2II3A

Crystal structure of a cubic core of the dihydrolipoamide acyltransferase (e2b) component in the branched-chain alpha-ketoacid dehydrogenase complex (bckdc), oxidized coenzyme a-bound form
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
234
structure length
234
Chain Sequence
GKDRTEPVKGFHKAMVKTMSAALKIPHFGYCDEVDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQIRSIFEIATELNRLQKLGSAGQLSTNDLIGGTFTLSNIGSIGGTYAKPVILPPEVAIGALGTIKALPRFNEKGEVCKAQIMNVSWSADHRIIDGATVSRFSNLWKSYLENPAFMLLDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoamide acyltransferase component of branched-chain alpha-
publication title A synchronized substrate-gating mechanism revealed by cubic-core structure of the bovine branched-chain alpha-ketoacid dehydrogenase complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 67
structure length 234
sequence length 234
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.1.168: Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase.
pdb deposition date 2006-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 2ii3A01
2IHWA 3CLAA 1Q23A 4G22A 3U9FA 1PD5A 4JN5A 2RKTA 3MAEA 4N72A 2XHGA 5DU9A 2CLAA 1CIAA 2JGPA 1E2OA 4KE4A 1EABA 2II4A 2BGHA 4G0BA 4CLAA 5FANA 1CLAA 2E1TA 5FALA 5KJTA 1XMCA 3B30A 5DUAA 5KJSA 1C4TA 2VSQA 1NOCB 3FP0A 1XL7A 5KJVA 1EAAA 2E1UA 5KJUA 4JN3A 1DPDA 1EAFA 3B2SA 1EAEA 4HVMA 1L5AA 1QCAA 4KECA 2E1VA 1XL8A 2I9DA 2II3A 2ZBAA 4G2MA 1EADA 1Q9JA 2RKVA 1EACA 2II5A 1DPBA 5T3EA 3U9BA 3FOTA 1SCZA 3L60A 5KJWA 1DPCA 1XMDA 2XR7A
chains in the Genus database with same CATH superfamily
4G22A 2H3UA 3U9FA 4JN5A 1T1UA 2H3PA 5DU9A 1CIAA 2H4TA 1EABA 2II4A 1CLAA 2E1TA 5KJTA 3B30A 5DUAA 3FP0A 2VSQA 1NOCB 5KJUA 5KJVA 2FYOA 1DPDA 1EAFA 3B2SA 1EAEA 1Q6XA 1L5AA 1QCAA 1EADA 1Q9JA 2II5A 2FY5A 5KJWA 1DPCA 2FW3A 1E2OA 2BGHA 5FANA 1T7QA 1T7OA 1XL7A 1NDFA 4JN3A 1NDBA 2E1VA 1XL8A 2ZBAA 2RKVA 3L60A 2XR7A 2DEBA 2IHWA 3CLAA 1Q23A 1PD5A 2FY4A 2RKTA 4N72A 2JGPA 4KE4A 4G0BA 4CLAA 2FY3A 1T7NA 5FALA 1XMCA 1C4TA 4EYWA 1EAAA 2E1UA 2II3A 4G2MA 1NM8A 5T3EA 2RCUA 3FOTA 1SCZA 3MAEA 2XHGA 2CLAA 4EPHA 1S5OA 5KJSA 4HVMA 1NDIA 4KECA 2H3WA 2I9DA 1EACA 3U9BA 1DPBA 2FY2A 1XMDA 4EP9A
chains in the Genus database with same CATH topology
2IHWA 3CLAA 1Q23A 4G22A 3U9FA 1PD5A 4JN5A 2RKTA 3MAEA 4N72A 2XHGA 5DU9A 2CLAA 1CIAA 2JGPA 1E2OA 4KE4A 1EABA 2II4A 2BGHA 4G0BA 4CLAA 5FANA 1CLAA 2E1TA 5FALA 5KJTA 1XMCA 3B30A 5DUAA 5KJSA 1C4TA 2VSQA 1NOCB 3FP0A 1XL7A 5KJVA 1EAAA 2E1UA 5KJUA 4JN3A 1DPDA 1EAFA 3B2SA 1EAEA 4HVMA 1L5AA 1QCAA 4KECA 2E1VA 1XL8A 2I9DA 2II3A 2ZBAA 4G2MA 1EADA 1Q9JA 2RKVA 1EACA 2II5A 1DPBA 5T3EA 3U9BA 3FOTA 1SCZA 3L60A 5KJWA 1DPCA 1XMDA 2XR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IHW A;  3CLA A;  1Q23 A;  4G22 A;  3U9F A;  1PD5 A;  4JN5 A;  2RKT A;  3MAE A;  4N72 A;  2XHG A;  5DU9 A;  2CLA A;  1CIA A;  2JGP A;  1E2O A;  4KE4 A;  1EAB A;  2II4 A;  2BGH A;  4G0B A;  4CLA A;  5FAN A;  1CLA A;  2E1T A;  5FAL A;  5KJT A;  1XMC A;  3B30 A;  5DUA A;  5KJS A;  1C4T A;  2VSQ A;  1NOC B;  3FP0 A;  1XL7 A;  5KJV A;  1EAA A;  2E1U A;  5KJU A;  4JN3 A;  1DPD A;  1EAF A;  3B2S A;  1EAE A;  4HVM A;  1L5A A;  1QCA A;  4KEC A;  2E1V A;  1XL8 A;  2I9D A;  2II3 A;  2ZBA A;  4G2M A;  1EAD A;  1Q9J A;  2RKV A;  1EAC A;  2II5 A;  1DPB A;  5T3E A;  3U9B A;  3FOT A;  1SCZ A;  3L60 A;  5KJW A;  1DPC A;  1XMD A;  2XR7 A; 
#chains in the Genus database with same CATH topology
 4G22 A;  2H3U A;  3U9F A;  4JN5 A;  1T1U A;  2H3P A;  5DU9 A;  1CIA A;  2H4T A;  1EAB A;  2II4 A;  1CLA A;  2E1T A;  5KJT A;  3B30 A;  5DUA A;  3FP0 A;  2VSQ A;  1NOC B;  5KJU A;  5KJV A;  2FYO A;  1DPD A;  1EAF A;  3B2S A;  1EAE A;  1Q6X A;  1L5A A;  1QCA A;  1EAD A;  1Q9J A;  2II5 A;  2FY5 A;  5KJW A;  1DPC A;  2FW3 A;  1E2O A;  2BGH A;  5FAN A;  1T7Q A;  1T7O A;  1XL7 A;  1NDF A;  4JN3 A;  1NDB A;  2E1V A;  1XL8 A;  2ZBA A;  2RKV A;  3L60 A;  2XR7 A;  2DEB A;  2IHW A;  3CLA A;  1Q23 A;  1PD5 A;  2FY4 A;  2RKT A;  4N72 A;  2JGP A;  4KE4 A;  4G0B A;  4CLA A;  2FY3 A;  1T7N A;  5FAL A;  1XMC A;  1C4T A;  4EYW A;  1EAA A;  2E1U A;  2II3 A;  4G2M A;  1NM8 A;  5T3E A;  2RCU A;  3FOT A;  1SCZ A;  3MAE A;  2XHG A;  2CLA A;  4EPH A;  1S5O A;  5KJS A;  4HVM A;  1NDI A;  4KEC A;  2H3W A;  2I9D A;  1EAC A;  3U9B A;  1DPB A;  2FY2 A;  1XMD A;  4EP9 A; 
#chains in the Genus database with same CATH homology
 2IHW A;  3CLA A;  1Q23 A;  4G22 A;  3U9F A;  1PD5 A;  4JN5 A;  2RKT A;  3MAE A;  4N72 A;  2XHG A;  5DU9 A;  2CLA A;  1CIA A;  2JGP A;  1E2O A;  4KE4 A;  1EAB A;  2II4 A;  2BGH A;  4G0B A;  4CLA A;  5FAN A;  1CLA A;  2E1T A;  5FAL A;  5KJT A;  1XMC A;  3B30 A;  5DUA A;  5KJS A;  1C4T A;  2VSQ A;  1NOC B;  3FP0 A;  1XL7 A;  5KJV A;  1EAA A;  2E1U A;  5KJU A;  4JN3 A;  1DPD A;  1EAF A;  3B2S A;  1EAE A;  4HVM A;  1L5A A;  1QCA A;  4KEC A;  2E1V A;  1XL8 A;  2I9D A;  2II3 A;  2ZBA A;  4G2M A;  1EAD A;  1Q9J A;  2RKV A;  1EAC A;  2II5 A;  1DPB A;  5T3E A;  3U9B A;  3FOT A;  1SCZ A;  3L60 A;  5KJW A;  1DPC A;  1XMD A;  2XR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...