  1S5O A;  4N72 A;  2XR7 A;  2JGP A;  2H3W A;  4EP9 A;  2FW3 A;  2XHG A;  1Q23 A;  2FY5 A;  3U9B A;  2RKT A;  3FP0 A;  1SCZ A;  1T7Q A;  1XMC A;  5KJW A;  1EAE A;  1XL7 A;  1T1U A;  1DPB A;  3MAE A;  1CIA A;  1NM8 A;  1Q6X A;  3B30 A;  1PD5 A;  2DEB A;  4G22 A;  2II3 A;  5DU9 A;  3FOT A;  2II4 A;  1NDF A;  1EAA A;  5KJV A;  2VSQ A;  2FY4 A;  2RKV A;  5FAL A;  5DUA A;  3U9F A;  1T7O A;  2FY2 A;  2RCU A;  2FY3 A;  1Q9J A;  1DPD A;  1NDI A;  1L5A A;  1EAC A; 
#chains in the Genus database with same CATH homology
 2E1T A;  4G22 A;  1EAF A;  2II3 A;  4KE4 A;  2I9D A;  5KJT A;  5DU9 A;  2XHG A;  2XR7 A;  1NOC B;  1Q23 A;  5FAN A;  3CLA A;  1DPC A;  4G0B A;  5KJU A;  1QCA A;  2ZBA A;  3FOT A;  2CLA A;  3U9B A;  2II4 A;  1XL8 A;  1XMD A;  4G2M A;  2RKT A;  1EAA A;  2IHW A;  1SCZ A;  3B30 A;  3FP0 A;  4JN3 A;  1XMC A;  2II5 A;  2VSQ A;  5KJV A;  4HVM A;  1CLA A;  2RKV A;  3B2S A;  1EAB A;  1EAD A;  5KJW A;  3L60 A;  4CLA A;  5FAL A;  1E2O A;  4JN5 A;  5KJS A;  4KEC A;  1EAE A;  1XL7 A;  2E1U A;  5DUA A;  3U9F A;  1DPB A;  3MAE A;  5T3E A;  2BGH A;  1Q9J A;  1C4T A;  1CIA A;  1DPD A;  4N72 A;  1L5A A;  1EAC A;  2E1V A;  2JGP A;  1PD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...