1EADA

Atomic structure of the cubic core of the pyruvate dehydrogenase multienzyme complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
243
structure length
243
Chain Sequence
IPPIPPVDFAKYGEIEEVPMTRLMQIGATNLHRSWLNVPHVTQFESADITELEAFRVAQKAVAKKAGVKLTVLPLLLKACAYLLKELPDFNSSLAPSGQALIRKKYVHIGFAVDTPDGLLVPVIRNVDQKSLLQLAAEAAELAEKARSKKLGADAMQGACFTISSLGHIGGTAFTPIVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLGDLLADIRAILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dihydrolipoamide acetyltransferase
molecule keywords DIHYDROLIPOYL-TRANSACETYLASE
publication title Crystallographic analysis of substrate binding and catalysis in dihydrolipoyl transacetylase (E2p).
pubmed doi rcsb
source organism Azotobacter vinelandii
total genus 65
structure length 243
sequence length 243
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1992-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1eadA00
2BGHA 2E1UA 2RKTA 5T3EA 5KJVA 1DPBA 2II5A 2JGPA 1L5AA 1EAAA 1EADA 1CIAA 2II3A 5KJWA 1DPCA 1DPDA 3CLAA 1NOCB 1XL7A 4JN5A 1Q9JA 4G22A 1Q23A 3U9BA 4HVMA 1EABA 2E1TA 2VSQA 1EAFA 2CLAA 2IHWA 3MAEA 4KE4A 1EAEA 4CLAA 5KJSA 1PD5A 3U9FA 2XR7A 1XMCA 3FOTA 2ZBAA 1SCZA 4G0BA 3B30A 4N72A 5KJUA 1XL8A 3L60A 1E2OA 4KECA 4JN3A 1QCAA 5FANA 2RKVA 5DU9A 1XMDA 2II4A 3B2SA 5FALA 5KJTA 1CLAA 2XHGA 1C4TA 4G2MA 3FP0A 5DUAA 1EACA 2I9DA 2E1VA
chains in the Genus database with same CATH superfamily
5T3EA 5KJWA 1CIAA 4HVMA 2IHWA 3MAEA 2H3PA 5KJSA 1PD5A 3U9FA 1XMCA 2FY2A 3FOTA 4KECA 5DU9A 1CLAA 1Q6XA 1NDBA 5DUAA 2BGHA 2E1UA 2RKTA 1DPBA 1L5AA 2FW3A 1DPDA 1NOCB 1T1UA 4G22A 3U9BA 2FYOA 1NDFA 2FY5A 2H3WA 1SCZA 1E2OA 4JN3A 1QCAA 1T7NA 2II4A 3B2SA 5FALA 4EP9A 2XHGA 3FP0A 2I9DA 4EYWA 5KJVA 2JGPA 1EAAA 1EADA 3CLAA 1XL7A 1T7OA 2H4TA 1Q9JA 4JN5A 1NDIA 2H3UA 2CLAA 4CLAA 2XR7A 4N72A 2ZBAA 3L60A 1NM8A 5FANA 1XMDA 5KJTA 1EACA 2E1VA 2II5A 2II3A 2RCUA 2FY3A 1DPCA 1T7QA 1Q23A 1EABA 2E1TA 2VSQA 1EAFA 4KE4A 1EAEA 2DEBA 4EPHA 4G0BA 5KJUA 3B30A 1XL8A 2RKVA 1S5OA 1C4TA 2FY4A 4G2MA
chains in the Genus database with same CATH topology
2BGHA 2E1UA 2RKTA 5T3EA 5KJVA 1DPBA 2II5A 2JGPA 1L5AA 1EAAA 1EADA 1CIAA 2II3A 5KJWA 1DPCA 1DPDA 3CLAA 1NOCB 1XL7A 4JN5A 1Q9JA 4G22A 1Q23A 3U9BA 4HVMA 1EABA 2E1TA 2VSQA 1EAFA 2CLAA 2IHWA 3MAEA 4KE4A 1EAEA 4CLAA 5KJSA 1PD5A 3U9FA 2XR7A 1XMCA 3FOTA 2ZBAA 1SCZA 4G0BA 3B30A 4N72A 5KJUA 1XL8A 3L60A 1E2OA 4KECA 4JN3A 1QCAA 5FANA 2RKVA 5DU9A 1XMDA 2II4A 3B2SA 5FALA 5KJTA 1CLAA 2XHGA 1C4TA 4G2MA 3FP0A 5DUAA 1EACA 2I9DA 2E1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BGH A;  2E1U A;  2RKT A;  5T3E A;  5KJV A;  1DPB A;  2II5 A;  2JGP A;  1L5A A;  1EAA A;  1EAD A;  1CIA A;  2II3 A;  5KJW A;  1DPC A;  1DPD A;  3CLA A;  1NOC B;  1XL7 A;  4JN5 A;  1Q9J A;  4G22 A;  1Q23 A;  3U9B A;  4HVM A;  1EAB A;  2E1T A;  2VSQ A;  1EAF A;  2CLA A;  2IHW A;  3MAE A;  4KE4 A;  1EAE A;  4CLA A;  5KJS A;  1PD5 A;  3U9F A;  2XR7 A;  1XMC A;  3FOT A;  2ZBA A;  1SCZ A;  4G0B A;  3B30 A;  4N72 A;  5KJU A;  1XL8 A;  3L60 A;  1E2O A;  4KEC A;  4JN3 A;  1QCA A;  5FAN A;  2RKV A;  5DU9 A;  1XMD A;  2II4 A;  3B2S A;  5FAL A;  5KJT A;  1CLA A;  2XHG A;  1C4T A;  4G2M A;  3FP0 A;  5DUA A;  1EAC A;  2I9D A;  2E1V A; 
#chains in the Genus database with same CATH topology
 5T3E A;  5KJW A;  1CIA A;  4HVM A;  2IHW A;  3MAE A;  2H3P A;  5KJS A;  1PD5 A;  3U9F A;  1XMC A;  2FY2 A;  3FOT A;  4KEC A;  5DU9 A;  1CLA A;  1Q6X A;  1NDB A;  5DUA A;  2BGH A;  2E1U A;  2RKT A;  1DPB A;  1L5A A;  2FW3 A;  1DPD A;  1NOC B;  1T1U A;  4G22 A;  3U9B A;  2FYO A;  1NDF A;  2FY5 A;  2H3W A;  1SCZ A;  1E2O A;  4JN3 A;  1QCA A;  1T7N A;  2II4 A;  3B2S A;  5FAL A;  4EP9 A;  2XHG A;  3FP0 A;  2I9D A;  4EYW A;  5KJV A;  2JGP A;  1EAA A;  1EAD A;  3CLA A;  1XL7 A;  1T7O A;  2H4T A;  1Q9J A;  4JN5 A;  1NDI A;  2H3U A;  2CLA A;  4CLA A;  2XR7 A;  4N72 A;  2ZBA A;  3L60 A;  1NM8 A;  5FAN A;  1XMD A;  5KJT A;  1EAC A;  2E1V A;  2II5 A;  2II3 A;  2RCU A;  2FY3 A;  1DPC A;  1T7Q A;  1Q23 A;  1EAB A;  2E1T A;  2VSQ A;  1EAF A;  4KE4 A;  1EAE A;  2DEB A;  4EPH A;  4G0B A;  5KJU A;  3B30 A;  1XL8 A;  2RKV A;  1S5O A;  1C4T A;  2FY4 A;  4G2M A; 
#chains in the Genus database with same CATH homology
 2BGH A;  2E1U A;  2RKT A;  5T3E A;  5KJV A;  1DPB A;  2II5 A;  2JGP A;  1L5A A;  1EAA A;  1EAD A;  1CIA A;  2II3 A;  5KJW A;  1DPC A;  1DPD A;  3CLA A;  1NOC B;  1XL7 A;  4JN5 A;  1Q9J A;  4G22 A;  1Q23 A;  3U9B A;  4HVM A;  1EAB A;  2E1T A;  2VSQ A;  1EAF A;  2CLA A;  2IHW A;  3MAE A;  4KE4 A;  1EAE A;  4CLA A;  5KJS A;  1PD5 A;  3U9F A;  2XR7 A;  1XMC A;  3FOT A;  2ZBA A;  1SCZ A;  4G0B A;  3B30 A;  4N72 A;  5KJU A;  1XL8 A;  3L60 A;  1E2O A;  4KEC A;  4JN3 A;  1QCA A;  5FAN A;  2RKV A;  5DU9 A;  1XMD A;  2II4 A;  3B2S A;  5FAL A;  5KJT A;  1CLA A;  2XHG A;  1C4T A;  4G2M A;  3FP0 A;  5DUA A;  1EAC A;  2I9D A;  2E1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...