1EAEA

Atomic structure of the cubic core of the pyruvate dehydrogenase multienzyme complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
243
structure length
243
Chain Sequence
b'IPPIPPVDFAKYGEIEEVPMTRLMQIGATNLHRSWLNVPHVTQFESADITELEAFRVAQKAVAKKAGVKLTVLPLLLKACAYLLKELPDFNSSLAPSGQALIRKKYVHIGFAVDTPDGLLVPVIRNVDQKSLLQLAAEAAELAEKARSKKLGADAMQGACFTISSLGHIGGTAFTPIVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLGDLLADIRAILL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DIHYDROLIPOYL-TRANSACETYLASE
publication title Crystallographic analysis of substrate binding and catalysis in dihydrolipoyl transacetylase (E2p).
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Dihydrolipoamide acetyltransferase
total genus 67
structure length 243
sequence length 243
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1992-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1eaeA00
2II5A 2E1TA 1XL7A 2E1VA 1PD5A 2XHGA 4JN3A 2JGPA 5T3EA 2II4A 4HVMA 2RKVA 5DU9A 5FALA 3L60A 1DPBA 5KJTA 1EADA 1EAAA 1XMCA 4G22A 3MAEA 1CLAA 4G0BA 4KECA 1XL8A 5FANA 2BGHA 5KJWA 1DPCA 3B2SA 2RKTA 4KE4A 5DUAA 1EABA 1EAFA 1XMDA 2CLAA 2XR7A 4JN5A 1Q23A 5KJUA 3FOTA 3B30A 1DPDA 1QCAA 2II3A 1Q9JA 4G2MA 5KJSA 1SCZA 1E2OA 4CLAA 1EAEA 2IHWA 1CIAA 3U9BA 5KJVA 3U9FA 1C4TA 2E1UA 4N72A 1L5AA 2VSQA 2ZBAA 1NOCB 3FP0A 3CLAA 1EACA 2I9DA
chains in the Genus database with same CATH superfamily
2FY2A 1T7OA 5DU9A 1DPBA 2H4TA 1XMCA 1CLAA 1XL8A 2RKTA 2CLAA 1DPDA 1Q9JA 1EAEA 1CIAA 3U9BA 1EACA 1NDIA 2FY4A 3FP0A 3CLAA 1T7NA 2II5A 2DEBA 2E1VA 2XHGA 2JGPA 2II4A 4HVMA 1EAAA 3B2SA 5DUAA 2H3WA 1Q23A 5KJUA 1T7QA 2II3A 4G2MA 5KJSA 2IHWA 4EP9A 3U9FA 2E1UA 1L5AA 1Q6XA 1XL7A 1PD5A 4JN3A 4EYWA 2RKVA 2H3UA 5KJTA 3MAEA 5FANA 5KJWA 1DPCA 1XMDA 1EAFA 4JN5A 3B30A 1SCZA 1E2OA 2H3PA 4CLAA 1T1UA 1S5OA 1C4TA 4N72A 2VSQA 2FW3A 1NOCB 2FY5A 2I9DA 2E1TA 1NM8A 5T3EA 5FALA 3L60A 1EADA 4G22A 4EPHA 4KECA 2BGHA 4KE4A 1EABA 2XR7A 1NDFA 3FOTA 2FY3A 1QCAA 2FYOA 2RCUA 1NDBA 5KJVA 2ZBAA 4G0BA
chains in the Genus database with same CATH topology
2II5A 2E1TA 1XL7A 2E1VA 1PD5A 2XHGA 4JN3A 2JGPA 5T3EA 2II4A 4HVMA 2RKVA 5DU9A 5FALA 3L60A 1DPBA 5KJTA 1EADA 1EAAA 1XMCA 4G22A 3MAEA 1CLAA 4G0BA 4KECA 1XL8A 5FANA 2BGHA 5KJWA 1DPCA 3B2SA 2RKTA 4KE4A 5DUAA 1EABA 1EAFA 1XMDA 2CLAA 2XR7A 4JN5A 1Q23A 5KJUA 3FOTA 3B30A 1DPDA 1QCAA 2II3A 1Q9JA 4G2MA 5KJSA 1SCZA 1E2OA 4CLAA 1EAEA 2IHWA 1CIAA 3U9BA 5KJVA 3U9FA 1C4TA 2E1UA 4N72A 1L5AA 2VSQA 2ZBAA 1NOCB 3FP0A 3CLAA 1EACA 2I9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2II5 A;  2E1T A;  1XL7 A;  2E1V A;  1PD5 A;  2XHG A;  4JN3 A;  2JGP A;  5T3E A;  2II4 A;  4HVM A;  2RKV A;  5DU9 A;  5FAL A;  3L60 A;  1DPB A;  5KJT A;  1EAD A;  1EAA A;  1XMC A;  4G22 A;  3MAE A;  1CLA A;  4G0B A;  4KEC A;  1XL8 A;  5FAN A;  2BGH A;  5KJW A;  1DPC A;  3B2S A;  2RKT A;  4KE4 A;  5DUA A;  1EAB A;  1EAF A;  1XMD A;  2CLA A;  2XR7 A;  4JN5 A;  1Q23 A;  5KJU A;  3FOT A;  3B30 A;  1DPD A;  1QCA A;  2II3 A;  1Q9J A;  4G2M A;  5KJS A;  1SCZ A;  1E2O A;  4CLA A;  1EAE A;  2IHW A;  1CIA A;  3U9B A;  5KJV A;  3U9F A;  1C4T A;  2E1U A;  4N72 A;  1L5A A;  2VSQ A;  2ZBA A;  1NOC B;  3FP0 A;  3CLA A;  1EAC A;  2I9D A; 
#chains in the Genus database with same CATH topology
 2FY2 A;  1T7O A;  5DU9 A;  1DPB A;  2H4T A;  1XMC A;  1CLA A;  1XL8 A;  2RKT A;  2CLA A;  1DPD A;  1Q9J A;  1EAE A;  1CIA A;  3U9B A;  1EAC A;  1NDI A;  2FY4 A;  3FP0 A;  3CLA A;  1T7N A;  2II5 A;  2DEB A;  2E1V A;  2XHG A;  2JGP A;  2II4 A;  4HVM A;  1EAA A;  3B2S A;  5DUA A;  2H3W A;  1Q23 A;  5KJU A;  1T7Q A;  2II3 A;  4G2M A;  5KJS A;  2IHW A;  4EP9 A;  3U9F A;  2E1U A;  1L5A A;  1Q6X A;  1XL7 A;  1PD5 A;  4JN3 A;  4EYW A;  2RKV A;  2H3U A;  5KJT A;  3MAE A;  5FAN A;  5KJW A;  1DPC A;  1XMD A;  1EAF A;  4JN5 A;  3B30 A;  1SCZ A;  1E2O A;  2H3P A;  4CLA A;  1T1U A;  1S5O A;  1C4T A;  4N72 A;  2VSQ A;  2FW3 A;  1NOC B;  2FY5 A;  2I9D A;  2E1T A;  1NM8 A;  5T3E A;  5FAL A;  3L60 A;  1EAD A;  4G22 A;  4EPH A;  4KEC A;  2BGH A;  4KE4 A;  1EAB A;  2XR7 A;  1NDF A;  3FOT A;  2FY3 A;  1QCA A;  2FYO A;  2RCU A;  1NDB A;  5KJV A;  2ZBA A;  4G0B A; 
#chains in the Genus database with same CATH homology
 2II5 A;  2E1T A;  1XL7 A;  2E1V A;  1PD5 A;  2XHG A;  4JN3 A;  2JGP A;  5T3E A;  2II4 A;  4HVM A;  2RKV A;  5DU9 A;  5FAL A;  3L60 A;  1DPB A;  5KJT A;  1EAD A;  1EAA A;  1XMC A;  4G22 A;  3MAE A;  1CLA A;  4G0B A;  4KEC A;  1XL8 A;  5FAN A;  2BGH A;  5KJW A;  1DPC A;  3B2S A;  2RKT A;  4KE4 A;  5DUA A;  1EAB A;  1EAF A;  1XMD A;  2CLA A;  2XR7 A;  4JN5 A;  1Q23 A;  5KJU A;  3FOT A;  3B30 A;  1DPD A;  1QCA A;  2II3 A;  1Q9J A;  4G2M A;  5KJS A;  1SCZ A;  1E2O A;  4CLA A;  1EAE A;  2IHW A;  1CIA A;  3U9B A;  5KJV A;  3U9F A;  1C4T A;  2E1U A;  4N72 A;  1L5A A;  2VSQ A;  2ZBA A;  1NOC B;  3FP0 A;  3CLA A;  1EAC A;  2I9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...