1E2OA

Catalytic domain from dihydrolipoamide succinyltransferase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
233
structure length
230
Chain Sequence
ARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTGLVTPVLRDVDTLGMADIEKKIKELAVKGDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DIHYDROLIPOAMIDE SUCCINYLTRANSFERASE
publication title Crystal structure of the truncated cubic core component of the Escherichia coli 2-oxoglutarate dehydrogenase multienzyme complex.
pubmed doi rcsb
source organism Escherichia coli
total genus 60
structure length 230
sequence length 233
ec nomenclature ec 2.3.1.61: Dihydrolipoyllysine-residue succinyltransferase.
pdb deposition date 1998-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1e2oA00
2E1UA 1C4TA 3U9FA 1XMCA 5FANA 4KECA 1CIAA 2BGHA 1EADA 5KJSA 1XMDA 2VSQA 1NOCB 4G22A 2RKVA 4KE4A 1CLAA 2CLAA 4CLAA 3L60A 1DPBA 3MAEA 2IHWA 1EABA 4HVMA 5T3EA 5KJTA 1QCAA 2E1VA 1SCZA 3U9BA 1XL8A 2XHGA 4N72A 1EAFA 1DPDA 1EAEA 2II4A 1EACA 2E1TA 2I9DA 1Q9JA 2RKTA 2XR7A 1PD5A 1XL7A 2JGPA 5DUAA 5KJUA 1EAAA 1L5AA 4JN5A 4G2MA 1DPCA 3CLAA 4JN3A 5FALA 5KJWA 1Q23A 2II3A 1E2OA 2II5A 2ZBAA 3FP0A 3FOTA 4G0BA 5KJVA 3B2SA 5DU9A 3B30A
chains in the Genus database with same CATH superfamily
2H3PA 1XMCA 2FY4A 1CIAA 2BGHA 1XMDA 2VSQA 1NOCB 1T7OA 2CLAA 1DPBA 1EABA 1T1UA 2XHGA 1EAFA 2XR7A 2JGPA 1DPCA 3CLAA 5FALA 5KJWA 4G0BA 1Q23A 2II5A 3FOTA 1T7QA 5DU9A 2E1UA 2RCUA 4KECA 4G22A 1NM8A 2RKVA 1CLAA 3MAEA 2FY2A 4EPHA 1XL8A 2II4A 1NDBA 2RKTA 1PD5A 5DUAA 1T7NA 5KJUA 4JN5A 4G2MA 1S5OA 2II3A 1E2OA 2H4TA 3B2SA 1C4TA 2FYOA 5FANA 2DEBA 5KJSA 4KE4A 4CLAA 4HVMA 5KJTA 1NDFA 5T3EA 1QCAA 2E1VA 1NDIA 4EP9A 2H3WA 1DPDA 1EAEA 1EACA 2E1TA 2FY5A 1EAAA 3FP0A 4EYWA 3U9FA 3B30A 2FY3A 1EADA 2H3UA 3L60A 2FW3A 2IHWA 1SCZA 3U9BA 4N72A 2I9DA 1Q9JA 1XL7A 1L5AA 4JN3A 2ZBAA 5KJVA 1Q6XA
chains in the Genus database with same CATH topology
2E1UA 1C4TA 3U9FA 1XMCA 5FANA 4KECA 1CIAA 2BGHA 1EADA 5KJSA 1XMDA 2VSQA 1NOCB 4G22A 2RKVA 4KE4A 1CLAA 2CLAA 4CLAA 3L60A 1DPBA 3MAEA 2IHWA 1EABA 4HVMA 5T3EA 5KJTA 1QCAA 2E1VA 1SCZA 3U9BA 1XL8A 2XHGA 4N72A 1EAFA 1DPDA 1EAEA 2II4A 1EACA 2E1TA 2I9DA 1Q9JA 2RKTA 2XR7A 1PD5A 1XL7A 2JGPA 5DUAA 5KJUA 1EAAA 1L5AA 4JN5A 4G2MA 1DPCA 3CLAA 4JN3A 5FALA 5KJWA 1Q23A 2II3A 1E2OA 2II5A 2ZBAA 3FP0A 3FOTA 4G0BA 5KJVA 3B2SA 5DU9A 3B30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E1U A;  1C4T A;  3U9F A;  1XMC A;  5FAN A;  4KEC A;  1CIA A;  2BGH A;  1EAD A;  5KJS A;  1XMD A;  2VSQ A;  1NOC B;  4G22 A;  2RKV A;  4KE4 A;  1CLA A;  2CLA A;  4CLA A;  3L60 A;  1DPB A;  3MAE A;  2IHW A;  1EAB A;  4HVM A;  5T3E A;  5KJT A;  1QCA A;  2E1V A;  1SCZ A;  3U9B A;  1XL8 A;  2XHG A;  4N72 A;  1EAF A;  1DPD A;  1EAE A;  2II4 A;  1EAC A;  2E1T A;  2I9D A;  1Q9J A;  2RKT A;  2XR7 A;  1PD5 A;  1XL7 A;  2JGP A;  5DUA A;  5KJU A;  1EAA A;  1L5A A;  4JN5 A;  4G2M A;  1DPC A;  3CLA A;  4JN3 A;  5FAL A;  5KJW A;  1Q23 A;  2II3 A;  1E2O A;  2II5 A;  2ZBA A;  3FP0 A;  3FOT A;  4G0B A;  5KJV A;  3B2S A;  5DU9 A;  3B30 A; 
#chains in the Genus database with same CATH topology
 2H3P A;  1XMC A;  2FY4 A;  1CIA A;  2BGH A;  1XMD A;  2VSQ A;  1NOC B;  1T7O A;  2CLA A;  1DPB A;  1EAB A;  1T1U A;  2XHG A;  1EAF A;  2XR7 A;  2JGP A;  1DPC A;  3CLA A;  5FAL A;  5KJW A;  4G0B A;  1Q23 A;  2II5 A;  3FOT A;  1T7Q A;  5DU9 A;  2E1U A;  2RCU A;  4KEC A;  4G22 A;  1NM8 A;  2RKV A;  1CLA A;  3MAE A;  2FY2 A;  4EPH A;  1XL8 A;  2II4 A;  1NDB A;  2RKT A;  1PD5 A;  5DUA A;  1T7N A;  5KJU A;  4JN5 A;  4G2M A;  1S5O A;  2II3 A;  1E2O A;  2H4T A;  3B2S A;  1C4T A;  2FYO A;  5FAN A;  2DEB A;  5KJS A;  4KE4 A;  4CLA A;  4HVM A;  5KJT A;  1NDF A;  5T3E A;  1QCA A;  2E1V A;  1NDI A;  4EP9 A;  2H3W A;  1DPD A;  1EAE A;  1EAC A;  2E1T A;  2FY5 A;  1EAA A;  3FP0 A;  4EYW A;  3U9F A;  3B30 A;  2FY3 A;  1EAD A;  2H3U A;  3L60 A;  2FW3 A;  2IHW A;  1SCZ A;  3U9B A;  4N72 A;  2I9D A;  1Q9J A;  1XL7 A;  1L5A A;  4JN3 A;  2ZBA A;  5KJV A;  1Q6X A; 
#chains in the Genus database with same CATH homology
 2E1U A;  1C4T A;  3U9F A;  1XMC A;  5FAN A;  4KEC A;  1CIA A;  2BGH A;  1EAD A;  5KJS A;  1XMD A;  2VSQ A;  1NOC B;  4G22 A;  2RKV A;  4KE4 A;  1CLA A;  2CLA A;  4CLA A;  3L60 A;  1DPB A;  3MAE A;  2IHW A;  1EAB A;  4HVM A;  5T3E A;  5KJT A;  1QCA A;  2E1V A;  1SCZ A;  3U9B A;  1XL8 A;  2XHG A;  4N72 A;  1EAF A;  1DPD A;  1EAE A;  2II4 A;  1EAC A;  2E1T A;  2I9D A;  1Q9J A;  2RKT A;  2XR7 A;  1PD5 A;  1XL7 A;  2JGP A;  5DUA A;  5KJU A;  1EAA A;  1L5A A;  4JN5 A;  4G2M A;  1DPC A;  3CLA A;  4JN3 A;  5FAL A;  5KJW A;  1Q23 A;  2II3 A;  1E2O A;  2II5 A;  2ZBA A;  3FP0 A;  3FOT A;  4G0B A;  5KJV A;  3B2S A;  5DU9 A;  3B30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...