1EACA

Atomic structure of the cubic core of the pyruvate dehydrogenase multienzyme complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
243
structure length
243
Chain Sequence
IPPIPPVDFAKYGEIEEVPMTRLMQIGATNLHRSWLNVPHVTQFESADITELEAFRVAQKAVAKKAGVKLTVLPLLLKACAYLLKELPDFNSSLAPSGQALIRKKYVHIGFAVDTPDGLLVPVIRNVDQKSLLQLAAEAAELAEKARSKKLGADAMQGACFTISSLGHIGGTAFTPIVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLGDLLADIRAILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DIHYDROLIPOYL-TRANSACETYLASE
publication title Crystallographic analysis of substrate binding and catalysis in dihydrolipoyl transacetylase (E2p).
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Dihydrolipoamide acetyltransferase
total genus 67
structure length 243
sequence length 243
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1992-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1eacA00
1C4TA 2E1TA 2IHWA 1NOCB 4JN5A 2II3A 5T3EA 5KJWA 5KJVA 2BGHA 5KJSA 4JN3A 5FALA 5FANA 4G22A 1EABA 2II5A 5DU9A 4HVMA 1EAFA 2VSQA 2E1UA 1E2OA 1EACA 1EADA 1Q9JA 1PD5A 1DPDA 1XL7A 2RKVA 2ZBAA 1DPBA 1L5AA 4G2MA 1XMDA 3CLAA 3U9FA 1CIAA 1EAEA 2E1VA 5DUAA 1Q23A 2II4A 3FOTA 3U9BA 4KE4A 1DPCA 3FP0A 2JGPA 4KECA 1XMCA 2I9DA 2XR7A 3MAEA 1SCZA 3B2SA 1XL8A 4CLAA 1CLAA 3B30A 4G0BA 3L60A 5KJUA 2XHGA 4N72A 5KJTA 2RKTA 2CLAA 1QCAA 1EAAA
chains in the Genus database with same CATH superfamily
2H3PA 2IHWA 2II3A 4JN3A 5FANA 2E1UA 1E2OA 1PD5A 1DPDA 1XL7A 3CLAA 3U9FA 1CIAA 1EAEA 1Q23A 3FOTA 1NDBA 2H4TA 3U9BA 1T1UA 2RCUA 5KJUA 4JN5A 4N72A 1NOCB 5KJWA 5KJSA 1Q6XA 1EAFA 2VSQA 1T7QA 2H3WA 2ZBAA 1L5AA 4G2MA 5DUAA 2II4A 4KE4A 3FP0A 4KECA 1XMCA 2FY4A 2H3UA 4CLAA 4G0BA 5KJTA 2RKTA 1QCAA 2FW3A 4EP9A 1C4TA 5T3EA 2BGHA 5FALA 2FY2A 4EYWA 1NM8A 1EACA 1EADA 2RKVA 1DPBA 1XMDA 1T7NA 2E1VA 2FY5A 1DPCA 2I9DA 3MAEA 3B2SA 1NDFA 1T7OA 2XHGA 2E1TA 5KJVA 2DEBA 4G22A 1EABA 2II5A 5DU9A 1NDIA 4HVMA 2FYOA 1Q9JA 2FY3A 4EPHA 2JGPA 2XR7A 1SCZA 1XL8A 1CLAA 3B30A 1S5OA 3L60A 2CLAA 1EAAA
chains in the Genus database with same CATH topology
1C4TA 2E1TA 2IHWA 1NOCB 4JN5A 2II3A 5T3EA 5KJWA 5KJVA 2BGHA 5KJSA 4JN3A 5FALA 5FANA 4G22A 1EABA 2II5A 5DU9A 4HVMA 1EAFA 2VSQA 2E1UA 1E2OA 1EACA 1EADA 1Q9JA 1PD5A 1DPDA 1XL7A 2RKVA 2ZBAA 1DPBA 1L5AA 4G2MA 1XMDA 3CLAA 3U9FA 1CIAA 1EAEA 2E1VA 5DUAA 1Q23A 2II4A 3FOTA 3U9BA 4KE4A 1DPCA 3FP0A 2JGPA 4KECA 1XMCA 2I9DA 2XR7A 3MAEA 1SCZA 3B2SA 1XL8A 4CLAA 1CLAA 3B30A 4G0BA 3L60A 5KJUA 2XHGA 4N72A 5KJTA 2RKTA 2CLAA 1QCAA 1EAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C4T A;  2E1T A;  2IHW A;  1NOC B;  4JN5 A;  2II3 A;  5T3E A;  5KJW A;  5KJV A;  2BGH A;  5KJS A;  4JN3 A;  5FAL A;  5FAN A;  4G22 A;  1EAB A;  2II5 A;  5DU9 A;  4HVM A;  1EAF A;  2VSQ A;  2E1U A;  1E2O A;  1EAC A;  1EAD A;  1Q9J A;  1PD5 A;  1DPD A;  1XL7 A;  2RKV A;  2ZBA A;  1DPB A;  1L5A A;  4G2M A;  1XMD A;  3CLA A;  3U9F A;  1CIA A;  1EAE A;  2E1V A;  5DUA A;  1Q23 A;  2II4 A;  3FOT A;  3U9B A;  4KE4 A;  1DPC A;  3FP0 A;  2JGP A;  4KEC A;  1XMC A;  2I9D A;  2XR7 A;  3MAE A;  1SCZ A;  3B2S A;  1XL8 A;  4CLA A;  1CLA A;  3B30 A;  4G0B A;  3L60 A;  5KJU A;  2XHG A;  4N72 A;  5KJT A;  2RKT A;  2CLA A;  1QCA A;  1EAA A; 
#chains in the Genus database with same CATH topology
 2H3P A;  2IHW A;  2II3 A;  4JN3 A;  5FAN A;  2E1U A;  1E2O A;  1PD5 A;  1DPD A;  1XL7 A;  3CLA A;  3U9F A;  1CIA A;  1EAE A;  1Q23 A;  3FOT A;  1NDB A;  2H4T A;  3U9B A;  1T1U A;  2RCU A;  5KJU A;  4JN5 A;  4N72 A;  1NOC B;  5KJW A;  5KJS A;  1Q6X A;  1EAF A;  2VSQ A;  1T7Q A;  2H3W A;  2ZBA A;  1L5A A;  4G2M A;  5DUA A;  2II4 A;  4KE4 A;  3FP0 A;  4KEC A;  1XMC A;  2FY4 A;  2H3U A;  4CLA A;  4G0B A;  5KJT A;  2RKT A;  1QCA A;  2FW3 A;  4EP9 A;  1C4T A;  5T3E A;  2BGH A;  5FAL A;  2FY2 A;  4EYW A;  1NM8 A;  1EAC A;  1EAD A;  2RKV A;  1DPB A;  1XMD A;  1T7N A;  2E1V A;  2FY5 A;  1DPC A;  2I9D A;  3MAE A;  3B2S A;  1NDF A;  1T7O A;  2XHG A;  2E1T A;  5KJV A;  2DEB A;  4G22 A;  1EAB A;  2II5 A;  5DU9 A;  1NDI A;  4HVM A;  2FYO A;  1Q9J A;  2FY3 A;  4EPH A;  2JGP A;  2XR7 A;  1SCZ A;  1XL8 A;  1CLA A;  3B30 A;  1S5O A;  3L60 A;  2CLA A;  1EAA A; 
#chains in the Genus database with same CATH homology
 1C4T A;  2E1T A;  2IHW A;  1NOC B;  4JN5 A;  2II3 A;  5T3E A;  5KJW A;  5KJV A;  2BGH A;  5KJS A;  4JN3 A;  5FAL A;  5FAN A;  4G22 A;  1EAB A;  2II5 A;  5DU9 A;  4HVM A;  1EAF A;  2VSQ A;  2E1U A;  1E2O A;  1EAC A;  1EAD A;  1Q9J A;  1PD5 A;  1DPD A;  1XL7 A;  2RKV A;  2ZBA A;  1DPB A;  1L5A A;  4G2M A;  1XMD A;  3CLA A;  3U9F A;  1CIA A;  1EAE A;  2E1V A;  5DUA A;  1Q23 A;  2II4 A;  3FOT A;  3U9B A;  4KE4 A;  1DPC A;  3FP0 A;  2JGP A;  4KEC A;  1XMC A;  2I9D A;  2XR7 A;  3MAE A;  1SCZ A;  3B2S A;  1XL8 A;  4CLA A;  1CLA A;  3B30 A;  4G0B A;  3L60 A;  5KJU A;  2XHG A;  4N72 A;  5KJT A;  2RKT A;  2CLA A;  1QCA A;  1EAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...