1EACA

Atomic structure of the cubic core of the pyruvate dehydrogenase multienzyme complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
243
structure length
243
Chain Sequence
b'IPPIPPVDFAKYGEIEEVPMTRLMQIGATNLHRSWLNVPHVTQFESADITELEAFRVAQKAVAKKAGVKLTVLPLLLKACAYLLKELPDFNSSLAPSGQALIRKKYVHIGFAVDTPDGLLVPVIRNVDQKSLLQLAAEAAELAEKARSKKLGADAMQGACFTISSLGHIGGTAFTPIVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLGDLLADIRAILL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DIHYDROLIPOYL-TRANSACETYLASE
publication title Crystallographic analysis of substrate binding and catalysis in dihydrolipoyl transacetylase (E2p).
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Dihydrolipoamide acetyltransferase
total genus 67
structure length 243
sequence length 243
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1992-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1eacA00
1E2OA 1DPBA 1EABA 1Q9JA 1EAAA 1XMCA 1EADA 2IHWA 2II5A 2II4A 2VSQA 3FP0A 3FOTA 4G2MA 5KJSA 2E1UA 1NOCB 2RKTA 1XL7A 2E1VA 1XL8A 2RKVA 1EACA 1DPCA 1PD5A 4G22A 4CLAA 5DU9A 1EAFA 1DPDA 4HVMA 5KJWA 2BGHA 3L60A 5KJTA 5KJUA 1SCZA 4N72A 3B30A 2E1TA 1XMDA 1EAEA 2XR7A 4JN5A 4KECA 1CIAA 2ZBAA 3U9BA 2JGPA 5KJVA 2I9DA 3MAEA 1C4TA 5DUAA 4JN3A 1QCAA 2XHGA 5FALA 1CLAA 5T3EA 2CLAA 3B2SA 3U9FA 1Q23A 3CLAA 1L5AA 4KE4A 4G0BA 2II3A 5FANA
chains in the Genus database with same CATH superfamily
1E2OA 1DPBA 2RCUA 1EAAA 2IHWA 2II4A 2VSQA 3FP0A 5KJSA 1EACA 2H3UA 4CLAA 2DEBA 5KJWA 2BGHA 5KJTA 4N72A 1XMDA 1EAEA 3U9BA 1NM8A 1QCAA 2XHGA 1CLAA 2CLAA 2FY2A 1Q23A 5FANA 4EYWA 4KE4A 1EADA 2H3PA 1NOCB 2RKTA 2E1VA 1DPCA 4G22A 1NDFA 1Q6XA 1SCZA 4KECA 2ZBAA 2I9DA 1C4TA 5DUAA 4EPHA 5FALA 4EP9A 5T3EA 3U9FA 2II3A 1XMCA 1S5OA 4G2MA 2FY3A 2E1UA 1XL7A 2RKVA 1PD5A 1DPDA 4HVMA 2H4TA 3B30A 2E1TA 1CIAA 4JN3A 2FW3A 1T7NA 3B2SA 1EABA 1Q9JA 2FY5A 2II5A 3FOTA 1XL8A 5DU9A 1EAFA 1NDBA 1T7QA 3L60A 5KJUA 4JN5A 2XR7A 2JGPA 1T7OA 5KJVA 3MAEA 1T1UA 2FY4A 2FYOA 1NDIA 2H3WA 3CLAA 1L5AA 4G0BA
chains in the Genus database with same CATH topology
1E2OA 1DPBA 1EABA 1Q9JA 1EAAA 1XMCA 1EADA 2IHWA 2II5A 2II4A 2VSQA 3FP0A 3FOTA 4G2MA 5KJSA 2E1UA 1NOCB 2RKTA 1XL7A 2E1VA 1XL8A 2RKVA 1EACA 1DPCA 1PD5A 4G22A 4CLAA 5DU9A 1EAFA 1DPDA 4HVMA 5KJWA 2BGHA 3L60A 5KJTA 5KJUA 1SCZA 4N72A 3B30A 2E1TA 1XMDA 1EAEA 2XR7A 4JN5A 4KECA 1CIAA 2ZBAA 3U9BA 2JGPA 5KJVA 2I9DA 3MAEA 1C4TA 5DUAA 4JN3A 1QCAA 2XHGA 5FALA 1CLAA 5T3EA 2CLAA 3B2SA 3U9FA 1Q23A 3CLAA 1L5AA 4KE4A 4G0BA 2II3A 5FANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E2O A;  1DPB A;  1EAB A;  1Q9J A;  1EAA A;  1XMC A;  1EAD A;  2IHW A;  2II5 A;  2II4 A;  2VSQ A;  3FP0 A;  3FOT A;  4G2M A;  5KJS A;  2E1U A;  1NOC B;  2RKT A;  1XL7 A;  2E1V A;  1XL8 A;  2RKV A;  1EAC A;  1DPC A;  1PD5 A;  4G22 A;  4CLA A;  5DU9 A;  1EAF A;  1DPD A;  4HVM A;  5KJW A;  2BGH A;  3L60 A;  5KJT A;  5KJU A;  1SCZ A;  4N72 A;  3B30 A;  2E1T A;  1XMD A;  1EAE A;  2XR7 A;  4JN5 A;  4KEC A;  1CIA A;  2ZBA A;  3U9B A;  2JGP A;  5KJV A;  2I9D A;  3MAE A;  1C4T A;  5DUA A;  4JN3 A;  1QCA A;  2XHG A;  5FAL A;  1CLA A;  5T3E A;  2CLA A;  3B2S A;  3U9F A;  1Q23 A;  3CLA A;  1L5A A;  4KE4 A;  4G0B A;  2II3 A;  5FAN A; 
#chains in the Genus database with same CATH topology
 1E2O A;  1DPB A;  2RCU A;  1EAA A;  2IHW A;  2II4 A;  2VSQ A;  3FP0 A;  5KJS A;  1EAC A;  2H3U A;  4CLA A;  2DEB A;  5KJW A;  2BGH A;  5KJT A;  4N72 A;  1XMD A;  1EAE A;  3U9B A;  1NM8 A;  1QCA A;  2XHG A;  1CLA A;  2CLA A;  2FY2 A;  1Q23 A;  5FAN A;  4EYW A;  4KE4 A;  1EAD A;  2H3P A;  1NOC B;  2RKT A;  2E1V A;  1DPC A;  4G22 A;  1NDF A;  1Q6X A;  1SCZ A;  4KEC A;  2ZBA A;  2I9D A;  1C4T A;  5DUA A;  4EPH A;  5FAL A;  4EP9 A;  5T3E A;  3U9F A;  2II3 A;  1XMC A;  1S5O A;  4G2M A;  2FY3 A;  2E1U A;  1XL7 A;  2RKV A;  1PD5 A;  1DPD A;  4HVM A;  2H4T A;  3B30 A;  2E1T A;  1CIA A;  4JN3 A;  2FW3 A;  1T7N A;  3B2S A;  1EAB A;  1Q9J A;  2FY5 A;  2II5 A;  3FOT A;  1XL8 A;  5DU9 A;  1EAF A;  1NDB A;  1T7Q A;  3L60 A;  5KJU A;  4JN5 A;  2XR7 A;  2JGP A;  1T7O A;  5KJV A;  3MAE A;  1T1U A;  2FY4 A;  2FYO A;  1NDI A;  2H3W A;  3CLA A;  1L5A A;  4G0B A; 
#chains in the Genus database with same CATH homology
 1E2O A;  1DPB A;  1EAB A;  1Q9J A;  1EAA A;  1XMC A;  1EAD A;  2IHW A;  2II5 A;  2II4 A;  2VSQ A;  3FP0 A;  3FOT A;  4G2M A;  5KJS A;  2E1U A;  1NOC B;  2RKT A;  1XL7 A;  2E1V A;  1XL8 A;  2RKV A;  1EAC A;  1DPC A;  1PD5 A;  4G22 A;  4CLA A;  5DU9 A;  1EAF A;  1DPD A;  4HVM A;  5KJW A;  2BGH A;  3L60 A;  5KJT A;  5KJU A;  1SCZ A;  4N72 A;  3B30 A;  2E1T A;  1XMD A;  1EAE A;  2XR7 A;  4JN5 A;  4KEC A;  1CIA A;  2ZBA A;  3U9B A;  2JGP A;  5KJV A;  2I9D A;  3MAE A;  1C4T A;  5DUA A;  4JN3 A;  1QCA A;  2XHG A;  5FAL A;  1CLA A;  5T3E A;  2CLA A;  3B2S A;  3U9F A;  1Q23 A;  3CLA A;  1L5A A;  4KE4 A;  4G0B A;  2II3 A;  5FAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...