1EAEA

Atomic structure of the cubic core of the pyruvate dehydrogenase multienzyme complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
243
structure length
243
Chain Sequence
IPPIPPVDFAKYGEIEEVPMTRLMQIGATNLHRSWLNVPHVTQFESADITELEAFRVAQKAVAKKAGVKLTVLPLLLKACAYLLKELPDFNSSLAPSGQALIRKKYVHIGFAVDTPDGLLVPVIRNVDQKSLLQLAAEAAELAEKARSKKLGADAMQGACFTISSLGHIGGTAFTPIVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLGDLLADIRAILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dihydrolipoamide acetyltransferase
molecule keywords DIHYDROLIPOYL-TRANSACETYLASE
publication title Crystallographic analysis of substrate binding and catalysis in dihydrolipoyl transacetylase (E2p).
pubmed doi rcsb
source organism Azotobacter vinelandii
total genus 67
structure length 243
sequence length 243
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1992-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1eaeA00
1EAAA 3B30A 5KJSA 5KJVA 1QCAA 2II4A 5DU9A 4HVMA 3FOTA 4KECA 1DPBA 2XHGA 1EABA 2XR7A 3L60A 2II3A 1C4TA 4JN3A 1EACA 2JGPA 2E1TA 4G2MA 5KJWA 3MAEA 1CIAA 2ZBAA 1Q23A 4G0BA 2CLAA 1NOCB 4G22A 4CLAA 2RKTA 4KE4A 2IHWA 1L5AA 2II5A 3B2SA 1E2OA 1PD5A 2BGHA 2I9DA 5T3EA 1XMDA 3FP0A 4N72A 3U9FA 5KJTA 1XL7A 2VSQA 1EADA 1EAFA 1XL8A 4JN5A 1CLAA 1SCZA 2E1VA 2E1UA 1DPDA 2RKVA 5FALA 3U9BA 1Q9JA 1EAEA 3CLAA 5DUAA 5KJUA 1DPCA 1XMCA 5FANA
chains in the Genus database with same CATH superfamily
3B30A 5KJSA 4HVMA 2XHGA 1C4TA 2JGPA 4G2MA 5KJWA 4EYWA 2DEBA 4G22A 2CLAA 2IHWA 1L5AA 1PD5A 2FY3A 1XL7A 1EADA 1XL8A 4JN5A 3CLAA 1EAEA 1NDFA 5KJUA 1DPBA 2H3UA 1EABA 3L60A 2II3A 4JN3A 2E1TA 4CLAA 1XMDA 1NDBA 4N72A 5KJTA 1EAFA 1NDIA 1CLAA 1DPDA 1Q9JA 1DPCA 2H3PA 1XMCA 1EAAA 1S5OA 1T1UA 1QCAA 5DU9A 1Q6XA 1EACA 2FW3A 2FY4A 2ZBAA 2FYOA 1Q23A 1NOCB 2H4TA 2RKTA 4KE4A 2II5A 2H3WA 3B2SA 2BGHA 2I9DA 5T3EA 3FP0A 3U9FA 2VSQA 2E1VA 1SCZA 1T7OA 2E1UA 5FALA 5DUAA 4EPHA 5KJVA 2II4A 3FOTA 4KECA 2XR7A 2RCUA 1T7QA 3MAEA 1CIAA 1T7NA 4G0BA 1E2OA 2FY2A 2RKVA 1NM8A 3U9BA 2FY5A 4EP9A 5FANA
chains in the Genus database with same CATH topology
1EAAA 3B30A 5KJSA 5KJVA 1QCAA 2II4A 5DU9A 4HVMA 3FOTA 4KECA 1DPBA 2XHGA 1EABA 2XR7A 3L60A 2II3A 1C4TA 4JN3A 1EACA 2JGPA 2E1TA 4G2MA 5KJWA 3MAEA 1CIAA 2ZBAA 1Q23A 4G0BA 2CLAA 1NOCB 4G22A 4CLAA 2RKTA 4KE4A 2IHWA 1L5AA 2II5A 3B2SA 1E2OA 1PD5A 2BGHA 2I9DA 5T3EA 1XMDA 3FP0A 4N72A 3U9FA 5KJTA 1XL7A 2VSQA 1EADA 1EAFA 1XL8A 4JN5A 1CLAA 1SCZA 2E1VA 2E1UA 1DPDA 2RKVA 5FALA 3U9BA 1Q9JA 1EAEA 3CLAA 5DUAA 5KJUA 1DPCA 1XMCA 5FANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EAA A;  3B30 A;  5KJS A;  5KJV A;  1QCA A;  2II4 A;  5DU9 A;  4HVM A;  3FOT A;  4KEC A;  1DPB A;  2XHG A;  1EAB A;  2XR7 A;  3L60 A;  2II3 A;  1C4T A;  4JN3 A;  1EAC A;  2JGP A;  2E1T A;  4G2M A;  5KJW A;  3MAE A;  1CIA A;  2ZBA A;  1Q23 A;  4G0B A;  2CLA A;  1NOC B;  4G22 A;  4CLA A;  2RKT A;  4KE4 A;  2IHW A;  1L5A A;  2II5 A;  3B2S A;  1E2O A;  1PD5 A;  2BGH A;  2I9D A;  5T3E A;  1XMD A;  3FP0 A;  4N72 A;  3U9F A;  5KJT A;  1XL7 A;  2VSQ A;  1EAD A;  1EAF A;  1XL8 A;  4JN5 A;  1CLA A;  1SCZ A;  2E1V A;  2E1U A;  1DPD A;  2RKV A;  5FAL A;  3U9B A;  1Q9J A;  1EAE A;  3CLA A;  5DUA A;  5KJU A;  1DPC A;  1XMC A;  5FAN A; 
#chains in the Genus database with same CATH topology
 3B30 A;  5KJS A;  4HVM A;  2XHG A;  1C4T A;  2JGP A;  4G2M A;  5KJW A;  4EYW A;  2DEB A;  4G22 A;  2CLA A;  2IHW A;  1L5A A;  1PD5 A;  2FY3 A;  1XL7 A;  1EAD A;  1XL8 A;  4JN5 A;  3CLA A;  1EAE A;  1NDF A;  5KJU A;  1DPB A;  2H3U A;  1EAB A;  3L60 A;  2II3 A;  4JN3 A;  2E1T A;  4CLA A;  1XMD A;  1NDB A;  4N72 A;  5KJT A;  1EAF A;  1NDI A;  1CLA A;  1DPD A;  1Q9J A;  1DPC A;  2H3P A;  1XMC A;  1EAA A;  1S5O A;  1T1U A;  1QCA A;  5DU9 A;  1Q6X A;  1EAC A;  2FW3 A;  2FY4 A;  2ZBA A;  2FYO A;  1Q23 A;  1NOC B;  2H4T A;  2RKT A;  4KE4 A;  2II5 A;  2H3W A;  3B2S A;  2BGH A;  2I9D A;  5T3E A;  3FP0 A;  3U9F A;  2VSQ A;  2E1V A;  1SCZ A;  1T7O A;  2E1U A;  5FAL A;  5DUA A;  4EPH A;  5KJV A;  2II4 A;  3FOT A;  4KEC A;  2XR7 A;  2RCU A;  1T7Q A;  3MAE A;  1CIA A;  1T7N A;  4G0B A;  1E2O A;  2FY2 A;  2RKV A;  1NM8 A;  3U9B A;  2FY5 A;  4EP9 A;  5FAN A; 
#chains in the Genus database with same CATH homology
 1EAA A;  3B30 A;  5KJS A;  5KJV A;  1QCA A;  2II4 A;  5DU9 A;  4HVM A;  3FOT A;  4KEC A;  1DPB A;  2XHG A;  1EAB A;  2XR7 A;  3L60 A;  2II3 A;  1C4T A;  4JN3 A;  1EAC A;  2JGP A;  2E1T A;  4G2M A;  5KJW A;  3MAE A;  1CIA A;  2ZBA A;  1Q23 A;  4G0B A;  2CLA A;  1NOC B;  4G22 A;  4CLA A;  2RKT A;  4KE4 A;  2IHW A;  1L5A A;  2II5 A;  3B2S A;  1E2O A;  1PD5 A;  2BGH A;  2I9D A;  5T3E A;  1XMD A;  3FP0 A;  4N72 A;  3U9F A;  5KJT A;  1XL7 A;  2VSQ A;  1EAD A;  1EAF A;  1XL8 A;  4JN5 A;  1CLA A;  1SCZ A;  2E1V A;  2E1U A;  1DPD A;  2RKV A;  5FAL A;  3U9B A;  1Q9J A;  1EAE A;  3CLA A;  5DUA A;  5KJU A;  1DPC A;  1XMC A;  5FAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...