1S5OA

Structural and mutational characterization of l-carnitine binding to human carnitine acetyltransferase
Total Genus 215
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
215
sequence length
591
structure length
591
Chain Sequence
HHTDPLPRLPVPPLQQSLDHYLKALQPIVSEEEWAHTKQLVDEFQASGGVGERLQKGLERRARKTENWLSEWWLKTAYLQYRQPVVIYSSPGVMLPKQDFVDLQGQLRFAAKLIEGVLDFKVMIDNETLPVEYLGGKPLCMNQYYQILSSCRVPGPKQDTVSNFSKTKKPPTHITVVHNYQFFELDVYHSDGTPLTADQIFVQLEKIWNSSLQTNKEPVGILTSNHRNSWAKAYNTLIKDKVNRDSVRSIQKSIFTVCLDATMPRVSEDVYRSHVAGQMLHGGGSRLNSGNRWFDKTLQFIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIEYTKKPELVRSPMVPLPMPKKLRFNITPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKDFPKSEKLSPDAFIQMALQLAYYRIYGQACATYESASLRMFHLGRTDTIRSASMDSLTFVKAMDDSSVTEHQKVELLRKAVQAHRGYTDRAIRGEAFDRHLLGLKLQAIEDLVSTPDIFMDTSYAIAMHFHLSTSQVPAKTDCVMFFGPVVPDGYGVCYNPMEAHINFSLSAYNSCAETNAARLAHYLEKALLDMRALLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords carnitine acetyltransferase isoform 2
publication title Structural and mutational characterization of l-carnitine binding to human carnitine acetyltransferase.
pubmed doi rcsb
source organism Homo sapiens
total genus 215
structure length 591
sequence length 591
ec nomenclature ec 2.3.1.7: Carnitine O-acetyltransferase.
pdb deposition date 2004-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00755 Carn_acyltransf Choline/Carnitine o-acyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.40 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol Acetyltransferase 1s5oA01
3.30.559.70 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol Acetyltransferase 1s5oA02
2FYOA 1S5OA 2H3WA 1NDBA 4EPHA 1NDFA 2H4TA 1T7QA 2FY3A 2FW3A 1NM8A 2H3PA 1T7NA 2H3UA 2RCUA 2FY2A 4EYWA 1Q6XA 1NDIA 2FY5A 4EP9A 1T7OA 2FY4A 1T1UA 2DEBA
chains in the Genus database with same CATH superfamily
3B30A 1S5OA 1NDBA 1L5AA 5FANA 1EACA 4G22A 2JGPA 5KJTA 1T7NA 4JN3A 2E1VA 1Q9JA 2E1UA 2XHGA 1T7OA 5DUAA 2FY4A 3CLAA 5KJWA 5DU9A 1DPBA 1NDFA 1C4TA 5T3EA 3MAEA 2II3A 1EAAA 3FP0A 2CLAA 2FY5A 2ZBAA 3U9FA 3B2SA 2DEBA 2BGHA 2RKTA 1CIAA 2H3WA 1Q23A 1EADA 5FALA 1QCAA 2H4TA 2RKVA 2E1TA 1T7QA 4KECA 1CLAA 1NM8A 5KJUA 3FOTA 1EAEA 2H3PA 2FY2A 4EYWA 5KJVA 1EABA 2I9DA 2II5A 3U9BA 1DPDA 5KJSA 1T1UA 3L60A 2FYOA 1NOCB 2II4A 2VSQA 1PD5A 4CLAA 1E2OA 1XL8A 4N72A 4EPHA 4HVMA 1EAFA 1XMDA 2FY3A 2FW3A 1XMCA 4KE4A 1XL7A 2H3UA 4JN5A 2RCUA 1DPCA 1Q6XA 4G0BA 1NDIA 1SCZA 2IHWA 2XR7A 4EP9A 4G2MA
chains in the Genus database with same CATH topology
2FYOA 1S5OA 2H3WA 2VSQA 5DU9A 1NDBA 4HVMA 4EPHA 1L5AA 1NDFA 5T3EA 2H4TA 1T7QA 2FY3A 2FW3A 1NM8A 3FOTA 2H3PA 2JGPA 1T7NA 2H3UA 4JN5A 4JN3A 2RCUA 2FY2A 4EYWA 1Q6XA 3FP0A 1NDIA 1Q9JA 2FY5A 4EP9A 2XHGA 1T7OA 5DUAA 2FY4A 1T1UA 2DEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYO A;  1S5O A;  2H3W A;  1NDB A;  4EPH A;  1NDF A;  2H4T A;  1T7Q A;  2FY3 A;  2FW3 A;  1NM8 A;  2H3P A;  1T7N A;  2H3U A;  2RCU A;  2FY2 A;  4EYW A;  1Q6X A;  1NDI A;  2FY5 A;  4EP9 A;  1T7O A;  2FY4 A;  1T1U A;  2DEB A; 
#chains in the Genus database with same CATH topology
 3B30 A;  1S5O A;  1NDB A;  1L5A A;  5FAN A;  1EAC A;  4G22 A;  2JGP A;  5KJT A;  1T7N A;  4JN3 A;  2E1V A;  1Q9J A;  2E1U A;  2XHG A;  1T7O A;  5DUA A;  2FY4 A;  3CLA A;  5KJW A;  5DU9 A;  1DPB A;  1NDF A;  1C4T A;  5T3E A;  3MAE A;  2II3 A;  1EAA A;  3FP0 A;  2CLA A;  2FY5 A;  2ZBA A;  3U9F A;  3B2S A;  2DEB A;  2BGH A;  2RKT A;  1CIA A;  2H3W A;  1Q23 A;  1EAD A;  5FAL A;  1QCA A;  2H4T A;  2RKV A;  2E1T A;  1T7Q A;  4KEC A;  1CLA A;  1NM8 A;  5KJU A;  3FOT A;  1EAE A;  2H3P A;  2FY2 A;  4EYW A;  5KJV A;  1EAB A;  2I9D A;  2II5 A;  3U9B A;  1DPD A;  5KJS A;  1T1U A;  3L60 A;  2FYO A;  1NOC B;  2II4 A;  2VSQ A;  1PD5 A;  4CLA A;  1E2O A;  1XL8 A;  4N72 A;  4EPH A;  4HVM A;  1EAF A;  1XMD A;  2FY3 A;  2FW3 A;  1XMC A;  4KE4 A;  1XL7 A;  2H3U A;  4JN5 A;  2RCU A;  1DPC A;  1Q6X A;  4G0B A;  1NDI A;  1SCZ A;  2IHW A;  2XR7 A;  4EP9 A;  4G2M A; 
#chains in the Genus database with same CATH homology
 2FYO A;  1S5O A;  2H3W A;  2VSQ A;  5DU9 A;  1NDB A;  4HVM A;  4EPH A;  1L5A A;  1NDF A;  5T3E A;  2H4T A;  1T7Q A;  2FY3 A;  2FW3 A;  1NM8 A;  3FOT A;  2H3P A;  2JGP A;  1T7N A;  2H3U A;  4JN5 A;  4JN3 A;  2RCU A;  2FY2 A;  4EYW A;  1Q6X A;  3FP0 A;  1NDI A;  1Q9J A;  2FY5 A;  4EP9 A;  2XHG A;  1T7O A;  5DUA A;  2FY4 A;  1T1U A;  2DEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...