3U9FA

Structure of cati in complex with chloramphenicol
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
215
structure length
215
Chain Sequence
EKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFLKTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSSLWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANMDNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/antibiotic
molecule keywords Chloramphenicol acetyltransferase
publication title The structural basis for substrate versatility of chloramphenicol acetyltransferase CAT(I).
pubmed doi rcsb
source organism Escherichia coli
total genus 54
structure length 215
sequence length 215
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, R, S
ec nomenclature ec 2.3.1.28: Chloramphenicol O-acetyltransferase.
pdb deposition date 2011-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00302 CAT Chloramphenicol acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 3u9fA00
2BGHA 5KJUA 5DUAA 5KJTA 1XL7A 5FANA 1CLAA 2II3A 2VSQA 1EAFA 5KJWA 1Q9JA 2E1VA 1DPCA 2XHGA 3B30A 3CLAA 4JN3A 1EACA 4CLAA 2II5A 4HVMA 3MAEA 5FALA 1DPDA 3B2SA 2I9DA 1EABA 3L60A 4KECA 5T3EA 1EAEA 4G22A 1Q23A 2II4A 1C4TA 1XL8A 5DU9A 1XMDA 2XR7A 2ZBAA 1QCAA 4G0BA 2E1TA 1EADA 1L5AA 3U9FA 3U9BA 1XMCA 4KE4A 2IHWA 2RKTA 1SCZA 4G2MA 3FOTA 1DPBA 1CIAA 4JN5A 1EAAA 1E2OA 1NOCB 1PD5A 2CLAA 2E1UA 2JGPA 3FP0A 5KJVA 5KJSA 4N72A 2RKVA
chains in the Genus database with same CATH superfamily
2BGHA 2RCUA 5DUAA 1XL7A 1CLAA 5KJWA 3B30A 4HVMA 2DEBA 2FY5A 4KECA 1EAEA 2H4TA 2II4A 4EPHA 2ZBAA 2E1TA 1L5AA 3U9BA 2H3UA 2IHWA 4G2MA 1CIAA 1EAAA 1NOCB 1PD5A 2E1UA 4N72A 2RKVA 5FANA 2II3A 1EAFA 4JN3A 2XHGA 3CLAA 1T1UA 3MAEA 1DPDA 1EABA 4EYWA 5T3EA 5DU9A 1C4TA 1T7NA 4KE4A 2FW3A 3FOTA 2JGPA 1NM8A 5KJUA 1Q6XA 2FY3A 2VSQA 1Q9JA 2E1VA 4CLAA 2II5A 1NDFA 2H3WA 3B2SA 2I9DA 4G22A 1XL8A 2FY4A 4G0BA 1EADA 1T7QA 3U9FA 2FYOA 2RKTA 4JN5A 1E2OA 2CLAA 3FP0A 5KJVA 5KJSA 4EP9A 1NDIA 5KJTA 2FY2A 1NDBA 1DPCA 1EACA 5FALA 1S5OA 3L60A 1Q23A 1XMDA 2H3PA 2XR7A 1QCAA 1XMCA 1SCZA 1DPBA 1T7OA
chains in the Genus database with same CATH topology
2BGHA 5KJUA 5DUAA 5KJTA 1XL7A 5FANA 1CLAA 2II3A 2VSQA 1EAFA 5KJWA 1Q9JA 2E1VA 1DPCA 2XHGA 3B30A 3CLAA 4JN3A 1EACA 4CLAA 2II5A 4HVMA 3MAEA 5FALA 1DPDA 3B2SA 2I9DA 1EABA 3L60A 4KECA 5T3EA 1EAEA 4G22A 1Q23A 2II4A 1C4TA 1XL8A 5DU9A 1XMDA 2XR7A 2ZBAA 1QCAA 4G0BA 2E1TA 1EADA 1L5AA 3U9FA 3U9BA 1XMCA 4KE4A 2IHWA 2RKTA 1SCZA 4G2MA 3FOTA 1DPBA 1CIAA 4JN5A 1EAAA 1E2OA 1NOCB 1PD5A 2CLAA 2E1UA 2JGPA 3FP0A 5KJVA 5KJSA 4N72A 2RKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BGH A;  5KJU A;  5DUA A;  5KJT A;  1XL7 A;  5FAN A;  1CLA A;  2II3 A;  2VSQ A;  1EAF A;  5KJW A;  1Q9J A;  2E1V A;  1DPC A;  2XHG A;  3B30 A;  3CLA A;  4JN3 A;  1EAC A;  4CLA A;  2II5 A;  4HVM A;  3MAE A;  5FAL A;  1DPD A;  3B2S A;  2I9D A;  1EAB A;  3L60 A;  4KEC A;  5T3E A;  1EAE A;  4G22 A;  1Q23 A;  2II4 A;  1C4T A;  1XL8 A;  5DU9 A;  1XMD A;  2XR7 A;  2ZBA A;  1QCA A;  4G0B A;  2E1T A;  1EAD A;  1L5A A;  3U9F A;  3U9B A;  1XMC A;  4KE4 A;  2IHW A;  2RKT A;  1SCZ A;  4G2M A;  3FOT A;  1DPB A;  1CIA A;  4JN5 A;  1EAA A;  1E2O A;  1NOC B;  1PD5 A;  2CLA A;  2E1U A;  2JGP A;  3FP0 A;  5KJV A;  5KJS A;  4N72 A;  2RKV A; 
#chains in the Genus database with same CATH topology
 2BGH A;  2RCU A;  5DUA A;  1XL7 A;  1CLA A;  5KJW A;  3B30 A;  4HVM A;  2DEB A;  2FY5 A;  4KEC A;  1EAE A;  2H4T A;  2II4 A;  4EPH A;  2ZBA A;  2E1T A;  1L5A A;  3U9B A;  2H3U A;  2IHW A;  4G2M A;  1CIA A;  1EAA A;  1NOC B;  1PD5 A;  2E1U A;  4N72 A;  2RKV A;  5FAN A;  2II3 A;  1EAF A;  4JN3 A;  2XHG A;  3CLA A;  1T1U A;  3MAE A;  1DPD A;  1EAB A;  4EYW A;  5T3E A;  5DU9 A;  1C4T A;  1T7N A;  4KE4 A;  2FW3 A;  3FOT A;  2JGP A;  1NM8 A;  5KJU A;  1Q6X A;  2FY3 A;  2VSQ A;  1Q9J A;  2E1V A;  4CLA A;  2II5 A;  1NDF A;  2H3W A;  3B2S A;  2I9D A;  4G22 A;  1XL8 A;  2FY4 A;  4G0B A;  1EAD A;  1T7Q A;  3U9F A;  2FYO A;  2RKT A;  4JN5 A;  1E2O A;  2CLA A;  3FP0 A;  5KJV A;  5KJS A;  4EP9 A;  1NDI A;  5KJT A;  2FY2 A;  1NDB A;  1DPC A;  1EAC A;  5FAL A;  1S5O A;  3L60 A;  1Q23 A;  1XMD A;  2H3P A;  2XR7 A;  1QCA A;  1XMC A;  1SCZ A;  1DPB A;  1T7O A; 
#chains in the Genus database with same CATH homology
 2BGH A;  5KJU A;  5DUA A;  5KJT A;  1XL7 A;  5FAN A;  1CLA A;  2II3 A;  2VSQ A;  1EAF A;  5KJW A;  1Q9J A;  2E1V A;  1DPC A;  2XHG A;  3B30 A;  3CLA A;  4JN3 A;  1EAC A;  4CLA A;  2II5 A;  4HVM A;  3MAE A;  5FAL A;  1DPD A;  3B2S A;  2I9D A;  1EAB A;  3L60 A;  4KEC A;  5T3E A;  1EAE A;  4G22 A;  1Q23 A;  2II4 A;  1C4T A;  1XL8 A;  5DU9 A;  1XMD A;  2XR7 A;  2ZBA A;  1QCA A;  4G0B A;  2E1T A;  1EAD A;  1L5A A;  3U9F A;  3U9B A;  1XMC A;  4KE4 A;  2IHW A;  2RKT A;  1SCZ A;  4G2M A;  3FOT A;  1DPB A;  1CIA A;  4JN5 A;  1EAA A;  1E2O A;  1NOC B;  1PD5 A;  2CLA A;  2E1U A;  2JGP A;  3FP0 A;  5KJV A;  5KJS A;  4N72 A;  2RKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...