1S5OA

Structural and mutational characterization of l-carnitine binding to human carnitine acetyltransferase
Total Genus 215
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
215
sequence length
591
structure length
591
Chain Sequence
HHTDPLPRLPVPPLQQSLDHYLKALQPIVSEEEWAHTKQLVDEFQASGGVGERLQKGLERRARKTENWLSEWWLKTAYLQYRQPVVIYSSPGVMLPKQDFVDLQGQLRFAAKLIEGVLDFKVMIDNETLPVEYLGGKPLCMNQYYQILSSCRVPGPKQDTVSNFSKTKKPPTHITVVHNYQFFELDVYHSDGTPLTADQIFVQLEKIWNSSLQTNKEPVGILTSNHRNSWAKAYNTLIKDKVNRDSVRSIQKSIFTVCLDATMPRVSEDVYRSHVAGQMLHGGGSRLNSGNRWFDKTLQFIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIEYTKKPELVRSPMVPLPMPKKLRFNITPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKDFPKSEKLSPDAFIQMALQLAYYRIYGQACATYESASLRMFHLGRTDTIRSASMDSLTFVKAMDDSSVTEHQKVELLRKAVQAHRGYTDRAIRGEAFDRHLLGLKLQAIEDLVSTPDIFMDTSYAIAMHFHLSTSQVPAKTDCVMFFGPVVPDGYGVCYNPMEAHINFSLSAYNSCAETNAARLAHYLEKALLDMRALLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords carnitine acetyltransferase isoform 2
publication title Structural and mutational characterization of l-carnitine binding to human carnitine acetyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 215
structure length 591
sequence length 591
ec nomenclature ec 2.3.1.7: Carnitine O-acetyltransferase.
pdb deposition date 2004-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00755 Carn_acyltransf Choline/Carnitine o-acyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.40 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol Acetyltransferase 1s5oA01
3.30.559.70 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol Acetyltransferase 1s5oA02
4EPHA 2FY4A 2FY3A 2FYOA 4EYWA 2FY2A 1T7NA 4EP9A 1T7QA 2FW3A 1NM8A 1Q6XA 2RCUA 2H3WA 1S5OA 1NDBA 1T1UA 2DEBA 1NDIA 1NDFA 2H3UA 2H4TA 2FY5A 2H3PA 1T7OA
chains in the Genus database with same CATH superfamily
3U9FA 2FY4A 2FY3A 2JGPA 1XMDA 2RKTA 2II5A 3U9BA 2E1TA 1Q23A 1XL7A 2II3A 4CLAA 2VSQA 5KJWA 2BGHA 1XMCA 4KECA 1DPCA 3CLAA 5KJUA 5T3EA 2IHWA 1T7NA 3FP0A 2FW3A 2XHGA 1NM8A 5KJTA 1Q6XA 1EAFA 4G0BA 1Q9JA 2RCUA 2H3WA 1CLAA 2E1UA 1QCAA 1NDBA 5KJVA 1PD5A 1NOCB 2I9DA 1NDFA 2H4TA 3MAEA 4EPHA 1L5AA 3FOTA 2FYOA 2II4A 4EYWA 2E1VA 4G2MA 1T7QA 5DUAA 1EABA 1S5OA 1E2OA 1T1UA 2DEBA 3B30A 1EADA 2RKVA 5KJSA 1EACA 1SCZA 4JN3A 1DPBA 1T7OA 4HVMA 2XR7A 1EAEA 2FY2A 1CIAA 1EAAA 4EP9A 1XL8A 3L60A 5FANA 4G22A 3B2SA 2CLAA 4JN5A 4N72A 2ZBAA 1DPDA 1NDIA 4KE4A 1C4TA 2H3UA 2FY5A 2H3PA 5FALA 5DU9A
chains in the Genus database with same CATH topology
4EPHA 2FY4A 2FY3A 2FYOA 4EYWA 2JGPA 2FY2A 5T3EA 1T7NA 4EP9A 3FP0A 1T7QA 2FW3A 2XHGA 1NM8A 4JN5A 1Q6XA 5DUAA 1Q9JA 2RCUA 2H3WA 1S5OA 1NDBA 1T1UA 2DEBA 2VSQA 1NDIA 1NDFA 2H3UA 2H4TA 4JN3A 2FY5A 2H3PA 1T7OA 4HVMA 5DU9A 1L5AA 3FOTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EPH A;  2FY4 A;  2FY3 A;  2FYO A;  4EYW A;  2FY2 A;  1T7N A;  4EP9 A;  1T7Q A;  2FW3 A;  1NM8 A;  1Q6X A;  2RCU A;  2H3W A;  1S5O A;  1NDB A;  1T1U A;  2DEB A;  1NDI A;  1NDF A;  2H3U A;  2H4T A;  2FY5 A;  2H3P A;  1T7O A; 
#chains in the Genus database with same CATH topology
 3U9F A;  2FY4 A;  2FY3 A;  2JGP A;  1XMD A;  2RKT A;  2II5 A;  3U9B A;  2E1T A;  1Q23 A;  1XL7 A;  2II3 A;  4CLA A;  2VSQ A;  5KJW A;  2BGH A;  1XMC A;  4KEC A;  1DPC A;  3CLA A;  5KJU A;  5T3E A;  2IHW A;  1T7N A;  3FP0 A;  2FW3 A;  2XHG A;  1NM8 A;  5KJT A;  1Q6X A;  1EAF A;  4G0B A;  1Q9J A;  2RCU A;  2H3W A;  1CLA A;  2E1U A;  1QCA A;  1NDB A;  5KJV A;  1PD5 A;  1NOC B;  2I9D A;  1NDF A;  2H4T A;  3MAE A;  4EPH A;  1L5A A;  3FOT A;  2FYO A;  2II4 A;  4EYW A;  2E1V A;  4G2M A;  1T7Q A;  5DUA A;  1EAB A;  1S5O A;  1E2O A;  1T1U A;  2DEB A;  3B30 A;  1EAD A;  2RKV A;  5KJS A;  1EAC A;  1SCZ A;  4JN3 A;  1DPB A;  1T7O A;  4HVM A;  2XR7 A;  1EAE A;  2FY2 A;  1CIA A;  1EAA A;  4EP9 A;  1XL8 A;  3L60 A;  5FAN A;  4G22 A;  3B2S A;  2CLA A;  4JN5 A;  4N72 A;  2ZBA A;  1DPD A;  1NDI A;  4KE4 A;  1C4T A;  2H3U A;  2FY5 A;  2H3P A;  5FAL A;  5DU9 A; 
#chains in the Genus database with same CATH homology
 4EPH A;  2FY4 A;  2FY3 A;  2FYO A;  4EYW A;  2JGP A;  2FY2 A;  5T3E A;  1T7N A;  4EP9 A;  3FP0 A;  1T7Q A;  2FW3 A;  2XHG A;  1NM8 A;  4JN5 A;  1Q6X A;  5DUA A;  1Q9J A;  2RCU A;  2H3W A;  1S5O A;  1NDB A;  1T1U A;  2DEB A;  2VSQ A;  1NDI A;  1NDF A;  2H3U A;  2H4T A;  4JN3 A;  2FY5 A;  2H3P A;  1T7O A;  4HVM A;  5DU9 A;  1L5A A;  3FOT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...