1EABA

Atomic structure of the cubic core of the pyruvate dehydrogenase multienzyme complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
243
structure length
243
Chain Sequence
IPPIPPVDFAKYGEIEEVPMTRLMQIGATNLHRSWLNVPHVTQFESADITELEAFRVAQKAVAKKAGVKLTVLPLLLKACAYLLKELPDFNSSLAPSGQALIRKKYVHIGFAVDTPDGLLVPVIRNVDQKSLLQLAAEAAELAEKARSKKLGADAMQGACFTISSLGHIGGTAFTPIVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLGDLLADIRAILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dihydrolipoamide acetyltransferase
molecule keywords DIHYDROLIPOYL-TRANSACETYLASE
publication title Crystallographic analysis of substrate binding and catalysis in dihydrolipoyl transacetylase (E2p).
pubmed doi rcsb
source organism Azotobacter vinelandii
total genus 68
structure length 243
sequence length 243
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1992-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1eabA00
1QCAA 5FALA 1EAAA 5KJSA 2XHGA 4HVMA 4CLAA 1SCZA 1EADA 1DPCA 1E2OA 2E1TA 1Q9JA 1EACA 2II3A 2I9DA 2VSQA 2ZBAA 3CLAA 1PD5A 5DUAA 5KJTA 2XR7A 1CLAA 1EAFA 1XL8A 1NOCB 2E1UA 3FP0A 4KECA 3U9FA 1EAEA 2JGPA 4N72A 3FOTA 5FANA 4JN5A 4JN3A 1Q23A 1XL7A 1XMCA 2CLAA 2RKTA 3B2SA 4G22A 2RKVA 5KJUA 1XMDA 3L60A 5T3EA 4G0BA 2E1VA 2IHWA 2II4A 2II5A 3B30A 1C4TA 5KJWA 5KJVA 4G2MA 1L5AA 3MAEA 1DPBA 5DU9A 1DPDA 1EABA 3U9BA 1CIAA 4KE4A 2BGHA
chains in the Genus database with same CATH superfamily
1NDFA 4EP9A 1EAAA 1E2OA 2II3A 2VSQA 4EPHA 2FY3A 5DUAA 1T7NA 3U9FA 1EAEA 4JN3A 1XMCA 3L60A 5T3EA 4G2MA 1L5AA 5DU9A 5FALA 1QCAA 2XHGA 2ZBAA 2FY5A 1Q9JA 3CLAA 2DEBA 1NDBA 1PD5A 5KJTA 1CLAA 2E1UA 1XL8A 3FP0A 4KECA 1XL7A 2H4TA 1S5OA 2H3UA 3B2SA 4G22A 1T7QA 5KJWA 1C4TA 2H3PA 3MAEA 2II4A 2BGHA 1T1UA 2FYOA 4HVMA 4CLAA 1SCZA 2E1TA 1EACA 2FY4A 1T7OA 1EAFA 1NOCB 2JGPA 3FOTA 4JN5A 1Q23A 2CLAA 2RKTA 1Q6XA 1XMDA 2E1VA 1NDIA 2II5A 2FY2A 1DPDA 1EABA 5KJSA 4KE4A 1EADA 1DPCA 2I9DA 2XR7A 4N72A 5FANA 2FW3A 2RCUA 5KJUA 2RKVA 4G0BA 2IHWA 2H3WA 5KJVA 3B30A 4EYWA 1DPBA 3U9BA 1CIAA 1NM8A
chains in the Genus database with same CATH topology
1QCAA 5FALA 1EAAA 5KJSA 2XHGA 4HVMA 4CLAA 1SCZA 1EADA 1DPCA 1E2OA 2E1TA 1Q9JA 1EACA 2II3A 2I9DA 2VSQA 2ZBAA 3CLAA 1PD5A 5DUAA 5KJTA 2XR7A 1CLAA 1EAFA 1XL8A 1NOCB 2E1UA 3FP0A 4KECA 3U9FA 1EAEA 2JGPA 4N72A 3FOTA 5FANA 4JN5A 4JN3A 1Q23A 1XL7A 1XMCA 2CLAA 2RKTA 3B2SA 4G22A 2RKVA 5KJUA 1XMDA 3L60A 5T3EA 4G0BA 2E1VA 2IHWA 2II4A 2II5A 3B30A 1C4TA 5KJWA 5KJVA 4G2MA 1L5AA 3MAEA 1DPBA 5DU9A 1DPDA 1EABA 3U9BA 1CIAA 4KE4A 2BGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QCA A;  5FAL A;  1EAA A;  5KJS A;  2XHG A;  4HVM A;  4CLA A;  1SCZ A;  1EAD A;  1DPC A;  1E2O A;  2E1T A;  1Q9J A;  1EAC A;  2II3 A;  2I9D A;  2VSQ A;  2ZBA A;  3CLA A;  1PD5 A;  5DUA A;  5KJT A;  2XR7 A;  1CLA A;  1EAF A;  1XL8 A;  1NOC B;  2E1U A;  3FP0 A;  4KEC A;  3U9F A;  1EAE A;  2JGP A;  4N72 A;  3FOT A;  5FAN A;  4JN5 A;  4JN3 A;  1Q23 A;  1XL7 A;  1XMC A;  2CLA A;  2RKT A;  3B2S A;  4G22 A;  2RKV A;  5KJU A;  1XMD A;  3L60 A;  5T3E A;  4G0B A;  2E1V A;  2IHW A;  2II4 A;  2II5 A;  3B30 A;  1C4T A;  5KJW A;  5KJV A;  4G2M A;  1L5A A;  3MAE A;  1DPB A;  5DU9 A;  1DPD A;  1EAB A;  3U9B A;  1CIA A;  4KE4 A;  2BGH A; 
#chains in the Genus database with same CATH topology
 1NDF A;  4EP9 A;  1EAA A;  1E2O A;  2II3 A;  2VSQ A;  4EPH A;  2FY3 A;  5DUA A;  1T7N A;  3U9F A;  1EAE A;  4JN3 A;  1XMC A;  3L60 A;  5T3E A;  4G2M A;  1L5A A;  5DU9 A;  5FAL A;  1QCA A;  2XHG A;  2ZBA A;  2FY5 A;  1Q9J A;  3CLA A;  2DEB A;  1NDB A;  1PD5 A;  5KJT A;  1CLA A;  2E1U A;  1XL8 A;  3FP0 A;  4KEC A;  1XL7 A;  2H4T A;  1S5O A;  2H3U A;  3B2S A;  4G22 A;  1T7Q A;  5KJW A;  1C4T A;  2H3P A;  3MAE A;  2II4 A;  2BGH A;  1T1U A;  2FYO A;  4HVM A;  4CLA A;  1SCZ A;  2E1T A;  1EAC A;  2FY4 A;  1T7O A;  1EAF A;  1NOC B;  2JGP A;  3FOT A;  4JN5 A;  1Q23 A;  2CLA A;  2RKT A;  1Q6X A;  1XMD A;  2E1V A;  1NDI A;  2II5 A;  2FY2 A;  1DPD A;  1EAB A;  5KJS A;  4KE4 A;  1EAD A;  1DPC A;  2I9D A;  2XR7 A;  4N72 A;  5FAN A;  2FW3 A;  2RCU A;  5KJU A;  2RKV A;  4G0B A;  2IHW A;  2H3W A;  5KJV A;  3B30 A;  4EYW A;  1DPB A;  3U9B A;  1CIA A;  1NM8 A; 
#chains in the Genus database with same CATH homology
 1QCA A;  5FAL A;  1EAA A;  5KJS A;  2XHG A;  4HVM A;  4CLA A;  1SCZ A;  1EAD A;  1DPC A;  1E2O A;  2E1T A;  1Q9J A;  1EAC A;  2II3 A;  2I9D A;  2VSQ A;  2ZBA A;  3CLA A;  1PD5 A;  5DUA A;  5KJT A;  2XR7 A;  1CLA A;  1EAF A;  1XL8 A;  1NOC B;  2E1U A;  3FP0 A;  4KEC A;  3U9F A;  1EAE A;  2JGP A;  4N72 A;  3FOT A;  5FAN A;  4JN5 A;  4JN3 A;  1Q23 A;  1XL7 A;  1XMC A;  2CLA A;  2RKT A;  3B2S A;  4G22 A;  2RKV A;  5KJU A;  1XMD A;  3L60 A;  5T3E A;  4G0B A;  2E1V A;  2IHW A;  2II4 A;  2II5 A;  3B30 A;  1C4T A;  5KJW A;  5KJV A;  4G2M A;  1L5A A;  3MAE A;  1DPB A;  5DU9 A;  1DPD A;  1EAB A;  3U9B A;  1CIA A;  4KE4 A;  2BGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...