3U9FA

Structure of cati in complex with chloramphenicol
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
215
structure length
215
Chain Sequence
EKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFLKTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSSLWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANMDNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chloramphenicol acetyltransferase
publication title The structural basis for substrate versatility of chloramphenicol acetyltransferase CAT(I).
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/antibiotic
total genus 54
structure length 215
sequence length 215
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, R, S
ec nomenclature ec 2.3.1.28: Chloramphenicol O-acetyltransferase.
pdb deposition date 2011-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00302 CAT Chloramphenicol acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 3u9fA00
1DPCA 1XL7A 1PD5A 3U9FA 5KJVA 1DPDA 4G22A 1EABA 2ZBAA 1C4TA 3CLAA 2II5A 3FOTA 4N72A 4KECA 5KJWA 1XMCA 1EAEA 5T3EA 5FANA 2II3A 5FALA 1EADA 1QCAA 3L60A 1EAFA 2XHGA 5DUAA 1EACA 2E1UA 3U9BA 4JN3A 2BGHA 2IHWA 3MAEA 4CLAA 4G2MA 1L5AA 1CLAA 1XMDA 2JGPA 4KE4A 3FP0A 1XL8A 4JN5A 5KJTA 1DPBA 1EAAA 1Q23A 5KJUA 2CLAA 2E1VA 2E1TA 3B2SA 2RKVA 2VSQA 1NOCB 1E2OA 1CIAA 2XR7A 3B30A 4HVMA 1SCZA 2RKTA 2I9DA 5DU9A 2II4A 1Q9JA 4G0BA 5KJSA
chains in the Genus database with same CATH superfamily
4G22A 1EABA 1C4TA 4N72A 1XMCA 5T3EA 5FANA 5FALA 2H3UA 1QCAA 5DUAA 1EACA 1NDIA 2E1UA 2RCUA 4JN3A 2BGHA 2FYOA 4G2MA 1XMDA 2JGPA 1XL8A 1Q23A 5KJUA 2E1TA 3B2SA 2RKVA 2I9DA 5DU9A 1Q6XA 2H3PA 2ZBAA 2H3WA 3CLAA 3FOTA 2II5A 2II3A 1EADA 2FY4A 1T7QA 3MAEA 4CLAA 2DEBA 3FP0A 4JN5A 2E1VA 2VSQA 1NOCB 1E2OA 1CIAA 1SCZA 4EPHA 2II4A 4G0BA 2FY3A 5KJSA 1DPCA 2FW3A 5KJWA 4EP9A 1EAEA 3L60A 1T1UA 3U9BA 1NM8A 2H4TA 4KE4A 1T7OA 5KJTA 1DPBA 1EAAA 3B30A 1S5OA 2RKTA 1Q9JA 2FY2A 4EYWA 1XL7A 1PD5A 3U9FA 5KJVA 1DPDA 4KECA 1T7NA 1EAFA 2XHGA 1NDBA 1NDFA 2IHWA 1L5AA 1CLAA 2CLAA 2XR7A 4HVMA 2FY5A
chains in the Genus database with same CATH topology
1DPCA 1XL7A 1PD5A 3U9FA 5KJVA 1DPDA 4G22A 1EABA 2ZBAA 1C4TA 3CLAA 2II5A 3FOTA 4N72A 4KECA 5KJWA 1XMCA 1EAEA 5T3EA 5FANA 2II3A 5FALA 1EADA 1QCAA 3L60A 1EAFA 2XHGA 5DUAA 1EACA 2E1UA 3U9BA 4JN3A 2BGHA 2IHWA 3MAEA 4CLAA 4G2MA 1L5AA 1CLAA 1XMDA 2JGPA 4KE4A 3FP0A 1XL8A 4JN5A 5KJTA 1DPBA 1EAAA 1Q23A 5KJUA 2CLAA 2E1VA 2E1TA 3B2SA 2RKVA 2VSQA 1NOCB 1E2OA 1CIAA 2XR7A 3B30A 4HVMA 1SCZA 2RKTA 2I9DA 5DU9A 2II4A 1Q9JA 4G0BA 5KJSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DPC A;  1XL7 A;  1PD5 A;  3U9F A;  5KJV A;  1DPD A;  4G22 A;  1EAB A;  2ZBA A;  1C4T A;  3CLA A;  2II5 A;  3FOT A;  4N72 A;  4KEC A;  5KJW A;  1XMC A;  1EAE A;  5T3E A;  5FAN A;  2II3 A;  5FAL A;  1EAD A;  1QCA A;  3L60 A;  1EAF A;  2XHG A;  5DUA A;  1EAC A;  2E1U A;  3U9B A;  4JN3 A;  2BGH A;  2IHW A;  3MAE A;  4CLA A;  4G2M A;  1L5A A;  1CLA A;  1XMD A;  2JGP A;  4KE4 A;  3FP0 A;  1XL8 A;  4JN5 A;  5KJT A;  1DPB A;  1EAA A;  1Q23 A;  5KJU A;  2CLA A;  2E1V A;  2E1T A;  3B2S A;  2RKV A;  2VSQ A;  1NOC B;  1E2O A;  1CIA A;  2XR7 A;  3B30 A;  4HVM A;  1SCZ A;  2RKT A;  2I9D A;  5DU9 A;  2II4 A;  1Q9J A;  4G0B A;  5KJS A; 
#chains in the Genus database with same CATH topology
 4G22 A;  1EAB A;  1C4T A;  4N72 A;  1XMC A;  5T3E A;  5FAN A;  5FAL A;  2H3U A;  1QCA A;  5DUA A;  1EAC A;  1NDI A;  2E1U A;  2RCU A;  4JN3 A;  2BGH A;  2FYO A;  4G2M A;  1XMD A;  2JGP A;  1XL8 A;  1Q23 A;  5KJU A;  2E1T A;  3B2S A;  2RKV A;  2I9D A;  5DU9 A;  1Q6X A;  2H3P A;  2ZBA A;  2H3W A;  3CLA A;  3FOT A;  2II5 A;  2II3 A;  1EAD A;  2FY4 A;  1T7Q A;  3MAE A;  4CLA A;  2DEB A;  3FP0 A;  4JN5 A;  2E1V A;  2VSQ A;  1NOC B;  1E2O A;  1CIA A;  1SCZ A;  4EPH A;  2II4 A;  4G0B A;  2FY3 A;  5KJS A;  1DPC A;  2FW3 A;  5KJW A;  4EP9 A;  1EAE A;  3L60 A;  1T1U A;  3U9B A;  1NM8 A;  2H4T A;  4KE4 A;  1T7O A;  5KJT A;  1DPB A;  1EAA A;  3B30 A;  1S5O A;  2RKT A;  1Q9J A;  2FY2 A;  4EYW A;  1XL7 A;  1PD5 A;  3U9F A;  5KJV A;  1DPD A;  4KEC A;  1T7N A;  1EAF A;  2XHG A;  1NDB A;  1NDF A;  2IHW A;  1L5A A;  1CLA A;  2CLA A;  2XR7 A;  4HVM A;  2FY5 A; 
#chains in the Genus database with same CATH homology
 1DPC A;  1XL7 A;  1PD5 A;  3U9F A;  5KJV A;  1DPD A;  4G22 A;  1EAB A;  2ZBA A;  1C4T A;  3CLA A;  2II5 A;  3FOT A;  4N72 A;  4KEC A;  5KJW A;  1XMC A;  1EAE A;  5T3E A;  5FAN A;  2II3 A;  5FAL A;  1EAD A;  1QCA A;  3L60 A;  1EAF A;  2XHG A;  5DUA A;  1EAC A;  2E1U A;  3U9B A;  4JN3 A;  2BGH A;  2IHW A;  3MAE A;  4CLA A;  4G2M A;  1L5A A;  1CLA A;  1XMD A;  2JGP A;  4KE4 A;  3FP0 A;  1XL8 A;  4JN5 A;  5KJT A;  1DPB A;  1EAA A;  1Q23 A;  5KJU A;  2CLA A;  2E1V A;  2E1T A;  3B2S A;  2RKV A;  2VSQ A;  1NOC B;  1E2O A;  1CIA A;  2XR7 A;  3B30 A;  4HVM A;  1SCZ A;  2RKT A;  2I9D A;  5DU9 A;  2II4 A;  1Q9J A;  4G0B A;  5KJS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...