1EAAA

Atomic structure of the cubic core of the pyruvate dehydrogenase multienzyme complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
243
structure length
243
Chain Sequence
IPPIPPVDFAKYGEIEEVPMTRLMQIGATNLHRSWLNVPHVTQFESADITELEAFRVAQKAVAKKAGVKLTVLPLLLKACAYLLKELPDFNSSLAPSGQALIRKKYVHIGFAVDTPDGLLVPVIRNVDQKSLLQLAAEAAELAEKARSKKLGADAMQGACFTISSLGHIGGTAFTPIVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLGDLLADIRAILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DIHYDROLIPOYL-TRANSACETYLASE
publication title Crystallographic analysis of substrate binding and catalysis in dihydrolipoyl transacetylase (E2p).
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Dihydrolipoamide acetyltransferase
total genus 67
structure length 243
sequence length 243
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1992-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1eaaA00
1XMCA 1DPBA 4N72A 5FALA 3MAEA 5KJUA 1DPDA 4KECA 5KJSA 1XL7A 1QCAA 1XL8A 4JN3A 1DPCA 4G22A 1EAFA 2VSQA 2BGHA 2CLAA 2JGPA 1CIAA 4G2MA 5KJVA 5T3EA 1SCZA 1C4TA 5FANA 2II5A 1PD5A 3CLAA 1EAAA 4JN5A 2E1TA 1Q23A 2II4A 3FP0A 2IHWA 4KE4A 4G0BA 2RKTA 5KJWA 2E1VA 5DUAA 1EAEA 1NOCB 1EABA 2E1UA 2XHGA 1XMDA 2XR7A 2ZBAA 3B30A 1Q9JA 3FOTA 3L60A 4HVMA 1E2OA 2RKVA 3U9BA 1EADA 2I9DA 3U9FA 5KJTA 3B2SA 5DU9A 4CLAA 2II3A 1CLAA 1EACA 1L5AA
chains in the Genus database with same CATH superfamily
1XMCA 1DPBA 4EP9A 1EAFA 2VSQA 2JGPA 2FY3A 3CLAA 1NM8A 4JN5A 1Q23A 2II4A 1NDIA 1NOCB 3U9BA 5KJTA 3MAEA 3FOTA 1L5AA 5FALA 1DPDA 4KECA 1XL7A 1XL8A 1T7NA 4JN3A 4G22A 2BGHA 2CLAA 5T3EA 2E1TA 4KE4A 2RKTA 2E1VA 1T7QA 1EABA 2ZBAA 2FW3A 2H3PA 1E2OA 2RKVA 3U9FA 1Q6XA 5DU9A 4CLAA 1EACA 5FANA 5KJUA 2DEBA 2FY4A 1DPCA 1NDBA 5KJVA 2FY2A 1PD5A 4EPHA 2FYOA 2IHWA 4G0BA 5KJWA 1NDFA 1EAEA 5DUAA 2E1UA 1Q9JA 2H3UA 2H4TA 3B2SA 4N72A 5KJSA 2II3A 1QCAA 1CIAA 4G2MA 1SCZA 1C4TA 2II5A 1EAAA 2RCUA 3FP0A 1S5OA 2FY5A 2H3WA 1T1UA 1XMDA 2XR7A 3L60A 3B30A 4HVMA 4EYWA 1EADA 2I9DA 1T7OA 2XHGA 1CLAA
chains in the Genus database with same CATH topology
1XMCA 1DPBA 4N72A 5FALA 3MAEA 5KJUA 1DPDA 4KECA 5KJSA 1XL7A 1QCAA 1XL8A 4JN3A 1DPCA 4G22A 1EAFA 2VSQA 2BGHA 2CLAA 2JGPA 1CIAA 4G2MA 5KJVA 5T3EA 1SCZA 1C4TA 5FANA 2II5A 1PD5A 3CLAA 1EAAA 4JN5A 2E1TA 1Q23A 2II4A 3FP0A 2IHWA 4KE4A 4G0BA 2RKTA 5KJWA 2E1VA 5DUAA 1EAEA 1NOCB 1EABA 2E1UA 2XHGA 1XMDA 2XR7A 2ZBAA 3B30A 1Q9JA 3FOTA 3L60A 4HVMA 1E2OA 2RKVA 3U9BA 1EADA 2I9DA 3U9FA 5KJTA 3B2SA 5DU9A 4CLAA 2II3A 1CLAA 1EACA 1L5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMC A;  1DPB A;  4N72 A;  5FAL A;  3MAE A;  5KJU A;  1DPD A;  4KEC A;  5KJS A;  1XL7 A;  1QCA A;  1XL8 A;  4JN3 A;  1DPC A;  4G22 A;  1EAF A;  2VSQ A;  2BGH A;  2CLA A;  2JGP A;  1CIA A;  4G2M A;  5KJV A;  5T3E A;  1SCZ A;  1C4T A;  5FAN A;  2II5 A;  1PD5 A;  3CLA A;  1EAA A;  4JN5 A;  2E1T A;  1Q23 A;  2II4 A;  3FP0 A;  2IHW A;  4KE4 A;  4G0B A;  2RKT A;  5KJW A;  2E1V A;  5DUA A;  1EAE A;  1NOC B;  1EAB A;  2E1U A;  2XHG A;  1XMD A;  2XR7 A;  2ZBA A;  3B30 A;  1Q9J A;  3FOT A;  3L60 A;  4HVM A;  1E2O A;  2RKV A;  3U9B A;  1EAD A;  2I9D A;  3U9F A;  5KJT A;  3B2S A;  5DU9 A;  4CLA A;  2II3 A;  1CLA A;  1EAC A;  1L5A A; 
#chains in the Genus database with same CATH topology
 1XMC A;  1DPB A;  4EP9 A;  1EAF A;  2VSQ A;  2JGP A;  2FY3 A;  3CLA A;  1NM8 A;  4JN5 A;  1Q23 A;  2II4 A;  1NDI A;  1NOC B;  3U9B A;  5KJT A;  3MAE A;  3FOT A;  1L5A A;  5FAL A;  1DPD A;  4KEC A;  1XL7 A;  1XL8 A;  1T7N A;  4JN3 A;  4G22 A;  2BGH A;  2CLA A;  5T3E A;  2E1T A;  4KE4 A;  2RKT A;  2E1V A;  1T7Q A;  1EAB A;  2ZBA A;  2FW3 A;  2H3P A;  1E2O A;  2RKV A;  3U9F A;  1Q6X A;  5DU9 A;  4CLA A;  1EAC A;  5FAN A;  5KJU A;  2DEB A;  2FY4 A;  1DPC A;  1NDB A;  5KJV A;  2FY2 A;  1PD5 A;  4EPH A;  2FYO A;  2IHW A;  4G0B A;  5KJW A;  1NDF A;  1EAE A;  5DUA A;  2E1U A;  1Q9J A;  2H3U A;  2H4T A;  3B2S A;  4N72 A;  5KJS A;  2II3 A;  1QCA A;  1CIA A;  4G2M A;  1SCZ A;  1C4T A;  2II5 A;  1EAA A;  2RCU A;  3FP0 A;  1S5O A;  2FY5 A;  2H3W A;  1T1U A;  1XMD A;  2XR7 A;  3L60 A;  3B30 A;  4HVM A;  4EYW A;  1EAD A;  2I9D A;  1T7O A;  2XHG A;  1CLA A; 
#chains in the Genus database with same CATH homology
 1XMC A;  1DPB A;  4N72 A;  5FAL A;  3MAE A;  5KJU A;  1DPD A;  4KEC A;  5KJS A;  1XL7 A;  1QCA A;  1XL8 A;  4JN3 A;  1DPC A;  4G22 A;  1EAF A;  2VSQ A;  2BGH A;  2CLA A;  2JGP A;  1CIA A;  4G2M A;  5KJV A;  5T3E A;  1SCZ A;  1C4T A;  5FAN A;  2II5 A;  1PD5 A;  3CLA A;  1EAA A;  4JN5 A;  2E1T A;  1Q23 A;  2II4 A;  3FP0 A;  2IHW A;  4KE4 A;  4G0B A;  2RKT A;  5KJW A;  2E1V A;  5DUA A;  1EAE A;  1NOC B;  1EAB A;  2E1U A;  2XHG A;  1XMD A;  2XR7 A;  2ZBA A;  3B30 A;  1Q9J A;  3FOT A;  3L60 A;  4HVM A;  1E2O A;  2RKV A;  3U9B A;  1EAD A;  2I9D A;  3U9F A;  5KJT A;  3B2S A;  5DU9 A;  4CLA A;  2II3 A;  1CLA A;  1EAC A;  1L5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...