1EABA

Atomic structure of the cubic core of the pyruvate dehydrogenase multienzyme complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
243
structure length
243
Chain Sequence
IPPIPPVDFAKYGEIEEVPMTRLMQIGATNLHRSWLNVPHVTQFESADITELEAFRVAQKAVAKKAGVKLTVLPLLLKACAYLLKELPDFNSSLAPSGQALIRKKYVHIGFAVDTPDGLLVPVIRNVDQKSLLQLAAEAAELAEKARSKKLGADAMQGACFTISSLGHIGGTAFTPIVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLGDLLADIRAILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DIHYDROLIPOYL-TRANSACETYLASE
publication title Crystallographic analysis of substrate binding and catalysis in dihydrolipoyl transacetylase (E2p).
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Dihydrolipoamide acetyltransferase
total genus 68
structure length 243
sequence length 243
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1992-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1eabA00
4G22A 2BGHA 4CLAA 1CIAA 1XL8A 3MAEA 3B30A 3FP0A 4G2MA 5DU9A 3CLAA 5T3EA 1C4TA 5KJWA 3B2SA 1EADA 2II5A 1L5AA 2XHGA 1DPCA 5KJUA 2RKTA 4JN5A 1NOCB 1E2OA 1EABA 2II3A 1QCAA 4KE4A 5FANA 2XR7A 1XL7A 2CLAA 1EAFA 5DUAA 3FOTA 1EAAA 1EACA 2E1TA 2JGPA 2E1UA 1EAEA 3U9FA 1XMCA 2RKVA 1CLAA 3L60A 5KJTA 5KJSA 2E1VA 2II4A 1Q23A 1Q9JA 1SCZA 3U9BA 1XMDA 4KECA 2IHWA 4G0BA 1DPDA 1DPBA 2VSQA 4JN3A 4HVMA 5FALA 2I9DA 1PD5A 5KJVA 4N72A 2ZBAA
chains in the Genus database with same CATH superfamily
4EPHA 4CLAA 1XL8A 3MAEA 5T3EA 1EADA 2II5A 2XHGA 2H3PA 2FW3A 1T7OA 4EP9A 1EABA 2II3A 1XL7A 2CLAA 1EAFA 1T1UA 4EYWA 1EAAA 2RKVA 5KJTA 1T7NA 1Q23A 1SCZA 2FY4A 1DPDA 2VSQA 4N72A 5FANA 1CIAA 5KJWA 1L5AA 2FY5A 2RKTA 1NOCB 1E2OA 1NDFA 5DUAA 2RCUA 1EACA 2H3WA 3U9FA 2E1UA 1EAEA 1NDIA 1CLAA 5KJSA 1Q6XA 4G0BA 4JN3A 1NDBA 4HVMA 2H3UA 4G22A 2BGHA 2FYOA 3FP0A 2DEBA 4G2MA 3CLAA 4JN5A 1S5OA 4KE4A 2JGPA 3L60A 2E1VA 2II4A 4KECA 1DPBA 2H4TA 2I9DA 3B30A 5DU9A 1C4TA 3B2SA 1DPCA 5KJUA 2FY2A 1QCAA 2XR7A 3FOTA 2E1TA 1XMCA 1T7QA 1NM8A 3U9BA 1Q9JA 2FY3A 1XMDA 2IHWA 5KJVA 5FALA 1PD5A 2ZBAA
chains in the Genus database with same CATH topology
4G22A 2BGHA 4CLAA 1CIAA 1XL8A 3MAEA 3B30A 3FP0A 4G2MA 5DU9A 3CLAA 5T3EA 1C4TA 5KJWA 3B2SA 1EADA 2II5A 1L5AA 2XHGA 1DPCA 5KJUA 2RKTA 4JN5A 1NOCB 1E2OA 1EABA 2II3A 1QCAA 4KE4A 5FANA 2XR7A 1XL7A 2CLAA 1EAFA 5DUAA 3FOTA 1EAAA 1EACA 2E1TA 2JGPA 2E1UA 1EAEA 3U9FA 1XMCA 2RKVA 1CLAA 3L60A 5KJTA 5KJSA 2E1VA 2II4A 1Q23A 1Q9JA 1SCZA 3U9BA 1XMDA 4KECA 2IHWA 4G0BA 1DPDA 1DPBA 2VSQA 4JN3A 4HVMA 5FALA 2I9DA 1PD5A 5KJVA 4N72A 2ZBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G22 A;  2BGH A;  4CLA A;  1CIA A;  1XL8 A;  3MAE A;  3B30 A;  3FP0 A;  4G2M A;  5DU9 A;  3CLA A;  5T3E A;  1C4T A;  5KJW A;  3B2S A;  1EAD A;  2II5 A;  1L5A A;  2XHG A;  1DPC A;  5KJU A;  2RKT A;  4JN5 A;  1NOC B;  1E2O A;  1EAB A;  2II3 A;  1QCA A;  4KE4 A;  5FAN A;  2XR7 A;  1XL7 A;  2CLA A;  1EAF A;  5DUA A;  3FOT A;  1EAA A;  1EAC A;  2E1T A;  2JGP A;  2E1U A;  1EAE A;  3U9F A;  1XMC A;  2RKV A;  1CLA A;  3L60 A;  5KJT A;  5KJS A;  2E1V A;  2II4 A;  1Q23 A;  1Q9J A;  1SCZ A;  3U9B A;  1XMD A;  4KEC A;  2IHW A;  4G0B A;  1DPD A;  1DPB A;  2VSQ A;  4JN3 A;  4HVM A;  5FAL A;  2I9D A;  1PD5 A;  5KJV A;  4N72 A;  2ZBA A; 
#chains in the Genus database with same CATH topology
 4EPH A;  4CLA A;  1XL8 A;  3MAE A;  5T3E A;  1EAD A;  2II5 A;  2XHG A;  2H3P A;  2FW3 A;  1T7O A;  4EP9 A;  1EAB A;  2II3 A;  1XL7 A;  2CLA A;  1EAF A;  1T1U A;  4EYW A;  1EAA A;  2RKV A;  5KJT A;  1T7N A;  1Q23 A;  1SCZ A;  2FY4 A;  1DPD A;  2VSQ A;  4N72 A;  5FAN A;  1CIA A;  5KJW A;  1L5A A;  2FY5 A;  2RKT A;  1NOC B;  1E2O A;  1NDF A;  5DUA A;  2RCU A;  1EAC A;  2H3W A;  3U9F A;  2E1U A;  1EAE A;  1NDI A;  1CLA A;  5KJS A;  1Q6X A;  4G0B A;  4JN3 A;  1NDB A;  4HVM A;  2H3U A;  4G22 A;  2BGH A;  2FYO A;  3FP0 A;  2DEB A;  4G2M A;  3CLA A;  4JN5 A;  1S5O A;  4KE4 A;  2JGP A;  3L60 A;  2E1V A;  2II4 A;  4KEC A;  1DPB A;  2H4T A;  2I9D A;  3B30 A;  5DU9 A;  1C4T A;  3B2S A;  1DPC A;  5KJU A;  2FY2 A;  1QCA A;  2XR7 A;  3FOT A;  2E1T A;  1XMC A;  1T7Q A;  1NM8 A;  3U9B A;  1Q9J A;  2FY3 A;  1XMD A;  2IHW A;  5KJV A;  5FAL A;  1PD5 A;  2ZBA A; 
#chains in the Genus database with same CATH homology
 4G22 A;  2BGH A;  4CLA A;  1CIA A;  1XL8 A;  3MAE A;  3B30 A;  3FP0 A;  4G2M A;  5DU9 A;  3CLA A;  5T3E A;  1C4T A;  5KJW A;  3B2S A;  1EAD A;  2II5 A;  1L5A A;  2XHG A;  1DPC A;  5KJU A;  2RKT A;  4JN5 A;  1NOC B;  1E2O A;  1EAB A;  2II3 A;  1QCA A;  4KE4 A;  5FAN A;  2XR7 A;  1XL7 A;  2CLA A;  1EAF A;  5DUA A;  3FOT A;  1EAA A;  1EAC A;  2E1T A;  2JGP A;  2E1U A;  1EAE A;  3U9F A;  1XMC A;  2RKV A;  1CLA A;  3L60 A;  5KJT A;  5KJS A;  2E1V A;  2II4 A;  1Q23 A;  1Q9J A;  1SCZ A;  3U9B A;  1XMD A;  4KEC A;  2IHW A;  4G0B A;  1DPD A;  1DPB A;  2VSQ A;  4JN3 A;  4HVM A;  5FAL A;  2I9D A;  1PD5 A;  5KJV A;  4N72 A;  2ZBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...