1EADA

Atomic structure of the cubic core of the pyruvate dehydrogenase multienzyme complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
243
structure length
243
Chain Sequence
b'IPPIPPVDFAKYGEIEEVPMTRLMQIGATNLHRSWLNVPHVTQFESADITELEAFRVAQKAVAKKAGVKLTVLPLLLKACAYLLKELPDFNSSLAPSGQALIRKKYVHIGFAVDTPDGLLVPVIRNVDQKSLLQLAAEAAELAEKARSKKLGADAMQGACFTISSLGHIGGTAFTPIVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLGDLLADIRAILL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DIHYDROLIPOYL-TRANSACETYLASE
publication title Crystallographic analysis of substrate binding and catalysis in dihydrolipoyl transacetylase (E2p).
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Dihydrolipoamide acetyltransferase
total genus 65
structure length 243
sequence length 243
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1992-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1eadA00
2CLAA 2E1UA 4HVMA 2E1TA 2II5A 1DPCA 1EAEA 2VSQA 4KECA 1EADA 5FANA 4G2MA 5T3EA 1XL7A 5KJVA 1XMDA 3L60A 2I9DA 1CLAA 2XHGA 3FP0A 4KE4A 1EACA 2RKTA 4CLAA 1C4TA 2JGPA 1DPDA 1E2OA 3B2SA 5KJWA 1XMCA 1QCAA 3U9FA 1DPBA 5KJTA 2RKVA 4G22A 5FALA 1EAFA 2BGHA 5DUAA 2IHWA 1EABA 4N72A 5KJSA 5DU9A 1NOCB 4JN5A 2II4A 2II3A 5KJUA 1XL8A 1EAAA 2ZBAA 1L5AA 3U9BA 3B30A 1CIAA 3MAEA 1Q9JA 1PD5A 2XR7A 1Q23A 2E1VA 1SCZA 3FOTA 4G0BA 4JN3A 3CLAA
chains in the Genus database with same CATH superfamily
2CLAA 2E1UA 4EYWA 2VSQA 1NDFA 4KECA 4G2MA 5KJVA 1XL7A 1T7QA 1EACA 2RCUA 1EAFA 1T1UA 2BGHA 5KJSA 4N72A 2FY4A 1T7OA 2II3A 5KJUA 2ZBAA 3U9BA 1CIAA 2DEBA 2E1VA 4JN3A 2FY2A 2II5A 4HVMA 1XMDA 3L60A 4EP9A 2RKTA 1NDBA 1C4TA 2H3PA 1XMCA 1QCAA 1DPBA 4G22A 5FALA 5DU9A 1NOCB 1S5OA 2FY5A 1XL8A 4G0BA 1Q9JA 2XR7A 1Q23A 1NM8A 1Q6XA 1EAEA 1EADA 5T3EA 1CLAA 4EPHA 4KE4A 2H3UA 2H4TA 3B2SA 2H3WA 5KJWA 5KJTA 5DUAA 1EAAA 3B30A 1NDIA 1T7NA 4JN5A 3CLAA 2FW3A 2E1TA 1DPCA 5FANA 2FY3A 2I9DA 2XHGA 3FP0A 2JGPA 1DPDA 1E2OA 2FYOA 3U9FA 2RKVA 2IHWA 1EABA 2II4A 1L5AA 3MAEA 1PD5A 3FOTA 1SCZA 4CLAA
chains in the Genus database with same CATH topology
2CLAA 2E1UA 4HVMA 2E1TA 2II5A 1DPCA 1EAEA 2VSQA 4KECA 1EADA 5FANA 4G2MA 5T3EA 1XL7A 5KJVA 1XMDA 3L60A 2I9DA 1CLAA 2XHGA 3FP0A 4KE4A 1EACA 2RKTA 4CLAA 1C4TA 2JGPA 1DPDA 1E2OA 3B2SA 5KJWA 1XMCA 1QCAA 3U9FA 1DPBA 5KJTA 2RKVA 4G22A 5FALA 1EAFA 2BGHA 5DUAA 2IHWA 1EABA 4N72A 5KJSA 5DU9A 1NOCB 4JN5A 2II4A 2II3A 5KJUA 1XL8A 1EAAA 2ZBAA 1L5AA 3U9BA 3B30A 1CIAA 3MAEA 1Q9JA 1PD5A 2XR7A 1Q23A 2E1VA 1SCZA 3FOTA 4G0BA 4JN3A 3CLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CLA A;  2E1U A;  4HVM A;  2E1T A;  2II5 A;  1DPC A;  1EAE A;  2VSQ A;  4KEC A;  1EAD A;  5FAN A;  4G2M A;  5T3E A;  1XL7 A;  5KJV A;  1XMD A;  3L60 A;  2I9D A;  1CLA A;  2XHG A;  3FP0 A;  4KE4 A;  1EAC A;  2RKT A;  4CLA A;  1C4T A;  2JGP A;  1DPD A;  1E2O A;  3B2S A;  5KJW A;  1XMC A;  1QCA A;  3U9F A;  1DPB A;  5KJT A;  2RKV A;  4G22 A;  5FAL A;  1EAF A;  2BGH A;  5DUA A;  2IHW A;  1EAB A;  4N72 A;  5KJS A;  5DU9 A;  1NOC B;  4JN5 A;  2II4 A;  2II3 A;  5KJU A;  1XL8 A;  1EAA A;  2ZBA A;  1L5A A;  3U9B A;  3B30 A;  1CIA A;  3MAE A;  1Q9J A;  1PD5 A;  2XR7 A;  1Q23 A;  2E1V A;  1SCZ A;  3FOT A;  4G0B A;  4JN3 A;  3CLA A; 
#chains in the Genus database with same CATH topology
 2CLA A;  2E1U A;  4EYW A;  2VSQ A;  1NDF A;  4KEC A;  4G2M A;  5KJV A;  1XL7 A;  1T7Q A;  1EAC A;  2RCU A;  1EAF A;  1T1U A;  2BGH A;  5KJS A;  4N72 A;  2FY4 A;  1T7O A;  2II3 A;  5KJU A;  2ZBA A;  3U9B A;  1CIA A;  2DEB A;  2E1V A;  4JN3 A;  2FY2 A;  2II5 A;  4HVM A;  1XMD A;  3L60 A;  4EP9 A;  2RKT A;  1NDB A;  1C4T A;  2H3P A;  1XMC A;  1QCA A;  1DPB A;  4G22 A;  5FAL A;  5DU9 A;  1NOC B;  1S5O A;  2FY5 A;  1XL8 A;  4G0B A;  1Q9J A;  2XR7 A;  1Q23 A;  1NM8 A;  1Q6X A;  1EAE A;  1EAD A;  5T3E A;  1CLA A;  4EPH A;  4KE4 A;  2H3U A;  2H4T A;  3B2S A;  2H3W A;  5KJW A;  5KJT A;  5DUA A;  1EAA A;  3B30 A;  1NDI A;  1T7N A;  4JN5 A;  3CLA A;  2FW3 A;  2E1T A;  1DPC A;  5FAN A;  2FY3 A;  2I9D A;  2XHG A;  3FP0 A;  2JGP A;  1DPD A;  1E2O A;  2FYO A;  3U9F A;  2RKV A;  2IHW A;  1EAB A;  2II4 A;  1L5A A;  3MAE A;  1PD5 A;  3FOT A;  1SCZ A;  4CLA A; 
#chains in the Genus database with same CATH homology
 2CLA A;  2E1U A;  4HVM A;  2E1T A;  2II5 A;  1DPC A;  1EAE A;  2VSQ A;  4KEC A;  1EAD A;  5FAN A;  4G2M A;  5T3E A;  1XL7 A;  5KJV A;  1XMD A;  3L60 A;  2I9D A;  1CLA A;  2XHG A;  3FP0 A;  4KE4 A;  1EAC A;  2RKT A;  4CLA A;  1C4T A;  2JGP A;  1DPD A;  1E2O A;  3B2S A;  5KJW A;  1XMC A;  1QCA A;  3U9F A;  1DPB A;  5KJT A;  2RKV A;  4G22 A;  5FAL A;  1EAF A;  2BGH A;  5DUA A;  2IHW A;  1EAB A;  4N72 A;  5KJS A;  5DU9 A;  1NOC B;  4JN5 A;  2II4 A;  2II3 A;  5KJU A;  1XL8 A;  1EAA A;  2ZBA A;  1L5A A;  3U9B A;  3B30 A;  1CIA A;  3MAE A;  1Q9J A;  1PD5 A;  2XR7 A;  1Q23 A;  2E1V A;  1SCZ A;  3FOT A;  4G0B A;  4JN3 A;  3CLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...