1E2OA

Catalytic domain from dihydrolipoamide succinyltransferase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
233
structure length
230
Chain Sequence
b'ARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTGLVTPVLRDVDTLGMADIEKKIKELAVKGDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROLIPOAMIDE SUCCINYLTRANSFERASE
publication title Crystal structure of the truncated cubic core component of the Escherichia coli 2-oxoglutarate dehydrogenase multienzyme complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 60
structure length 230
sequence length 233
ec nomenclature ec 2.3.1.61: Dihydrolipoyllysine-residue succinyltransferase.
pdb deposition date 1998-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1e2oA00
3MAEA 1CLAA 4G2MA 3U9FA 2VSQA 3B2SA 1PD5A 2CLAA 1XMDA 2JGPA 3L60A 2XHGA 1EAFA 1EADA 1E2OA 1C4TA 2II3A 1EAAA 2II5A 2E1TA 3CLAA 4JN3A 4KE4A 4N72A 5KJSA 3B30A 3U9BA 1XL7A 2ZBAA 4JN5A 1Q23A 1XMCA 4HVMA 2E1UA 2RKVA 2XR7A 2RKTA 2II4A 5KJUA 5KJTA 3FOTA 4KECA 1L5AA 1DPDA 2BGHA 1XL8A 2E1VA 2I9DA 2IHWA 1NOCB 1EABA 4CLAA 5FALA 4G0BA 1DPCA 3FP0A 1QCAA 5DU9A 5T3EA 1CIAA 1EACA 1SCZA 5DUAA 5KJWA 5FANA 4G22A 1Q9JA 5KJVA 1EAEA 1DPBA
chains in the Genus database with same CATH superfamily
4G2MA 4EP9A 3B2SA 4KE4A 1T7OA 1XMDA 2JGPA 3L60A 4JN3A 1NM8A 4JN5A 4EPHA 5KJTA 3FOTA 1DPDA 2BGHA 2FY4A 1CIAA 1EACA 5FANA 4G22A 1Q9JA 5KJVA 1DPBA 3MAEA 1S5OA 2CLAA 4EYWA 1E2OA 1C4TA 2II3A 2E1TA 5KJSA 3U9BA 2FY3A 1XL7A 1XMCA 4HVMA 2FYOA 2RKTA 5KJUA 4KECA 1L5AA 2E1VA 1EABA 1DPCA 5DU9A 5T3EA 1SCZA 5KJWA 1NDIA 2RKVA 1EAEA 3U9FA 2VSQA 2RCUA 1EAFA 1T7QA 2ZBAA 1NDFA 2E1UA 2XR7A 2II4A 1NDBA 2FW3A 1T1UA 4CLAA 2DEBA 5FALA 4G0BA 3FP0A 1QCAA 1CLAA 2FY5A 1PD5A 2XHGA 1EADA 3CLAA 1EAAA 4N72A 3B30A 2H3UA 1Q23A 2H3WA 2H3PA 2I9DA 1XL8A 2IHWA 1NOCB 1Q6XA 2H4TA 5DUAA 2FY2A 1T7NA 2II5A
chains in the Genus database with same CATH topology
3MAEA 1CLAA 4G2MA 3U9FA 2VSQA 3B2SA 1PD5A 2CLAA 1XMDA 2JGPA 3L60A 2XHGA 1EAFA 1EADA 1E2OA 1C4TA 2II3A 1EAAA 2II5A 2E1TA 3CLAA 4JN3A 4KE4A 4N72A 5KJSA 3B30A 3U9BA 1XL7A 2ZBAA 4JN5A 1Q23A 1XMCA 4HVMA 2E1UA 2RKVA 2XR7A 2RKTA 2II4A 5KJUA 5KJTA 3FOTA 4KECA 1L5AA 1DPDA 2BGHA 1XL8A 2E1VA 2I9DA 2IHWA 1NOCB 1EABA 4CLAA 5FALA 4G0BA 1DPCA 3FP0A 1QCAA 5DU9A 5T3EA 1CIAA 1EACA 1SCZA 5DUAA 5KJWA 5FANA 4G22A 1Q9JA 5KJVA 1EAEA 1DPBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MAE A;  1CLA A;  4G2M A;  3U9F A;  2VSQ A;  3B2S A;  1PD5 A;  2CLA A;  1XMD A;  2JGP A;  3L60 A;  2XHG A;  1EAF A;  1EAD A;  1E2O A;  1C4T A;  2II3 A;  1EAA A;  2II5 A;  2E1T A;  3CLA A;  4JN3 A;  4KE4 A;  4N72 A;  5KJS A;  3B30 A;  3U9B A;  1XL7 A;  2ZBA A;  4JN5 A;  1Q23 A;  1XMC A;  4HVM A;  2E1U A;  2RKV A;  2XR7 A;  2RKT A;  2II4 A;  5KJU A;  5KJT A;  3FOT A;  4KEC A;  1L5A A;  1DPD A;  2BGH A;  1XL8 A;  2E1V A;  2I9D A;  2IHW A;  1NOC B;  1EAB A;  4CLA A;  5FAL A;  4G0B A;  1DPC A;  3FP0 A;  1QCA A;  5DU9 A;  5T3E A;  1CIA A;  1EAC A;  1SCZ A;  5DUA A;  5KJW A;  5FAN A;  4G22 A;  1Q9J A;  5KJV A;  1EAE A;  1DPB A; 
#chains in the Genus database with same CATH topology
 4G2M A;  4EP9 A;  3B2S A;  4KE4 A;  1T7O A;  1XMD A;  2JGP A;  3L60 A;  4JN3 A;  1NM8 A;  4JN5 A;  4EPH A;  5KJT A;  3FOT A;  1DPD A;  2BGH A;  2FY4 A;  1CIA A;  1EAC A;  5FAN A;  4G22 A;  1Q9J A;  5KJV A;  1DPB A;  3MAE A;  1S5O A;  2CLA A;  4EYW A;  1E2O A;  1C4T A;  2II3 A;  2E1T A;  5KJS A;  3U9B A;  2FY3 A;  1XL7 A;  1XMC A;  4HVM A;  2FYO A;  2RKT A;  5KJU A;  4KEC A;  1L5A A;  2E1V A;  1EAB A;  1DPC A;  5DU9 A;  5T3E A;  1SCZ A;  5KJW A;  1NDI A;  2RKV A;  1EAE A;  3U9F A;  2VSQ A;  2RCU A;  1EAF A;  1T7Q A;  2ZBA A;  1NDF A;  2E1U A;  2XR7 A;  2II4 A;  1NDB A;  2FW3 A;  1T1U A;  4CLA A;  2DEB A;  5FAL A;  4G0B A;  3FP0 A;  1QCA A;  1CLA A;  2FY5 A;  1PD5 A;  2XHG A;  1EAD A;  3CLA A;  1EAA A;  4N72 A;  3B30 A;  2H3U A;  1Q23 A;  2H3W A;  2H3P A;  2I9D A;  1XL8 A;  2IHW A;  1NOC B;  1Q6X A;  2H4T A;  5DUA A;  2FY2 A;  1T7N A;  2II5 A; 
#chains in the Genus database with same CATH homology
 3MAE A;  1CLA A;  4G2M A;  3U9F A;  2VSQ A;  3B2S A;  1PD5 A;  2CLA A;  1XMD A;  2JGP A;  3L60 A;  2XHG A;  1EAF A;  1EAD A;  1E2O A;  1C4T A;  2II3 A;  1EAA A;  2II5 A;  2E1T A;  3CLA A;  4JN3 A;  4KE4 A;  4N72 A;  5KJS A;  3B30 A;  3U9B A;  1XL7 A;  2ZBA A;  4JN5 A;  1Q23 A;  1XMC A;  4HVM A;  2E1U A;  2RKV A;  2XR7 A;  2RKT A;  2II4 A;  5KJU A;  5KJT A;  3FOT A;  4KEC A;  1L5A A;  1DPD A;  2BGH A;  1XL8 A;  2E1V A;  2I9D A;  2IHW A;  1NOC B;  1EAB A;  4CLA A;  5FAL A;  4G0B A;  1DPC A;  3FP0 A;  1QCA A;  5DU9 A;  5T3E A;  1CIA A;  1EAC A;  1SCZ A;  5DUA A;  5KJW A;  5FAN A;  4G22 A;  1Q9J A;  5KJV A;  1EAE A;  1DPB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...