1EACA

Atomic structure of the cubic core of the pyruvate dehydrogenase multienzyme complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
243
structure length
243
Chain Sequence
IPPIPPVDFAKYGEIEEVPMTRLMQIGATNLHRSWLNVPHVTQFESADITELEAFRVAQKAVAKKAGVKLTVLPLLLKACAYLLKELPDFNSSLAPSGQALIRKKYVHIGFAVDTPDGLLVPVIRNVDQKSLLQLAAEAAELAEKARSKKLGADAMQGACFTISSLGHIGGTAFTPIVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLGDLLADIRAILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dihydrolipoamide acetyltransferase
molecule keywords DIHYDROLIPOYL-TRANSACETYLASE
publication title Crystallographic analysis of substrate binding and catalysis in dihydrolipoyl transacetylase (E2p).
pubmed doi rcsb
source organism Azotobacter vinelandii
total genus 67
structure length 243
sequence length 243
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1992-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1eacA00
2E1VA 1DPCA 4KECA 2RKTA 5FALA 3CLAA 1EAFA 1CIAA 1Q9JA 1Q23A 3U9FA 1SCZA 1XMCA 5KJTA 1EABA 4HVMA 2CLAA 2II5A 4G0BA 1PD5A 2II4A 5KJVA 4N72A 1QCAA 2I9DA 2VSQA 1DPDA 1CLAA 2JGPA 5T3EA 4G2MA 3U9BA 1XL8A 5KJUA 1NOCB 4G22A 4JN3A 1EAEA 2BGHA 5FANA 2E1UA 2IHWA 4CLAA 1XMDA 2ZBAA 2E1TA 2XHGA 1E2OA 2XR7A 4JN5A 5DUAA 1EADA 2RKVA 4KE4A 1EAAA 1DPBA 1EACA 5KJSA 1C4TA 3L60A 1XL7A 3B30A 3B2SA 3MAEA 3FOTA 1L5AA 5KJWA 3FP0A 5DU9A 2II3A
chains in the Genus database with same CATH superfamily
1DPCA 4KECA 5FALA 1EAFA 1Q23A 2II5A 1PD5A 1DPDA 2JGPA 5T3EA 1XL8A 5KJUA 1EAEA 2BGHA 2E1UA 2DEBA 4CLAA 5DUAA 2XHGA 4JN5A 4EP9A 1EADA 1EACA 1C4TA 5KJWA 3MAEA 2RKTA 1NDIA 1NM8A 3U9FA 1T7NA 5KJTA 1EABA 4HVMA 2CLAA 2H3WA 2II4A 5KJVA 1QCAA 2FY5A 4G2MA 3U9BA 1T7QA 1Q6XA 2FY2A 2IHWA 1T1UA 2XR7A 4EPHA 4KE4A 3B30A 1L5AA 2II3A 2E1VA 1CIAA 1Q9JA 2FW3A 4G0BA 4N72A 4EYWA 1S5OA 1T7OA 2H3UA 1NOCB 4G22A 4JN3A 2RCUA 1XMDA 2E1TA 2H3PA 2FY4A 2RKVA 1EAAA 5KJSA 2FY3A 3B2SA 1NDFA 5DU9A 3CLAA 2FYOA 1SCZA 1XMCA 2I9DA 2VSQA 1CLAA 2H4TA 5FANA 1NDBA 2ZBAA 1E2OA 1DPBA 3L60A 1XL7A 3FOTA 3FP0A
chains in the Genus database with same CATH topology
2E1VA 1DPCA 4KECA 2RKTA 5FALA 3CLAA 1EAFA 1CIAA 1Q9JA 1Q23A 3U9FA 1SCZA 1XMCA 5KJTA 1EABA 4HVMA 2CLAA 2II5A 4G0BA 1PD5A 2II4A 5KJVA 4N72A 1QCAA 2I9DA 2VSQA 1DPDA 1CLAA 2JGPA 5T3EA 4G2MA 3U9BA 1XL8A 5KJUA 1NOCB 4G22A 4JN3A 1EAEA 2BGHA 5FANA 2E1UA 2IHWA 4CLAA 1XMDA 2ZBAA 2E1TA 2XHGA 1E2OA 2XR7A 4JN5A 5DUAA 1EADA 2RKVA 4KE4A 1EAAA 1DPBA 1EACA 5KJSA 1C4TA 3L60A 1XL7A 3B30A 3B2SA 3MAEA 3FOTA 1L5AA 5KJWA 3FP0A 5DU9A 2II3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E1V A;  1DPC A;  4KEC A;  2RKT A;  5FAL A;  3CLA A;  1EAF A;  1CIA A;  1Q9J A;  1Q23 A;  3U9F A;  1SCZ A;  1XMC A;  5KJT A;  1EAB A;  4HVM A;  2CLA A;  2II5 A;  4G0B A;  1PD5 A;  2II4 A;  5KJV A;  4N72 A;  1QCA A;  2I9D A;  2VSQ A;  1DPD A;  1CLA A;  2JGP A;  5T3E A;  4G2M A;  3U9B A;  1XL8 A;  5KJU A;  1NOC B;  4G22 A;  4JN3 A;  1EAE A;  2BGH A;  5FAN A;  2E1U A;  2IHW A;  4CLA A;  1XMD A;  2ZBA A;  2E1T A;  2XHG A;  1E2O A;  2XR7 A;  4JN5 A;  5DUA A;  1EAD A;  2RKV A;  4KE4 A;  1EAA A;  1DPB A;  1EAC A;  5KJS A;  1C4T A;  3L60 A;  1XL7 A;  3B30 A;  3B2S A;  3MAE A;  3FOT A;  1L5A A;  5KJW A;  3FP0 A;  5DU9 A;  2II3 A; 
#chains in the Genus database with same CATH topology
 1DPC A;  4KEC A;  5FAL A;  1EAF A;  1Q23 A;  2II5 A;  1PD5 A;  1DPD A;  2JGP A;  5T3E A;  1XL8 A;  5KJU A;  1EAE A;  2BGH A;  2E1U A;  2DEB A;  4CLA A;  5DUA A;  2XHG A;  4JN5 A;  4EP9 A;  1EAD A;  1EAC A;  1C4T A;  5KJW A;  3MAE A;  2RKT A;  1NDI A;  1NM8 A;  3U9F A;  1T7N A;  5KJT A;  1EAB A;  4HVM A;  2CLA A;  2H3W A;  2II4 A;  5KJV A;  1QCA A;  2FY5 A;  4G2M A;  3U9B A;  1T7Q A;  1Q6X A;  2FY2 A;  2IHW A;  1T1U A;  2XR7 A;  4EPH A;  4KE4 A;  3B30 A;  1L5A A;  2II3 A;  2E1V A;  1CIA A;  1Q9J A;  2FW3 A;  4G0B A;  4N72 A;  4EYW A;  1S5O A;  1T7O A;  2H3U A;  1NOC B;  4G22 A;  4JN3 A;  2RCU A;  1XMD A;  2E1T A;  2H3P A;  2FY4 A;  2RKV A;  1EAA A;  5KJS A;  2FY3 A;  3B2S A;  1NDF A;  5DU9 A;  3CLA A;  2FYO A;  1SCZ A;  1XMC A;  2I9D A;  2VSQ A;  1CLA A;  2H4T A;  5FAN A;  1NDB A;  2ZBA A;  1E2O A;  1DPB A;  3L60 A;  1XL7 A;  3FOT A;  3FP0 A; 
#chains in the Genus database with same CATH homology
 2E1V A;  1DPC A;  4KEC A;  2RKT A;  5FAL A;  3CLA A;  1EAF A;  1CIA A;  1Q9J A;  1Q23 A;  3U9F A;  1SCZ A;  1XMC A;  5KJT A;  1EAB A;  4HVM A;  2CLA A;  2II5 A;  4G0B A;  1PD5 A;  2II4 A;  5KJV A;  4N72 A;  1QCA A;  2I9D A;  2VSQ A;  1DPD A;  1CLA A;  2JGP A;  5T3E A;  4G2M A;  3U9B A;  1XL8 A;  5KJU A;  1NOC B;  4G22 A;  4JN3 A;  1EAE A;  2BGH A;  5FAN A;  2E1U A;  2IHW A;  4CLA A;  1XMD A;  2ZBA A;  2E1T A;  2XHG A;  1E2O A;  2XR7 A;  4JN5 A;  5DUA A;  1EAD A;  2RKV A;  4KE4 A;  1EAA A;  1DPB A;  1EAC A;  5KJS A;  1C4T A;  3L60 A;  1XL7 A;  3B30 A;  3B2S A;  3MAE A;  3FOT A;  1L5A A;  5KJW A;  3FP0 A;  5DU9 A;  2II3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...