1S5OA

Structural and mutational characterization of l-carnitine binding to human carnitine acetyltransferase
Total Genus 215
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
215
sequence length
591
structure length
591
Chain Sequence
HHTDPLPRLPVPPLQQSLDHYLKALQPIVSEEEWAHTKQLVDEFQASGGVGERLQKGLERRARKTENWLSEWWLKTAYLQYRQPVVIYSSPGVMLPKQDFVDLQGQLRFAAKLIEGVLDFKVMIDNETLPVEYLGGKPLCMNQYYQILSSCRVPGPKQDTVSNFSKTKKPPTHITVVHNYQFFELDVYHSDGTPLTADQIFVQLEKIWNSSLQTNKEPVGILTSNHRNSWAKAYNTLIKDKVNRDSVRSIQKSIFTVCLDATMPRVSEDVYRSHVAGQMLHGGGSRLNSGNRWFDKTLQFIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIEYTKKPELVRSPMVPLPMPKKLRFNITPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKDFPKSEKLSPDAFIQMALQLAYYRIYGQACATYESASLRMFHLGRTDTIRSASMDSLTFVKAMDDSSVTEHQKVELLRKAVQAHRGYTDRAIRGEAFDRHLLGLKLQAIEDLVSTPDIFMDTSYAIAMHFHLSTSQVPAKTDCVMFFGPVVPDGYGVCYNPMEAHINFSLSAYNSCAETNAARLAHYLEKALLDMRALLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords carnitine acetyltransferase isoform 2
publication title Structural and mutational characterization of l-carnitine binding to human carnitine acetyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 215
structure length 591
sequence length 591
ec nomenclature ec 2.3.1.7: Carnitine O-acetyltransferase.
pdb deposition date 2004-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00755 Carn_acyltransf Choline/Carnitine o-acyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.40 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol Acetyltransferase 1s5oA01
3.30.559.70 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol Acetyltransferase 1s5oA02
4EP9A 1T7OA 2RCUA 1NDIA 2H3UA 2FYOA 2FY5A 2FW3A 1Q6XA 2FY2A 2H3WA 4EYWA 1NDBA 2FY3A 4EPHA 2DEBA 1S5OA 2FY4A 1T1UA 2H4TA 1T7NA 1NM8A 1T7QA 1NDFA 2H3PA
chains in the Genus database with same CATH superfamily
4CLAA 2E1VA 4JN5A 1NDIA 1CIAA 3MAEA 1QCAA 1DPBA 1NOCB 1PD5A 2FY2A 5KJSA 1NDBA 5KJTA 2FY3A 5T3EA 4HVMA 2H4TA 1XL7A 1T7QA 2IHWA 1C4TA 3CLAA 5KJWA 1XMDA 2RCUA 1EADA 2H3UA 5FALA 2FYOA 1EAAA 2FW3A 1Q6XA 2E1UA 2E1TA 2I9DA 2RKVA 1SCZA 1EACA 1S5OA 2FY4A 2II3A 4G0BA 2II4A 4KECA 4N72A 3U9BA 3U9FA 1XL8A 4KE4A 1CLAA 2II5A 3FP0A 5KJVA 1T7OA 1Q23A 2JGPA 5DUAA 2RKTA 3FOTA 2CLAA 4EYWA 3B30A 1T1UA 1EAEA 2XHGA 2XR7A 1T7NA 1NDFA 2H3PA 5DU9A 4EP9A 1Q9JA 5KJUA 4G22A 2FY5A 2VSQA 2H3WA 4EPHA 4G2MA 1EAFA 2BGHA 2DEBA 1EABA 1L5AA 2ZBAA 1DPDA 3L60A 4JN3A 1NM8A 1XMCA 3B2SA 1DPCA 1E2OA 5FANA
chains in the Genus database with same CATH topology
5DU9A 4EP9A 3FP0A 1T7OA 2RCUA 1Q9JA 4JN5A 2JGPA 1NDIA 2H3UA 2FYOA 5DUAA 3FOTA 2FY5A 2FW3A 1Q6XA 2FY2A 2VSQA 2H3WA 4EYWA 1NDBA 2FY3A 4EPHA 2DEBA 1S5OA 5T3EA 2FY4A 4HVMA 1L5AA 1T1UA 2XHGA 2H4TA 1T7NA 1NM8A 4JN3A 1T7QA 1NDFA 2H3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EP9 A;  1T7O A;  2RCU A;  1NDI A;  2H3U A;  2FYO A;  2FY5 A;  2FW3 A;  1Q6X A;  2FY2 A;  2H3W A;  4EYW A;  1NDB A;  2FY3 A;  4EPH A;  2DEB A;  1S5O A;  2FY4 A;  1T1U A;  2H4T A;  1T7N A;  1NM8 A;  1T7Q A;  1NDF A;  2H3P A; 
#chains in the Genus database with same CATH topology
 4CLA A;  2E1V A;  4JN5 A;  1NDI A;  1CIA A;  3MAE A;  1QCA A;  1DPB A;  1NOC B;  1PD5 A;  2FY2 A;  5KJS A;  1NDB A;  5KJT A;  2FY3 A;  5T3E A;  4HVM A;  2H4T A;  1XL7 A;  1T7Q A;  2IHW A;  1C4T A;  3CLA A;  5KJW A;  1XMD A;  2RCU A;  1EAD A;  2H3U A;  5FAL A;  2FYO A;  1EAA A;  2FW3 A;  1Q6X A;  2E1U A;  2E1T A;  2I9D A;  2RKV A;  1SCZ A;  1EAC A;  1S5O A;  2FY4 A;  2II3 A;  4G0B A;  2II4 A;  4KEC A;  4N72 A;  3U9B A;  3U9F A;  1XL8 A;  4KE4 A;  1CLA A;  2II5 A;  3FP0 A;  5KJV A;  1T7O A;  1Q23 A;  2JGP A;  5DUA A;  2RKT A;  3FOT A;  2CLA A;  4EYW A;  3B30 A;  1T1U A;  1EAE A;  2XHG A;  2XR7 A;  1T7N A;  1NDF A;  2H3P A;  5DU9 A;  4EP9 A;  1Q9J A;  5KJU A;  4G22 A;  2FY5 A;  2VSQ A;  2H3W A;  4EPH A;  4G2M A;  1EAF A;  2BGH A;  2DEB A;  1EAB A;  1L5A A;  2ZBA A;  1DPD A;  3L60 A;  4JN3 A;  1NM8 A;  1XMC A;  3B2S A;  1DPC A;  1E2O A;  5FAN A; 
#chains in the Genus database with same CATH homology
 5DU9 A;  4EP9 A;  3FP0 A;  1T7O A;  2RCU A;  1Q9J A;  4JN5 A;  2JGP A;  1NDI A;  2H3U A;  2FYO A;  5DUA A;  3FOT A;  2FY5 A;  2FW3 A;  1Q6X A;  2FY2 A;  2VSQ A;  2H3W A;  4EYW A;  1NDB A;  2FY3 A;  4EPH A;  2DEB A;  1S5O A;  5T3E A;  2FY4 A;  4HVM A;  1L5A A;  1T1U A;  2XHG A;  2H4T A;  1T7N A;  1NM8 A;  4JN3 A;  1T7Q A;  1NDF A;  2H3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...