1EAEA

Atomic structure of the cubic core of the pyruvate dehydrogenase multienzyme complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
243
structure length
243
Chain Sequence
IPPIPPVDFAKYGEIEEVPMTRLMQIGATNLHRSWLNVPHVTQFESADITELEAFRVAQKAVAKKAGVKLTVLPLLLKACAYLLKELPDFNSSLAPSGQALIRKKYVHIGFAVDTPDGLLVPVIRNVDQKSLLQLAAEAAELAEKARSKKLGADAMQGACFTISSLGHIGGTAFTPIVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLGDLLADIRAILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DIHYDROLIPOYL-TRANSACETYLASE
publication title Crystallographic analysis of substrate binding and catalysis in dihydrolipoyl transacetylase (E2p).
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Dihydrolipoamide acetyltransferase
total genus 67
structure length 243
sequence length 243
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1992-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1eaeA00
1EABA 4KECA 1XL7A 3FOTA 2IHWA 2ZBAA 1XMDA 2JGPA 3MAEA 1EAEA 3U9BA 5DUAA 2E1VA 2E1TA 2RKTA 1NOCB 3B2SA 4KE4A 1SCZA 4G22A 1CLAA 5FALA 1EAFA 2E1UA 5KJVA 2XR7A 2RKVA 1DPBA 2XHGA 4HVMA 5KJUA 3FP0A 1EAAA 4G2MA 1L5AA 1PD5A 2II3A 1XMCA 2VSQA 5FANA 2CLAA 1DPCA 3B30A 5T3EA 4G0BA 1CIAA 4CLAA 1DPDA 4JN5A 1EADA 5KJSA 1Q9JA 1EACA 2I9DA 1C4TA 2BGHA 3CLAA 3L60A 5KJWA 1Q23A 3U9FA 4N72A 5KJTA 5DU9A 4JN3A 2II5A 2II4A 1QCAA 1E2OA 1XL8A
chains in the Genus database with same CATH superfamily
1NDFA 3FOTA 3MAEA 2E1VA 1T7OA 1NOCB 3B2SA 4G22A 4EYWA 2E1UA 5KJUA 2FY5A 1T1UA 1XMCA 4EPHA 2VSQA 5FANA 3B30A 1EADA 1T7QA 1S5OA 5KJWA 1NDIA 1Q23A 2DEBA 1QCAA 1DPCA 4KECA 2ZBAA 1XMDA 2E1TA 2FY3A 2FYOA 2H3WA 1EAFA 2RKVA 2XHGA 3FP0A 1L5AA 4G2MA 2CLAA 4G0BA 1CIAA 1NDBA 1Q9JA 2I9DA 1C4TA 3U9FA 5DU9A 2RCUA 4EP9A 2II5A 1EACA 1NM8A 1E2OA 5KJTA 1EABA 1XL7A 2IHWA 2JGPA 5DUAA 2RKTA 1CLAA 5KJVA 4HVMA 1PD5A 4JN5A 2BGHA 3CLAA 3L60A 2H3UA 4N72A 4JN3A 2FW3A 2II4A 2H4TA 1EAEA 3U9BA 2FY2A 4KE4A 1SCZA 5FALA 2XR7A 1DPBA 2FY4A 1T7NA 1EAAA 2II3A 1Q6XA 5T3EA 4CLAA 1DPDA 5KJSA 2H3PA 1XL8A
chains in the Genus database with same CATH topology
1EABA 4KECA 1XL7A 3FOTA 2IHWA 2ZBAA 1XMDA 2JGPA 3MAEA 1EAEA 3U9BA 5DUAA 2E1VA 2E1TA 2RKTA 1NOCB 3B2SA 4KE4A 1SCZA 4G22A 1CLAA 5FALA 1EAFA 2E1UA 5KJVA 2XR7A 2RKVA 1DPBA 2XHGA 4HVMA 5KJUA 3FP0A 1EAAA 4G2MA 1L5AA 1PD5A 2II3A 1XMCA 2VSQA 5FANA 2CLAA 1DPCA 3B30A 5T3EA 4G0BA 1CIAA 4CLAA 1DPDA 4JN5A 1EADA 5KJSA 1Q9JA 1EACA 2I9DA 1C4TA 2BGHA 3CLAA 3L60A 5KJWA 1Q23A 3U9FA 4N72A 5KJTA 5DU9A 4JN3A 2II5A 2II4A 1QCAA 1E2OA 1XL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EAB A;  4KEC A;  1XL7 A;  3FOT A;  2IHW A;  2ZBA A;  1XMD A;  2JGP A;  3MAE A;  1EAE A;  3U9B A;  5DUA A;  2E1V A;  2E1T A;  2RKT A;  1NOC B;  3B2S A;  4KE4 A;  1SCZ A;  4G22 A;  1CLA A;  5FAL A;  1EAF A;  2E1U A;  5KJV A;  2XR7 A;  2RKV A;  1DPB A;  2XHG A;  4HVM A;  5KJU A;  3FP0 A;  1EAA A;  4G2M A;  1L5A A;  1PD5 A;  2II3 A;  1XMC A;  2VSQ A;  5FAN A;  2CLA A;  1DPC A;  3B30 A;  5T3E A;  4G0B A;  1CIA A;  4CLA A;  1DPD A;  4JN5 A;  1EAD A;  5KJS A;  1Q9J A;  1EAC A;  2I9D A;  1C4T A;  2BGH A;  3CLA A;  3L60 A;  5KJW A;  1Q23 A;  3U9F A;  4N72 A;  5KJT A;  5DU9 A;  4JN3 A;  2II5 A;  2II4 A;  1QCA A;  1E2O A;  1XL8 A; 
#chains in the Genus database with same CATH topology
 1NDF A;  3FOT A;  3MAE A;  2E1V A;  1T7O A;  1NOC B;  3B2S A;  4G22 A;  4EYW A;  2E1U A;  5KJU A;  2FY5 A;  1T1U A;  1XMC A;  4EPH A;  2VSQ A;  5FAN A;  3B30 A;  1EAD A;  1T7Q A;  1S5O A;  5KJW A;  1NDI A;  1Q23 A;  2DEB A;  1QCA A;  1DPC A;  4KEC A;  2ZBA A;  1XMD A;  2E1T A;  2FY3 A;  2FYO A;  2H3W A;  1EAF A;  2RKV A;  2XHG A;  3FP0 A;  1L5A A;  4G2M A;  2CLA A;  4G0B A;  1CIA A;  1NDB A;  1Q9J A;  2I9D A;  1C4T A;  3U9F A;  5DU9 A;  2RCU A;  4EP9 A;  2II5 A;  1EAC A;  1NM8 A;  1E2O A;  5KJT A;  1EAB A;  1XL7 A;  2IHW A;  2JGP A;  5DUA A;  2RKT A;  1CLA A;  5KJV A;  4HVM A;  1PD5 A;  4JN5 A;  2BGH A;  3CLA A;  3L60 A;  2H3U A;  4N72 A;  4JN3 A;  2FW3 A;  2II4 A;  2H4T A;  1EAE A;  3U9B A;  2FY2 A;  4KE4 A;  1SCZ A;  5FAL A;  2XR7 A;  1DPB A;  2FY4 A;  1T7N A;  1EAA A;  2II3 A;  1Q6X A;  5T3E A;  4CLA A;  1DPD A;  5KJS A;  2H3P A;  1XL8 A; 
#chains in the Genus database with same CATH homology
 1EAB A;  4KEC A;  1XL7 A;  3FOT A;  2IHW A;  2ZBA A;  1XMD A;  2JGP A;  3MAE A;  1EAE A;  3U9B A;  5DUA A;  2E1V A;  2E1T A;  2RKT A;  1NOC B;  3B2S A;  4KE4 A;  1SCZ A;  4G22 A;  1CLA A;  5FAL A;  1EAF A;  2E1U A;  5KJV A;  2XR7 A;  2RKV A;  1DPB A;  2XHG A;  4HVM A;  5KJU A;  3FP0 A;  1EAA A;  4G2M A;  1L5A A;  1PD5 A;  2II3 A;  1XMC A;  2VSQ A;  5FAN A;  2CLA A;  1DPC A;  3B30 A;  5T3E A;  4G0B A;  1CIA A;  4CLA A;  1DPD A;  4JN5 A;  1EAD A;  5KJS A;  1Q9J A;  1EAC A;  2I9D A;  1C4T A;  2BGH A;  3CLA A;  3L60 A;  5KJW A;  1Q23 A;  3U9F A;  4N72 A;  5KJT A;  5DU9 A;  4JN3 A;  2II5 A;  2II4 A;  1QCA A;  1E2O A;  1XL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...