1DPBA

Crystallographic and enzymatic investigations on the role of ser558, his610 and asn614 in the catalytic mechanism of azotobacter vinelandii dihydrolipoamide acetyltransferase (e2p)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
243
structure length
243
Chain Sequence
IPPIPPVDFAKYGEIEEVPMTRLMQIGATNLHRSWLNVPHVTQFESADITELEAFRVAQKAVAEKAGVKLTVLPLLLKACAYLLKELPDFNSSLAPSGQALIRKKYVHIGFAVDTPDGLLVPVIRNVDQKSLLQLAAEAAELAEKARSKKLGADAMQGACFTISSLGHIGGTAFTPIVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDCRVINGAAAARFTKRLGDLLADIRAILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dihydrolipoamide acetyltransferase
molecule keywords DIHYDROLIPOYL-TRANSACETYLASE
publication title Crystallographic and enzymatic investigations on the role of Ser558, His610, and Asn614 in the catalytic mechanism of Azotobacter vinelandii dihydrolipoamide acetyltransferase (E2p).
pubmed doi rcsb
source organism Azotobacter vinelandii
total genus 67
structure length 243
sequence length 243
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1995-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1dpbA00
2II3A 1SCZA 5KJUA 1Q9JA 5DUAA 5FANA 1EADA 2JGPA 2XHGA 4JN5A 2VSQA 1QCAA 4CLAA 1XMDA 4JN3A 4KECA 5KJWA 5KJVA 1E2OA 2II4A 3MAEA 2RKVA 5KJTA 2E1UA 2II5A 1DPBA 1EAFA 1DPDA 2IHWA 3U9BA 3B30A 2CLAA 1C4TA 2E1VA 2BGHA 4G22A 4HVMA 1EABA 1XL8A 1NOCB 1Q23A 1CLAA 3FP0A 4N72A 3U9FA 2ZBAA 2RKTA 2XR7A 1XL7A 1EAAA 2E1TA 3CLAA 4G2MA 5FALA 3FOTA 5KJSA 1EAEA 2I9DA 4KE4A 1DPCA 1XMCA 1PD5A 4G0BA 3B2SA 1CIAA 5DU9A 1L5AA 3L60A 5T3EA 1EACA
chains in the Genus database with same CATH superfamily
1NDIA 1T1UA 2H3UA 2XHGA 1NDFA 5KJWA 1E2OA 3B30A 2CLAA 2E1VA 2FY2A 1EAEA 4G0BA 2H3PA 5T3EA 2II3A 1SCZA 1Q9JA 5DUAA 5FANA 1EADA 4JN5A 1T7QA 4JN3A 2FW3A 2DEBA 5KJVA 2RKVA 2E1UA 2II5A 1DPBA 2IHWA 3U9BA 1NDBA 2BGHA 2FY4A 4N72A 2H4TA 2I9DA 1DPCA 1PD5A 3B2SA 1CIAA 2FY5A 1Q6XA 5DU9A 2VSQA 1QCAA 1XMDA 4KECA 4EPHA 1T7NA 5KJTA 2II4A 4EP9A 1DPDA 2FY3A 1C4TA 4G22A 4HVMA 1EABA 1XL8A 3U9FA 4EYWA 2ZBAA 2RCUA 1XL7A 2E1TA 4G2MA 5FALA 3FOTA 4KE4A 1L5AA 1EACA 5KJUA 2FYOA 2JGPA 1S5OA 4CLAA 2H3WA 3MAEA 1EAFA 1NOCB 1NM8A 1CLAA 1Q23A 3FP0A 2RKTA 2XR7A 1EAAA 3CLAA 1T7OA 5KJSA 1XMCA 3L60A
chains in the Genus database with same CATH topology
2II3A 1SCZA 5KJUA 1Q9JA 5DUAA 5FANA 1EADA 2JGPA 2XHGA 4JN5A 2VSQA 1QCAA 4CLAA 1XMDA 4JN3A 4KECA 5KJWA 5KJVA 1E2OA 2II4A 3MAEA 2RKVA 5KJTA 2E1UA 2II5A 1DPBA 1EAFA 1DPDA 2IHWA 3U9BA 3B30A 2CLAA 1C4TA 2E1VA 2BGHA 4G22A 4HVMA 1EABA 1XL8A 1NOCB 1Q23A 1CLAA 3FP0A 4N72A 3U9FA 2ZBAA 2RKTA 2XR7A 1XL7A 1EAAA 2E1TA 3CLAA 4G2MA 5FALA 3FOTA 5KJSA 1EAEA 2I9DA 4KE4A 1DPCA 1XMCA 1PD5A 4G0BA 3B2SA 1CIAA 5DU9A 1L5AA 3L60A 5T3EA 1EACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2II3 A;  1SCZ A;  5KJU A;  1Q9J A;  5DUA A;  5FAN A;  1EAD A;  2JGP A;  2XHG A;  4JN5 A;  2VSQ A;  1QCA A;  4CLA A;  1XMD A;  4JN3 A;  4KEC A;  5KJW A;  5KJV A;  1E2O A;  2II4 A;  3MAE A;  2RKV A;  5KJT A;  2E1U A;  2II5 A;  1DPB A;  1EAF A;  1DPD A;  2IHW A;  3U9B A;  3B30 A;  2CLA A;  1C4T A;  2E1V A;  2BGH A;  4G22 A;  4HVM A;  1EAB A;  1XL8 A;  1NOC B;  1Q23 A;  1CLA A;  3FP0 A;  4N72 A;  3U9F A;  2ZBA A;  2RKT A;  2XR7 A;  1XL7 A;  1EAA A;  2E1T A;  3CLA A;  4G2M A;  5FAL A;  3FOT A;  5KJS A;  1EAE A;  2I9D A;  4KE4 A;  1DPC A;  1XMC A;  1PD5 A;  4G0B A;  3B2S A;  1CIA A;  5DU9 A;  1L5A A;  3L60 A;  5T3E A;  1EAC A; 
#chains in the Genus database with same CATH topology
 1NDI A;  1T1U A;  2H3U A;  2XHG A;  1NDF A;  5KJW A;  1E2O A;  3B30 A;  2CLA A;  2E1V A;  2FY2 A;  1EAE A;  4G0B A;  2H3P A;  5T3E A;  2II3 A;  1SCZ A;  1Q9J A;  5DUA A;  5FAN A;  1EAD A;  4JN5 A;  1T7Q A;  4JN3 A;  2FW3 A;  2DEB A;  5KJV A;  2RKV A;  2E1U A;  2II5 A;  1DPB A;  2IHW A;  3U9B A;  1NDB A;  2BGH A;  2FY4 A;  4N72 A;  2H4T A;  2I9D A;  1DPC A;  1PD5 A;  3B2S A;  1CIA A;  2FY5 A;  1Q6X A;  5DU9 A;  2VSQ A;  1QCA A;  1XMD A;  4KEC A;  4EPH A;  1T7N A;  5KJT A;  2II4 A;  4EP9 A;  1DPD A;  2FY3 A;  1C4T A;  4G22 A;  4HVM A;  1EAB A;  1XL8 A;  3U9F A;  4EYW A;  2ZBA A;  2RCU A;  1XL7 A;  2E1T A;  4G2M A;  5FAL A;  3FOT A;  4KE4 A;  1L5A A;  1EAC A;  5KJU A;  2FYO A;  2JGP A;  1S5O A;  4CLA A;  2H3W A;  3MAE A;  1EAF A;  1NOC B;  1NM8 A;  1CLA A;  1Q23 A;  3FP0 A;  2RKT A;  2XR7 A;  1EAA A;  3CLA A;  1T7O A;  5KJS A;  1XMC A;  3L60 A; 
#chains in the Genus database with same CATH homology
 2II3 A;  1SCZ A;  5KJU A;  1Q9J A;  5DUA A;  5FAN A;  1EAD A;  2JGP A;  2XHG A;  4JN5 A;  2VSQ A;  1QCA A;  4CLA A;  1XMD A;  4JN3 A;  4KEC A;  5KJW A;  5KJV A;  1E2O A;  2II4 A;  3MAE A;  2RKV A;  5KJT A;  2E1U A;  2II5 A;  1DPB A;  1EAF A;  1DPD A;  2IHW A;  3U9B A;  3B30 A;  2CLA A;  1C4T A;  2E1V A;  2BGH A;  4G22 A;  4HVM A;  1EAB A;  1XL8 A;  1NOC B;  1Q23 A;  1CLA A;  3FP0 A;  4N72 A;  3U9F A;  2ZBA A;  2RKT A;  2XR7 A;  1XL7 A;  1EAA A;  2E1T A;  3CLA A;  4G2M A;  5FAL A;  3FOT A;  5KJS A;  1EAE A;  2I9D A;  4KE4 A;  1DPC A;  1XMC A;  1PD5 A;  4G0B A;  3B2S A;  1CIA A;  5DU9 A;  1L5A A;  3L60 A;  5T3E A;  1EAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...