2II3A

Crystal structure of a cubic core of the dihydrolipoamide acyltransferase (e2b) component in the branched-chain alpha-ketoacid dehydrogenase complex (bckdc), oxidized coenzyme a-bound form
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
234
structure length
234
Chain Sequence
GKDRTEPVKGFHKAMVKTMSAALKIPHFGYCDEVDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQIRSIFEIATELNRLQKLGSAGQLSTNDLIGGTFTLSNIGSIGGTYAKPVILPPEVAIGALGTIKALPRFNEKGEVCKAQIMNVSWSADHRIIDGATVSRFSNLWKSYLENPAFMLLDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Lipoamide acyltransferase component of branched-chain alpha-
publication title A synchronized substrate-gating mechanism revealed by cubic-core structure of the bovine branched-chain alpha-ketoacid dehydrogenase complex.
pubmed doi rcsb
source organism Bos taurus
total genus 67
structure length 234
sequence length 234
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.1.168: Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase.
pdb deposition date 2006-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 2ii3A01
3U9FA 2I9DA 5FALA 3U9BA 1XMCA 1EABA 4G0BA 2E1UA 5KJTA 1NOCB 5DUAA 3L60A 1EAAA 2XHGA 1DPCA 2JGPA 4KECA 1L5AA 1PD5A 1XMDA 1EAFA 4JN3A 4CLAA 2CLAA 1CIAA 5KJWA 5KJVA 4G2MA 1C4TA 1E2OA 1Q9JA 2VSQA 2BGHA 2XR7A 3B30A 1XL7A 4HVMA 4JN5A 4N72A 1EADA 1XL8A 2E1VA 2RKTA 3CLAA 1Q23A 1QCAA 2RKVA 5T3EA 5FANA 3B2SA 5KJSA 1DPBA 1CLAA 4G22A 2E1TA 1SCZA 2II3A 2II4A 5DU9A 2IHWA 3FOTA 1DPDA 2II5A 1EAEA 5KJUA 3FP0A 4KE4A 2ZBAA 3MAEA 1EACA
chains in the Genus database with same CATH superfamily
4EPHA 2I9DA 2H3PA 3L60A 2XHGA 4KECA 2JGPA 1PD5A 1EAFA 5KJWA 4G2MA 2BGHA 4HVMA 2RKTA 3CLAA 5KJSA 1T1UA 2II4A 1DPDA 2H4TA 1EAEA 3FP0A 4KE4A 2FY3A 1T7NA 4G0BA 4EP9A 1CIAA 1T7OA 2XR7A 2FY4A 1NM8A 1XL8A 1Q23A 1QCAA 3B2SA 1CLAA 2II3A 1NDIA 1EACA 2FY2A 4EYWA 1XMCA 1EABA 1NDFA 5KJTA 1EAAA 1L5AA 1DPCA 2H3WA 1XMDA 2RCUA 1C4TA 1E2OA 2DEBA 1XL7A 4JN5A 4N72A 1EADA 2E1VA 2RKVA 1DPBA 4G22A 1SCZA 2H3UA 5DU9A 2IHWA 1NDBA 5KJUA 3MAEA 3U9FA 5FALA 3U9BA 2E1UA 2FW3A 1NOCB 4JN3A 2FYOA 4CLAA 2CLAA 2FY5A 5KJVA 1Q9JA 2VSQA 3B30A 5DUAA 5T3EA 5FANA 1T7QA 2E1TA 3FOTA 2II5A 1S5OA 1Q6XA 2ZBAA
chains in the Genus database with same CATH topology
3U9FA 2I9DA 5FALA 3U9BA 1XMCA 1EABA 4G0BA 2E1UA 5KJTA 1NOCB 5DUAA 3L60A 1EAAA 2XHGA 1DPCA 2JGPA 4KECA 1L5AA 1PD5A 1XMDA 1EAFA 4JN3A 4CLAA 2CLAA 1CIAA 5KJWA 5KJVA 4G2MA 1C4TA 1E2OA 1Q9JA 2VSQA 2BGHA 2XR7A 3B30A 1XL7A 4HVMA 4JN5A 4N72A 1EADA 1XL8A 2E1VA 2RKTA 3CLAA 1Q23A 1QCAA 2RKVA 5T3EA 5FANA 3B2SA 5KJSA 1DPBA 1CLAA 4G22A 2E1TA 1SCZA 2II3A 2II4A 5DU9A 2IHWA 3FOTA 1DPDA 2II5A 1EAEA 5KJUA 3FP0A 4KE4A 2ZBAA 3MAEA 1EACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U9F A;  2I9D A;  5FAL A;  3U9B A;  1XMC A;  1EAB A;  4G0B A;  2E1U A;  5KJT A;  1NOC B;  5DUA A;  3L60 A;  1EAA A;  2XHG A;  1DPC A;  2JGP A;  4KEC A;  1L5A A;  1PD5 A;  1XMD A;  1EAF A;  4JN3 A;  4CLA A;  2CLA A;  1CIA A;  5KJW A;  5KJV A;  4G2M A;  1C4T A;  1E2O A;  1Q9J A;  2VSQ A;  2BGH A;  2XR7 A;  3B30 A;  1XL7 A;  4HVM A;  4JN5 A;  4N72 A;  1EAD A;  1XL8 A;  2E1V A;  2RKT A;  3CLA A;  1Q23 A;  1QCA A;  2RKV A;  5T3E A;  5FAN A;  3B2S A;  5KJS A;  1DPB A;  1CLA A;  4G22 A;  2E1T A;  1SCZ A;  2II3 A;  2II4 A;  5DU9 A;  2IHW A;  3FOT A;  1DPD A;  2II5 A;  1EAE A;  5KJU A;  3FP0 A;  4KE4 A;  2ZBA A;  3MAE A;  1EAC A; 
#chains in the Genus database with same CATH topology
 4EPH A;  2I9D A;  2H3P A;  3L60 A;  2XHG A;  4KEC A;  2JGP A;  1PD5 A;  1EAF A;  5KJW A;  4G2M A;  2BGH A;  4HVM A;  2RKT A;  3CLA A;  5KJS A;  1T1U A;  2II4 A;  1DPD A;  2H4T A;  1EAE A;  3FP0 A;  4KE4 A;  2FY3 A;  1T7N A;  4G0B A;  4EP9 A;  1CIA A;  1T7O A;  2XR7 A;  2FY4 A;  1NM8 A;  1XL8 A;  1Q23 A;  1QCA A;  3B2S A;  1CLA A;  2II3 A;  1NDI A;  1EAC A;  2FY2 A;  4EYW A;  1XMC A;  1EAB A;  1NDF A;  5KJT A;  1EAA A;  1L5A A;  1DPC A;  2H3W A;  1XMD A;  2RCU A;  1C4T A;  1E2O A;  2DEB A;  1XL7 A;  4JN5 A;  4N72 A;  1EAD A;  2E1V A;  2RKV A;  1DPB A;  4G22 A;  1SCZ A;  2H3U A;  5DU9 A;  2IHW A;  1NDB A;  5KJU A;  3MAE A;  3U9F A;  5FAL A;  3U9B A;  2E1U A;  2FW3 A;  1NOC B;  4JN3 A;  2FYO A;  4CLA A;  2CLA A;  2FY5 A;  5KJV A;  1Q9J A;  2VSQ A;  3B30 A;  5DUA A;  5T3E A;  5FAN A;  1T7Q A;  2E1T A;  3FOT A;  2II5 A;  1S5O A;  1Q6X A;  2ZBA A; 
#chains in the Genus database with same CATH homology
 3U9F A;  2I9D A;  5FAL A;  3U9B A;  1XMC A;  1EAB A;  4G0B A;  2E1U A;  5KJT A;  1NOC B;  5DUA A;  3L60 A;  1EAA A;  2XHG A;  1DPC A;  2JGP A;  4KEC A;  1L5A A;  1PD5 A;  1XMD A;  1EAF A;  4JN3 A;  4CLA A;  2CLA A;  1CIA A;  5KJW A;  5KJV A;  4G2M A;  1C4T A;  1E2O A;  1Q9J A;  2VSQ A;  2BGH A;  2XR7 A;  3B30 A;  1XL7 A;  4HVM A;  4JN5 A;  4N72 A;  1EAD A;  1XL8 A;  2E1V A;  2RKT A;  3CLA A;  1Q23 A;  1QCA A;  2RKV A;  5T3E A;  5FAN A;  3B2S A;  5KJS A;  1DPB A;  1CLA A;  4G22 A;  2E1T A;  1SCZ A;  2II3 A;  2II4 A;  5DU9 A;  2IHW A;  3FOT A;  1DPD A;  2II5 A;  1EAE A;  5KJU A;  3FP0 A;  4KE4 A;  2ZBA A;  3MAE A;  1EAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...