1DPBA

Crystallographic and enzymatic investigations on the role of ser558, his610 and asn614 in the catalytic mechanism of azotobacter vinelandii dihydrolipoamide acetyltransferase (e2p)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
243
structure length
243
Chain Sequence
IPPIPPVDFAKYGEIEEVPMTRLMQIGATNLHRSWLNVPHVTQFESADITELEAFRVAQKAVAEKAGVKLTVLPLLLKACAYLLKELPDFNSSLAPSGQALIRKKYVHIGFAVDTPDGLLVPVIRNVDQKSLLQLAAEAAELAEKARSKKLGADAMQGACFTISSLGHIGGTAFTPIVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDCRVINGAAAARFTKRLGDLLADIRAILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DIHYDROLIPOYL-TRANSACETYLASE
publication title Crystallographic and enzymatic investigations on the role of Ser558, His610, and Asn614 in the catalytic mechanism of Azotobacter vinelandii dihydrolipoamide acetyltransferase (E2p).
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Dihydrolipoamide acetyltransferase
total genus 67
structure length 243
sequence length 243
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1995-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1dpbA00
1C4TA 3B2SA 1Q23A 4N72A 1EADA 2RKVA 2II4A 1SCZA 1CLAA 1EAFA 4KECA 2JGPA 1EAEA 5DUAA 2II3A 3FP0A 1EACA 4JN3A 1PD5A 1DPDA 5KJVA 4G0BA 1QCAA 2VSQA 5FALA 4JN5A 2I9DA 3FOTA 1XMCA 2II5A 5KJUA 4CLAA 1EABA 1XMDA 1XL7A 5T3EA 2BGHA 1L5AA 4HVMA 1XL8A 2E1UA 1NOCB 2E1TA 3U9BA 5DU9A 3U9FA 5KJSA 1Q9JA 2IHWA 2RKTA 2XHGA 3CLAA 2E1VA 3B30A 1E2OA 5KJWA 4G2MA 2ZBAA 2XR7A 1DPCA 4KE4A 4G22A 3L60A 5FANA 1CIAA 2CLAA 3MAEA 5KJTA 1EAAA 1DPBA
chains in the Genus database with same CATH superfamily
2FYOA 1T7QA 3B2SA 2II4A 2RCUA 1DPDA 1NDIA 5FALA 1XMCA 1EABA 1XL8A 3U9FA 2E1TA 2DEBA 1NM8A 2XR7A 3L60A 2FY5A 5KJTA 2H3PA 1C4TA 1Q23A 4N72A 1EADA 2H3UA 1SCZA 1EAFA 4KECA 2II3A 3FP0A 4EP9A 5KJVA 2VSQA 1XMDA 5T3EA 1L5AA 3U9BA 2IHWA 2XHGA 1E2OA 4G2MA 1DPCA 5FANA 2CLAA 1S5OA 1CLAA 2JGPA 1EAEA 5DUAA 1T1UA 4JN3A 1EACA 1PD5A 2FY4A 3FOTA 2II5A 5KJUA 2FY2A 4CLAA 1Q6XA 2BGHA 4HVMA 1NDBA 5DU9A 1T7NA 2H4TA 1Q9JA 2RKTA 2H3WA 2E1VA 3B30A 5KJWA 4EYWA 2ZBAA 1NDFA 1DPBA 2RKVA 1T7OA 4G0BA 1QCAA 4JN5A 2I9DA 1XL7A 2E1UA 1NOCB 5KJSA 2FY3A 3CLAA 4KE4A 4G22A 2FW3A 1CIAA 3MAEA 1EAAA 4EPHA
chains in the Genus database with same CATH topology
1C4TA 3B2SA 1Q23A 4N72A 1EADA 2RKVA 2II4A 1SCZA 1CLAA 1EAFA 4KECA 2JGPA 1EAEA 5DUAA 2II3A 3FP0A 1EACA 4JN3A 1PD5A 1DPDA 5KJVA 4G0BA 1QCAA 2VSQA 5FALA 4JN5A 2I9DA 3FOTA 1XMCA 2II5A 5KJUA 4CLAA 1EABA 1XMDA 1XL7A 5T3EA 2BGHA 1L5AA 4HVMA 1XL8A 2E1UA 1NOCB 2E1TA 3U9BA 5DU9A 3U9FA 5KJSA 1Q9JA 2IHWA 2RKTA 2XHGA 3CLAA 2E1VA 3B30A 1E2OA 5KJWA 4G2MA 2ZBAA 2XR7A 1DPCA 4KE4A 4G22A 3L60A 5FANA 1CIAA 2CLAA 3MAEA 5KJTA 1EAAA 1DPBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C4T A;  3B2S A;  1Q23 A;  4N72 A;  1EAD A;  2RKV A;  2II4 A;  1SCZ A;  1CLA A;  1EAF A;  4KEC A;  2JGP A;  1EAE A;  5DUA A;  2II3 A;  3FP0 A;  1EAC A;  4JN3 A;  1PD5 A;  1DPD A;  5KJV A;  4G0B A;  1QCA A;  2VSQ A;  5FAL A;  4JN5 A;  2I9D A;  3FOT A;  1XMC A;  2II5 A;  5KJU A;  4CLA A;  1EAB A;  1XMD A;  1XL7 A;  5T3E A;  2BGH A;  1L5A A;  4HVM A;  1XL8 A;  2E1U A;  1NOC B;  2E1T A;  3U9B A;  5DU9 A;  3U9F A;  5KJS A;  1Q9J A;  2IHW A;  2RKT A;  2XHG A;  3CLA A;  2E1V A;  3B30 A;  1E2O A;  5KJW A;  4G2M A;  2ZBA A;  2XR7 A;  1DPC A;  4KE4 A;  4G22 A;  3L60 A;  5FAN A;  1CIA A;  2CLA A;  3MAE A;  5KJT A;  1EAA A;  1DPB A; 
#chains in the Genus database with same CATH topology
 2FYO A;  1T7Q A;  3B2S A;  2II4 A;  2RCU A;  1DPD A;  1NDI A;  5FAL A;  1XMC A;  1EAB A;  1XL8 A;  3U9F A;  2E1T A;  2DEB A;  1NM8 A;  2XR7 A;  3L60 A;  2FY5 A;  5KJT A;  2H3P A;  1C4T A;  1Q23 A;  4N72 A;  1EAD A;  2H3U A;  1SCZ A;  1EAF A;  4KEC A;  2II3 A;  3FP0 A;  4EP9 A;  5KJV A;  2VSQ A;  1XMD A;  5T3E A;  1L5A A;  3U9B A;  2IHW A;  2XHG A;  1E2O A;  4G2M A;  1DPC A;  5FAN A;  2CLA A;  1S5O A;  1CLA A;  2JGP A;  1EAE A;  5DUA A;  1T1U A;  4JN3 A;  1EAC A;  1PD5 A;  2FY4 A;  3FOT A;  2II5 A;  5KJU A;  2FY2 A;  4CLA A;  1Q6X A;  2BGH A;  4HVM A;  1NDB A;  5DU9 A;  1T7N A;  2H4T A;  1Q9J A;  2RKT A;  2H3W A;  2E1V A;  3B30 A;  5KJW A;  4EYW A;  2ZBA A;  1NDF A;  1DPB A;  2RKV A;  1T7O A;  4G0B A;  1QCA A;  4JN5 A;  2I9D A;  1XL7 A;  2E1U A;  1NOC B;  5KJS A;  2FY3 A;  3CLA A;  4KE4 A;  4G22 A;  2FW3 A;  1CIA A;  3MAE A;  1EAA A;  4EPH A; 
#chains in the Genus database with same CATH homology
 1C4T A;  3B2S A;  1Q23 A;  4N72 A;  1EAD A;  2RKV A;  2II4 A;  1SCZ A;  1CLA A;  1EAF A;  4KEC A;  2JGP A;  1EAE A;  5DUA A;  2II3 A;  3FP0 A;  1EAC A;  4JN3 A;  1PD5 A;  1DPD A;  5KJV A;  4G0B A;  1QCA A;  2VSQ A;  5FAL A;  4JN5 A;  2I9D A;  3FOT A;  1XMC A;  2II5 A;  5KJU A;  4CLA A;  1EAB A;  1XMD A;  1XL7 A;  5T3E A;  2BGH A;  1L5A A;  4HVM A;  1XL8 A;  2E1U A;  1NOC B;  2E1T A;  3U9B A;  5DU9 A;  3U9F A;  5KJS A;  1Q9J A;  2IHW A;  2RKT A;  2XHG A;  3CLA A;  2E1V A;  3B30 A;  1E2O A;  5KJW A;  4G2M A;  2ZBA A;  2XR7 A;  1DPC A;  4KE4 A;  4G22 A;  3L60 A;  5FAN A;  1CIA A;  2CLA A;  3MAE A;  5KJT A;  1EAA A;  1DPB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...