1EADA

Atomic structure of the cubic core of the pyruvate dehydrogenase multienzyme complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
243
structure length
243
Chain Sequence
IPPIPPVDFAKYGEIEEVPMTRLMQIGATNLHRSWLNVPHVTQFESADITELEAFRVAQKAVAKKAGVKLTVLPLLLKACAYLLKELPDFNSSLAPSGQALIRKKYVHIGFAVDTPDGLLVPVIRNVDQKSLLQLAAEAAELAEKARSKKLGADAMQGACFTISSLGHIGGTAFTPIVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLGDLLADIRAILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DIHYDROLIPOYL-TRANSACETYLASE
publication title Crystallographic analysis of substrate binding and catalysis in dihydrolipoyl transacetylase (E2p).
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Dihydrolipoamide acetyltransferase
total genus 65
structure length 243
sequence length 243
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1992-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1eadA00
2IHWA 4JN3A 2ZBAA 5DU9A 5KJTA 2XR7A 5FANA 1DPBA 1SCZA 4N72A 5KJUA 3FOTA 4KE4A 1EAFA 1EADA 1EABA 2E1TA 2XHGA 2E1VA 2II5A 1DPCA 5DUAA 5KJWA 1L5AA 1PD5A 4HVMA 1E2OA 1XMDA 3MAEA 4G2MA 4G22A 5KJSA 3U9BA 2VSQA 1C4TA 2RKVA 3B30A 1QCAA 1EACA 3L60A 3FP0A 1CIAA 1EAAA 2I9DA 1XL8A 1XMCA 2II4A 1EAEA 4JN5A 1Q23A 4KECA 3U9FA 4CLAA 4G0BA 1DPDA 2RKTA 2JGPA 2BGHA 1CLAA 2CLAA 5T3EA 1NOCB 5KJVA 3B2SA 2E1UA 5FALA 2II3A 3CLAA 1Q9JA 1XL7A
chains in the Genus database with same CATH superfamily
4JN3A 2H3WA 1NM8A 1DPBA 1SCZA 4N72A 1EADA 1EABA 2FY3A 1XMDA 4G22A 1T7NA 5KJUA 3FP0A 5FANA 4HVMA 1XMCA 1EAEA 4JN5A 3U9FA 4EYWA 2BGHA 5T3EA 2E1UA 2IHWA 2ZBAA 4EP9A 2XHGA 2E1VA 2II5A 1PD5A 5KJSA 3MAEA 4G2MA 2FY5A 3U9BA 2VSQA 1C4TA 1EACA 4KECA 1T7OA 2CLAA 5KJVA 5FALA 2II3A 1NDBA 2E1TA 2H3UA 1DPCA 1L5AA 2FY2A 2RKVA 3B30A 1XL8A 2FYOA 1Q23A 4G0BA 2RKTA 2FW3A 1NOCB 2DEBA 3CLAA 1Q9JA 1XL7A 5DU9A 2XR7A 1S5OA 2H3PA 3FOTA 4KE4A 1Q6XA 1EAFA 1NDFA 4EPHA 5DUAA 2RCUA 2H4TA 1E2OA 1NDIA 1T1UA 2FY4A 5KJWA 3L60A 1CIAA 1EAAA 2II4A 5KJTA 4CLAA 1DPDA 2JGPA 1CLAA 1T7QA 3B2SA 1QCAA 2I9DA
chains in the Genus database with same CATH topology
2IHWA 4JN3A 2ZBAA 5DU9A 5KJTA 2XR7A 5FANA 1DPBA 1SCZA 4N72A 5KJUA 3FOTA 4KE4A 1EAFA 1EADA 1EABA 2E1TA 2XHGA 2E1VA 2II5A 1DPCA 5DUAA 5KJWA 1L5AA 1PD5A 4HVMA 1E2OA 1XMDA 3MAEA 4G2MA 4G22A 5KJSA 3U9BA 2VSQA 1C4TA 2RKVA 3B30A 1QCAA 1EACA 3L60A 3FP0A 1CIAA 1EAAA 2I9DA 1XL8A 1XMCA 2II4A 1EAEA 4JN5A 1Q23A 4KECA 3U9FA 4CLAA 4G0BA 1DPDA 2RKTA 2JGPA 2BGHA 1CLAA 2CLAA 5T3EA 1NOCB 5KJVA 3B2SA 2E1UA 5FALA 2II3A 3CLAA 1Q9JA 1XL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IHW A;  4JN3 A;  2ZBA A;  5DU9 A;  5KJT A;  2XR7 A;  5FAN A;  1DPB A;  1SCZ A;  4N72 A;  5KJU A;  3FOT A;  4KE4 A;  1EAF A;  1EAD A;  1EAB A;  2E1T A;  2XHG A;  2E1V A;  2II5 A;  1DPC A;  5DUA A;  5KJW A;  1L5A A;  1PD5 A;  4HVM A;  1E2O A;  1XMD A;  3MAE A;  4G2M A;  4G22 A;  5KJS A;  3U9B A;  2VSQ A;  1C4T A;  2RKV A;  3B30 A;  1QCA A;  1EAC A;  3L60 A;  3FP0 A;  1CIA A;  1EAA A;  2I9D A;  1XL8 A;  1XMC A;  2II4 A;  1EAE A;  4JN5 A;  1Q23 A;  4KEC A;  3U9F A;  4CLA A;  4G0B A;  1DPD A;  2RKT A;  2JGP A;  2BGH A;  1CLA A;  2CLA A;  5T3E A;  1NOC B;  5KJV A;  3B2S A;  2E1U A;  5FAL A;  2II3 A;  3CLA A;  1Q9J A;  1XL7 A; 
#chains in the Genus database with same CATH topology
 4JN3 A;  2H3W A;  1NM8 A;  1DPB A;  1SCZ A;  4N72 A;  1EAD A;  1EAB A;  2FY3 A;  1XMD A;  4G22 A;  1T7N A;  5KJU A;  3FP0 A;  5FAN A;  4HVM A;  1XMC A;  1EAE A;  4JN5 A;  3U9F A;  4EYW A;  2BGH A;  5T3E A;  2E1U A;  2IHW A;  2ZBA A;  4EP9 A;  2XHG A;  2E1V A;  2II5 A;  1PD5 A;  5KJS A;  3MAE A;  4G2M A;  2FY5 A;  3U9B A;  2VSQ A;  1C4T A;  1EAC A;  4KEC A;  1T7O A;  2CLA A;  5KJV A;  5FAL A;  2II3 A;  1NDB A;  2E1T A;  2H3U A;  1DPC A;  1L5A A;  2FY2 A;  2RKV A;  3B30 A;  1XL8 A;  2FYO A;  1Q23 A;  4G0B A;  2RKT A;  2FW3 A;  1NOC B;  2DEB A;  3CLA A;  1Q9J A;  1XL7 A;  5DU9 A;  2XR7 A;  1S5O A;  2H3P A;  3FOT A;  4KE4 A;  1Q6X A;  1EAF A;  1NDF A;  4EPH A;  5DUA A;  2RCU A;  2H4T A;  1E2O A;  1NDI A;  1T1U A;  2FY4 A;  5KJW A;  3L60 A;  1CIA A;  1EAA A;  2II4 A;  5KJT A;  4CLA A;  1DPD A;  2JGP A;  1CLA A;  1T7Q A;  3B2S A;  1QCA A;  2I9D A; 
#chains in the Genus database with same CATH homology
 2IHW A;  4JN3 A;  2ZBA A;  5DU9 A;  5KJT A;  2XR7 A;  5FAN A;  1DPB A;  1SCZ A;  4N72 A;  5KJU A;  3FOT A;  4KE4 A;  1EAF A;  1EAD A;  1EAB A;  2E1T A;  2XHG A;  2E1V A;  2II5 A;  1DPC A;  5DUA A;  5KJW A;  1L5A A;  1PD5 A;  4HVM A;  1E2O A;  1XMD A;  3MAE A;  4G2M A;  4G22 A;  5KJS A;  3U9B A;  2VSQ A;  1C4T A;  2RKV A;  3B30 A;  1QCA A;  1EAC A;  3L60 A;  3FP0 A;  1CIA A;  1EAA A;  2I9D A;  1XL8 A;  1XMC A;  2II4 A;  1EAE A;  4JN5 A;  1Q23 A;  4KEC A;  3U9F A;  4CLA A;  4G0B A;  1DPD A;  2RKT A;  2JGP A;  2BGH A;  1CLA A;  2CLA A;  5T3E A;  1NOC B;  5KJV A;  3B2S A;  2E1U A;  5FAL A;  2II3 A;  3CLA A;  1Q9J A;  1XL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...