1S5OA

Structural and mutational characterization of l-carnitine binding to human carnitine acetyltransferase
Total Genus 215
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
215
sequence length
591
structure length
591
Chain Sequence
b'HHTDPLPRLPVPPLQQSLDHYLKALQPIVSEEEWAHTKQLVDEFQASGGVGERLQKGLERRARKTENWLSEWWLKTAYLQYRQPVVIYSSPGVMLPKQDFVDLQGQLRFAAKLIEGVLDFKVMIDNETLPVEYLGGKPLCMNQYYQILSSCRVPGPKQDTVSNFSKTKKPPTHITVVHNYQFFELDVYHSDGTPLTADQIFVQLEKIWNSSLQTNKEPVGILTSNHRNSWAKAYNTLIKDKVNRDSVRSIQKSIFTVCLDATMPRVSEDVYRSHVAGQMLHGGGSRLNSGNRWFDKTLQFIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIEYTKKPELVRSPMVPLPMPKKLRFNITPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKDFPKSEKLSPDAFIQMALQLAYYRIYGQACATYESASLRMFHLGRTDTIRSASMDSLTFVKAMDDSSVTEHQKVELLRKAVQAHRGYTDRAIRGEAFDRHLLGLKLQAIEDLVSTPDIFMDTSYAIAMHFHLSTSQVPAKTDCVMFFGPVVPDGYGVCYNPMEAHINFSLSAYNSCAETNAARLAHYLEKALLDMRALLQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords carnitine acetyltransferase isoform 2
publication title Structural and mutational characterization of l-carnitine binding to human carnitine acetyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 215
structure length 591
sequence length 591
ec nomenclature ec 2.3.1.7: Carnitine O-acetyltransferase.
pdb deposition date 2004-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00755 Carn_acyltransf Choline/Carnitine o-acyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.40 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol Acetyltransferase 1s5oA01
3.30.559.70 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol Acetyltransferase 1s5oA02
2FW3A 2FYOA 2H3UA 1S5OA 2FY2A 2H3PA 4EP9A 1T7NA 2FY3A 2H4TA 4EPHA 2FY5A 1NDIA 1NDBA 1T7QA 1T7OA 2H3WA 2DEBA 1Q6XA 4EYWA 2RCUA 2FY4A 1NM8A 1NDFA 1T1UA
chains in the Genus database with same CATH superfamily
2VSQA 2FW3A 1XMDA 1CIAA 2H3PA 4EP9A 1T7NA 5KJUA 2CLAA 1CLAA 2H4TA 2E1VA 2E1TA 1NDIA 2FY5A 4G22A 2FY4A 1SCZA 1NDFA 1XL7A 4HVMA 1NOCB 3MAEA 3U9FA 2II3A 4N72A 4KE4A 2FY2A 1EABA 2II4A 1EAFA 5KJWA 2JGPA 5DU9A 3B2SA 1NDBA 1Q23A 2H3WA 4G0BA 1Q9JA 1Q6XA 2RCUA 2E1UA 5FALA 4KECA 4JN3A 3B30A 1S5OA 4CLAA 4G2MA 2RKTA 1L5AA 1C4TA 1DPDA 3CLAA 3FOTA 2II5A 2XR7A 2ZBAA 1DPCA 1T7QA 1T7OA 2DEBA 5T3EA 4EYWA 1NM8A 2BGHA 2IHWA 5FANA 1EACA 2RKVA 3U9BA 2FYOA 2H3UA 3FP0A 5DUAA 1EADA 1EAAA 2FY3A 1E2OA 4JN5A 1XL8A 4EPHA 2I9DA 1DPBA 5KJSA 2XHGA 5KJVA 1EAEA 1PD5A 1XMCA 5KJTA 1T1UA 1QCAA 3L60A
chains in the Genus database with same CATH topology
2VSQA 2FW3A 2FYOA 4JN3A 2H3UA 3FP0A 1S5OA 5DUAA 2FY2A 2H3PA 4EP9A 1L5AA 1T7NA 2FY3A 4JN5A 2H4TA 4EPHA 2FY5A 1NDIA 2JGPA 3FOTA 5DU9A 1NDBA 2XHGA 1T7QA 1T7OA 2H3WA 2DEBA 1Q6XA 1Q9JA 5T3EA 4EYWA 2RCUA 2FY4A 1NM8A 1NDFA 1T1UA 4HVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FW3 A;  2FYO A;  2H3U A;  1S5O A;  2FY2 A;  2H3P A;  4EP9 A;  1T7N A;  2FY3 A;  2H4T A;  4EPH A;  2FY5 A;  1NDI A;  1NDB A;  1T7Q A;  1T7O A;  2H3W A;  2DEB A;  1Q6X A;  4EYW A;  2RCU A;  2FY4 A;  1NM8 A;  1NDF A;  1T1U A; 
#chains in the Genus database with same CATH topology
 2VSQ A;  2FW3 A;  1XMD A;  1CIA A;  2H3P A;  4EP9 A;  1T7N A;  5KJU A;  2CLA A;  1CLA A;  2H4T A;  2E1V A;  2E1T A;  1NDI A;  2FY5 A;  4G22 A;  2FY4 A;  1SCZ A;  1NDF A;  1XL7 A;  4HVM A;  1NOC B;  3MAE A;  3U9F A;  2II3 A;  4N72 A;  4KE4 A;  2FY2 A;  1EAB A;  2II4 A;  1EAF A;  5KJW A;  2JGP A;  5DU9 A;  3B2S A;  1NDB A;  1Q23 A;  2H3W A;  4G0B A;  1Q9J A;  1Q6X A;  2RCU A;  2E1U A;  5FAL A;  4KEC A;  4JN3 A;  3B30 A;  1S5O A;  4CLA A;  4G2M A;  2RKT A;  1L5A A;  1C4T A;  1DPD A;  3CLA A;  3FOT A;  2II5 A;  2XR7 A;  2ZBA A;  1DPC A;  1T7Q A;  1T7O A;  2DEB A;  5T3E A;  4EYW A;  1NM8 A;  2BGH A;  2IHW A;  5FAN A;  1EAC A;  2RKV A;  3U9B A;  2FYO A;  2H3U A;  3FP0 A;  5DUA A;  1EAD A;  1EAA A;  2FY3 A;  1E2O A;  4JN5 A;  1XL8 A;  4EPH A;  2I9D A;  1DPB A;  5KJS A;  2XHG A;  5KJV A;  1EAE A;  1PD5 A;  1XMC A;  5KJT A;  1T1U A;  1QCA A;  3L60 A; 
#chains in the Genus database with same CATH homology
 2VSQ A;  2FW3 A;  2FYO A;  4JN3 A;  2H3U A;  3FP0 A;  1S5O A;  5DUA A;  2FY2 A;  2H3P A;  4EP9 A;  1L5A A;  1T7N A;  2FY3 A;  4JN5 A;  2H4T A;  4EPH A;  2FY5 A;  1NDI A;  2JGP A;  3FOT A;  5DU9 A;  1NDB A;  2XHG A;  1T7Q A;  1T7O A;  2H3W A;  2DEB A;  1Q6X A;  1Q9J A;  5T3E A;  4EYW A;  2RCU A;  2FY4 A;  1NM8 A;  1NDF A;  1T1U A;  4HVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...