1E2OA

Catalytic domain from dihydrolipoamide succinyltransferase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
233
structure length
230
Chain Sequence
ARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTGLVTPVLRDVDTLGMADIEKKIKELAVKGDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROLIPOAMIDE SUCCINYLTRANSFERASE
publication title Crystal structure of the truncated cubic core component of the Escherichia coli 2-oxoglutarate dehydrogenase multienzyme complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 60
structure length 230
sequence length 233
ec nomenclature ec 2.3.1.61: Dihydrolipoyllysine-residue succinyltransferase.
pdb deposition date 1998-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1e2oA00
2I9DA 2II3A 2VSQA 5KJTA 5FANA 1PD5A 1XMCA 2CLAA 1CIAA 4G2MA 2RKTA 2XR7A 4KE4A 2JGPA 3B2SA 2RKVA 4HVMA 1NOCB 2E1TA 5DUAA 2ZBAA 1XL7A 1Q23A 4N72A 3MAEA 2IHWA 1QCAA 3FOTA 5KJSA 3CLAA 2E1VA 3U9BA 1XL8A 1EADA 5T3EA 1EACA 1E2OA 1CLAA 1EAAA 1DPBA 2II4A 2XHGA 5KJVA 3U9FA 4G22A 3B30A 4KECA 1Q9JA 3L60A 1DPDA 4JN5A 3FP0A 5KJWA 1L5AA 1EAFA 4JN3A 1EAEA 2BGHA 1DPCA 1EABA 1C4TA 1XMDA 2II5A 5DU9A 2E1UA 5KJUA 5FALA 4CLAA 1SCZA 4G0BA
chains in the Genus database with same CATH superfamily
2I9DA 4EYWA 5FANA 2CLAA 1CIAA 5DUAA 2ZBAA 5KJSA 2E1VA 4EPHA 2FY5A 5T3EA 1NM8A 1DPBA 2II4A 1T7OA 2FY2A 2H3PA 1Q9JA 1DPDA 3FP0A 5KJWA 2H3UA 1EAEA 1EABA 2II5A 5DU9A 5KJUA 1NDFA 2FY4A 4CLAA 4G0BA 2FYOA 4G2MA 2E1TA 1Q23A 4N72A 1NDBA 3FOTA 4EP9A 1XL8A 1EADA 1EACA 3U9FA 4G22A 4KECA 4JN5A 2DEBA 1DPCA 2RCUA 1S5OA 2E1UA 1T1UA 1SCZA 2VSQA 5KJTA 1XMCA 2RKTA 2XR7A 3B2SA 4HVMA 2H3WA 2FY3A 1XL7A 3MAEA 2IHWA 1QCAA 3U9BA 1E2OA 1CLAA 1EAAA 2XHGA 3L60A 2FW3A 1L5AA 2BGHA 1C4TA 1XMDA 1NDIA 5FALA 2H4TA 2II3A 1PD5A 4KE4A 2JGPA 2RKVA 1NOCB 3CLAA 1Q6XA 1T7NA 5KJVA 3B30A 1EAFA 4JN3A 1T7QA
chains in the Genus database with same CATH topology
2I9DA 2II3A 2VSQA 5KJTA 5FANA 1PD5A 1XMCA 2CLAA 1CIAA 4G2MA 2RKTA 2XR7A 4KE4A 2JGPA 3B2SA 2RKVA 4HVMA 1NOCB 2E1TA 5DUAA 2ZBAA 1XL7A 1Q23A 4N72A 3MAEA 2IHWA 1QCAA 3FOTA 5KJSA 3CLAA 2E1VA 3U9BA 1XL8A 1EADA 5T3EA 1EACA 1E2OA 1CLAA 1EAAA 1DPBA 2II4A 2XHGA 5KJVA 3U9FA 4G22A 3B30A 4KECA 1Q9JA 3L60A 1DPDA 4JN5A 3FP0A 5KJWA 1L5AA 1EAFA 4JN3A 1EAEA 2BGHA 1DPCA 1EABA 1C4TA 1XMDA 2II5A 5DU9A 2E1UA 5KJUA 5FALA 4CLAA 1SCZA 4G0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I9D A;  2II3 A;  2VSQ A;  5KJT A;  5FAN A;  1PD5 A;  1XMC A;  2CLA A;  1CIA A;  4G2M A;  2RKT A;  2XR7 A;  4KE4 A;  2JGP A;  3B2S A;  2RKV A;  4HVM A;  1NOC B;  2E1T A;  5DUA A;  2ZBA A;  1XL7 A;  1Q23 A;  4N72 A;  3MAE A;  2IHW A;  1QCA A;  3FOT A;  5KJS A;  3CLA A;  2E1V A;  3U9B A;  1XL8 A;  1EAD A;  5T3E A;  1EAC A;  1E2O A;  1CLA A;  1EAA A;  1DPB A;  2II4 A;  2XHG A;  5KJV A;  3U9F A;  4G22 A;  3B30 A;  4KEC A;  1Q9J A;  3L60 A;  1DPD A;  4JN5 A;  3FP0 A;  5KJW A;  1L5A A;  1EAF A;  4JN3 A;  1EAE A;  2BGH A;  1DPC A;  1EAB A;  1C4T A;  1XMD A;  2II5 A;  5DU9 A;  2E1U A;  5KJU A;  5FAL A;  4CLA A;  1SCZ A;  4G0B A; 
#chains in the Genus database with same CATH topology
 2I9D A;  4EYW A;  5FAN A;  2CLA A;  1CIA A;  5DUA A;  2ZBA A;  5KJS A;  2E1V A;  4EPH A;  2FY5 A;  5T3E A;  1NM8 A;  1DPB A;  2II4 A;  1T7O A;  2FY2 A;  2H3P A;  1Q9J A;  1DPD A;  3FP0 A;  5KJW A;  2H3U A;  1EAE A;  1EAB A;  2II5 A;  5DU9 A;  5KJU A;  1NDF A;  2FY4 A;  4CLA A;  4G0B A;  2FYO A;  4G2M A;  2E1T A;  1Q23 A;  4N72 A;  1NDB A;  3FOT A;  4EP9 A;  1XL8 A;  1EAD A;  1EAC A;  3U9F A;  4G22 A;  4KEC A;  4JN5 A;  2DEB A;  1DPC A;  2RCU A;  1S5O A;  2E1U A;  1T1U A;  1SCZ A;  2VSQ A;  5KJT A;  1XMC A;  2RKT A;  2XR7 A;  3B2S A;  4HVM A;  2H3W A;  2FY3 A;  1XL7 A;  3MAE A;  2IHW A;  1QCA A;  3U9B A;  1E2O A;  1CLA A;  1EAA A;  2XHG A;  3L60 A;  2FW3 A;  1L5A A;  2BGH A;  1C4T A;  1XMD A;  1NDI A;  5FAL A;  2H4T A;  2II3 A;  1PD5 A;  4KE4 A;  2JGP A;  2RKV A;  1NOC B;  3CLA A;  1Q6X A;  1T7N A;  5KJV A;  3B30 A;  1EAF A;  4JN3 A;  1T7Q A; 
#chains in the Genus database with same CATH homology
 2I9D A;  2II3 A;  2VSQ A;  5KJT A;  5FAN A;  1PD5 A;  1XMC A;  2CLA A;  1CIA A;  4G2M A;  2RKT A;  2XR7 A;  4KE4 A;  2JGP A;  3B2S A;  2RKV A;  4HVM A;  1NOC B;  2E1T A;  5DUA A;  2ZBA A;  1XL7 A;  1Q23 A;  4N72 A;  3MAE A;  2IHW A;  1QCA A;  3FOT A;  5KJS A;  3CLA A;  2E1V A;  3U9B A;  1XL8 A;  1EAD A;  5T3E A;  1EAC A;  1E2O A;  1CLA A;  1EAA A;  1DPB A;  2II4 A;  2XHG A;  5KJV A;  3U9F A;  4G22 A;  3B30 A;  4KEC A;  1Q9J A;  3L60 A;  1DPD A;  4JN5 A;  3FP0 A;  5KJW A;  1L5A A;  1EAF A;  4JN3 A;  1EAE A;  2BGH A;  1DPC A;  1EAB A;  1C4T A;  1XMD A;  2II5 A;  5DU9 A;  2E1U A;  5KJU A;  5FAL A;  4CLA A;  1SCZ A;  4G0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...