1DPBA

Crystallographic and enzymatic investigations on the role of ser558, his610 and asn614 in the catalytic mechanism of azotobacter vinelandii dihydrolipoamide acetyltransferase (e2p)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
243
structure length
243
Chain Sequence
b'IPPIPPVDFAKYGEIEEVPMTRLMQIGATNLHRSWLNVPHVTQFESADITELEAFRVAQKAVAEKAGVKLTVLPLLLKACAYLLKELPDFNSSLAPSGQALIRKKYVHIGFAVDTPDGLLVPVIRNVDQKSLLQLAAEAAELAEKARSKKLGADAMQGACFTISSLGHIGGTAFTPIVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDCRVINGAAAARFTKRLGDLLADIRAILL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DIHYDROLIPOYL-TRANSACETYLASE
publication title Crystallographic and enzymatic investigations on the role of Ser558, His610, and Asn614 in the catalytic mechanism of Azotobacter vinelandii dihydrolipoamide acetyltransferase (E2p).
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Dihydrolipoamide acetyltransferase
total genus 67
structure length 243
sequence length 243
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1995-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1dpbA00
1EAFA 1XMDA 3FOTA 2RKTA 2ZBAA 3B2SA 3B30A 2IHWA 4G2MA 1EAAA 5FANA 1E2OA 2CLAA 3L60A 5KJVA 5KJWA 3MAEA 4HVMA 1Q23A 1SCZA 4CLAA 2RKVA 1NOCB 3U9FA 1QCAA 4G22A 1EADA 5DUAA 1DPDA 2II4A 1XL7A 1EAEA 5DU9A 1C4TA 3FP0A 1EACA 2XR7A 1DPBA 5KJTA 5FALA 1CLAA 1DPCA 2II5A 1Q9JA 1XMCA 5KJSA 3CLAA 4JN3A 4JN5A 2VSQA 3U9BA 1XL8A 2E1VA 4N72A 1PD5A 1EABA 2XHGA 5T3EA 2BGHA 1L5AA 2E1UA 2E1TA 5KJUA 4KECA 2I9DA 2II3A 2JGPA 4G0BA 4KE4A 1CIAA
chains in the Genus database with same CATH superfamily
5KJVA 1Q23A 1SCZA 1T7QA 1Q6XA 2H3UA 1EAEA 1EACA 1T1UA 5KJSA 4JN5A 4EP9A 1NDFA 4N72A 1T7OA 2H3WA 2FY5A 2FW3A 2E1TA 2FY4A 2I9DA 1XMDA 2RKTA 3B2SA 1EADA 5DUAA 2FY3A 1DPDA 2DEBA 3FP0A 1NDIA 1XMCA 3CLAA 3U9BA 1XL8A 1PD5A 2XHGA 5KJUA 4EYWA 2JGPA 4G0BA 4KE4A 1EAFA 2H4TA 2IHWA 4G2MA 1EAAA 5FANA 1E2OA 2CLAA 3L60A 5KJWA 3MAEA 1T7NA 4HVMA 2RKVA 1NOCB 1QCAA 2FY2A 2II4A 1XL7A 1DPBA 1DPCA 2II5A 1NDBA 2E1VA 1EABA 2BGHA 1L5AA 5KJTA 1CIAA 3FOTA 2ZBAA 3B30A 2FYOA 4CLAA 2H3PA 3U9FA 4EPHA 4G22A 2RCUA 1S5OA 5DU9A 1C4TA 2XR7A 5FALA 1CLAA 1Q9JA 4JN3A 2VSQA 5T3EA 2E1UA 4KECA 2II3A 1NM8A
chains in the Genus database with same CATH topology
1EAFA 1XMDA 3FOTA 2RKTA 2ZBAA 3B2SA 3B30A 2IHWA 4G2MA 1EAAA 5FANA 1E2OA 2CLAA 3L60A 5KJVA 5KJWA 3MAEA 4HVMA 1Q23A 1SCZA 4CLAA 2RKVA 1NOCB 3U9FA 1QCAA 4G22A 1EADA 5DUAA 1DPDA 2II4A 1XL7A 1EAEA 5DU9A 1C4TA 3FP0A 1EACA 2XR7A 1DPBA 5KJTA 5FALA 1CLAA 1DPCA 2II5A 1Q9JA 1XMCA 5KJSA 3CLAA 4JN3A 4JN5A 2VSQA 3U9BA 1XL8A 2E1VA 4N72A 1PD5A 1EABA 2XHGA 5T3EA 2BGHA 1L5AA 2E1UA 2E1TA 5KJUA 4KECA 2I9DA 2II3A 2JGPA 4G0BA 4KE4A 1CIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EAF A;  1XMD A;  3FOT A;  2RKT A;  2ZBA A;  3B2S A;  3B30 A;  2IHW A;  4G2M A;  1EAA A;  5FAN A;  1E2O A;  2CLA A;  3L60 A;  5KJV A;  5KJW A;  3MAE A;  4HVM A;  1Q23 A;  1SCZ A;  4CLA A;  2RKV A;  1NOC B;  3U9F A;  1QCA A;  4G22 A;  1EAD A;  5DUA A;  1DPD A;  2II4 A;  1XL7 A;  1EAE A;  5DU9 A;  1C4T A;  3FP0 A;  1EAC A;  2XR7 A;  1DPB A;  5KJT A;  5FAL A;  1CLA A;  1DPC A;  2II5 A;  1Q9J A;  1XMC A;  5KJS A;  3CLA A;  4JN3 A;  4JN5 A;  2VSQ A;  3U9B A;  1XL8 A;  2E1V A;  4N72 A;  1PD5 A;  1EAB A;  2XHG A;  5T3E A;  2BGH A;  1L5A A;  2E1U A;  2E1T A;  5KJU A;  4KEC A;  2I9D A;  2II3 A;  2JGP A;  4G0B A;  4KE4 A;  1CIA A; 
#chains in the Genus database with same CATH topology
 5KJV A;  1Q23 A;  1SCZ A;  1T7Q A;  1Q6X A;  2H3U A;  1EAE A;  1EAC A;  1T1U A;  5KJS A;  4JN5 A;  4EP9 A;  1NDF A;  4N72 A;  1T7O A;  2H3W A;  2FY5 A;  2FW3 A;  2E1T A;  2FY4 A;  2I9D A;  1XMD A;  2RKT A;  3B2S A;  1EAD A;  5DUA A;  2FY3 A;  1DPD A;  2DEB A;  3FP0 A;  1NDI A;  1XMC A;  3CLA A;  3U9B A;  1XL8 A;  1PD5 A;  2XHG A;  5KJU A;  4EYW A;  2JGP A;  4G0B A;  4KE4 A;  1EAF A;  2H4T A;  2IHW A;  4G2M A;  1EAA A;  5FAN A;  1E2O A;  2CLA A;  3L60 A;  5KJW A;  3MAE A;  1T7N A;  4HVM A;  2RKV A;  1NOC B;  1QCA A;  2FY2 A;  2II4 A;  1XL7 A;  1DPB A;  1DPC A;  2II5 A;  1NDB A;  2E1V A;  1EAB A;  2BGH A;  1L5A A;  5KJT A;  1CIA A;  3FOT A;  2ZBA A;  3B30 A;  2FYO A;  4CLA A;  2H3P A;  3U9F A;  4EPH A;  4G22 A;  2RCU A;  1S5O A;  5DU9 A;  1C4T A;  2XR7 A;  5FAL A;  1CLA A;  1Q9J A;  4JN3 A;  2VSQ A;  5T3E A;  2E1U A;  4KEC A;  2II3 A;  1NM8 A; 
#chains in the Genus database with same CATH homology
 1EAF A;  1XMD A;  3FOT A;  2RKT A;  2ZBA A;  3B2S A;  3B30 A;  2IHW A;  4G2M A;  1EAA A;  5FAN A;  1E2O A;  2CLA A;  3L60 A;  5KJV A;  5KJW A;  3MAE A;  4HVM A;  1Q23 A;  1SCZ A;  4CLA A;  2RKV A;  1NOC B;  3U9F A;  1QCA A;  4G22 A;  1EAD A;  5DUA A;  1DPD A;  2II4 A;  1XL7 A;  1EAE A;  5DU9 A;  1C4T A;  3FP0 A;  1EAC A;  2XR7 A;  1DPB A;  5KJT A;  5FAL A;  1CLA A;  1DPC A;  2II5 A;  1Q9J A;  1XMC A;  5KJS A;  3CLA A;  4JN3 A;  4JN5 A;  2VSQ A;  3U9B A;  1XL8 A;  2E1V A;  4N72 A;  1PD5 A;  1EAB A;  2XHG A;  5T3E A;  2BGH A;  1L5A A;  2E1U A;  2E1T A;  5KJU A;  4KEC A;  2I9D A;  2II3 A;  2JGP A;  4G0B A;  4KE4 A;  1CIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...