1EABA

Atomic structure of the cubic core of the pyruvate dehydrogenase multienzyme complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
243
structure length
243
Chain Sequence
IPPIPPVDFAKYGEIEEVPMTRLMQIGATNLHRSWLNVPHVTQFESADITELEAFRVAQKAVAKKAGVKLTVLPLLLKACAYLLKELPDFNSSLAPSGQALIRKKYVHIGFAVDTPDGLLVPVIRNVDQKSLLQLAAEAAELAEKARSKKLGADAMQGACFTISSLGHIGGTAFTPIVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLGDLLADIRAILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DIHYDROLIPOYL-TRANSACETYLASE
publication title Crystallographic analysis of substrate binding and catalysis in dihydrolipoyl transacetylase (E2p).
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Dihydrolipoamide acetyltransferase
total genus 68
structure length 243
sequence length 243
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1992-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1eabA00
2II4A 1EAAA 2E1VA 1EAFA 1SCZA 2I9DA 5DUAA 4KECA 1EADA 2E1TA 4N72A 1QCAA 1Q23A 1NOCB 5T3EA 4CLAA 2XR7A 5KJVA 4G22A 2RKTA 3FP0A 4G0BA 5KJWA 2VSQA 1DPDA 2BGHA 3FOTA 5DU9A 1XL7A 3CLAA 5FALA 3L60A 1C4TA 1CIAA 2II3A 2II5A 2CLAA 5KJUA 1CLAA 1Q9JA 2IHWA 2RKVA 1EAEA 2XHGA 4JN5A 4JN3A 5KJSA 4HVMA 1EACA 1E2OA 5KJTA 3U9BA 2E1UA 3MAEA 1XMDA 1PD5A 2JGPA 4G2MA 1L5AA 4KE4A 1EABA 1DPCA 3U9FA 1XL8A 5FANA 3B2SA 1XMCA 3B30A 1DPBA 2ZBAA
chains in the Genus database with same CATH superfamily
3U9FA 2E1VA 1EADA 1Q23A 2XR7A 1T7NA 3FOTA 3L60A 1CIAA 5KJUA 2FY2A 1Q9JA 1NDIA 4JN5A 1S5OA 1EACA 2E1UA 1L5AA 1PD5A 1NDFA 2H3UA 1T7QA 1DPBA 2RCUA 3MAEA 2ZBAA 1EAAA 5DUAA 4CLAA 1NOCB 2RKTA 5DU9A 2BGHA 2H3PA 5FALA 2II3A 2II5A 2FY3A 2JGPA 1NDBA 1EABA 1DPCA 1XL8A 3B30A 2II4A 2I9DA 1EAFA 4KECA 5T3EA 1QCAA 4G22A 2VSQA 2FY5A 1DPDA 1XL7A 3CLAA 4EP9A 2CLAA 2FW3A 2RKVA 2XHGA 4JN3A 1NM8A 1E2OA 3U9BA 2FYOA 2H4TA 1XMDA 4G2MA 1T7OA 2H3WA 1SCZA 2DEBA 4N72A 2E1TA 5KJVA 1Q6XA 3FP0A 4G0BA 2FY4A 5KJWA 4EPHA 1C4TA 1CLAA 2IHWA 1EAEA 1T1UA 5KJSA 4HVMA 5KJTA 4KE4A 4EYWA 5FANA 3B2SA 1XMCA
chains in the Genus database with same CATH topology
2II4A 1EAAA 2E1VA 1EAFA 1SCZA 2I9DA 5DUAA 4KECA 1EADA 2E1TA 4N72A 1QCAA 1Q23A 1NOCB 5T3EA 4CLAA 2XR7A 5KJVA 4G22A 2RKTA 3FP0A 4G0BA 5KJWA 2VSQA 1DPDA 2BGHA 3FOTA 5DU9A 1XL7A 3CLAA 5FALA 3L60A 1C4TA 1CIAA 2II3A 2II5A 2CLAA 5KJUA 1CLAA 1Q9JA 2IHWA 2RKVA 1EAEA 2XHGA 4JN5A 4JN3A 5KJSA 4HVMA 1EACA 1E2OA 5KJTA 3U9BA 2E1UA 3MAEA 1XMDA 1PD5A 2JGPA 4G2MA 1L5AA 4KE4A 1EABA 1DPCA 3U9FA 1XL8A 5FANA 3B2SA 1XMCA 3B30A 1DPBA 2ZBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2II4 A;  1EAA A;  2E1V A;  1EAF A;  1SCZ A;  2I9D A;  5DUA A;  4KEC A;  1EAD A;  2E1T A;  4N72 A;  1QCA A;  1Q23 A;  1NOC B;  5T3E A;  4CLA A;  2XR7 A;  5KJV A;  4G22 A;  2RKT A;  3FP0 A;  4G0B A;  5KJW A;  2VSQ A;  1DPD A;  2BGH A;  3FOT A;  5DU9 A;  1XL7 A;  3CLA A;  5FAL A;  3L60 A;  1C4T A;  1CIA A;  2II3 A;  2II5 A;  2CLA A;  5KJU A;  1CLA A;  1Q9J A;  2IHW A;  2RKV A;  1EAE A;  2XHG A;  4JN5 A;  4JN3 A;  5KJS A;  4HVM A;  1EAC A;  1E2O A;  5KJT A;  3U9B A;  2E1U A;  3MAE A;  1XMD A;  1PD5 A;  2JGP A;  4G2M A;  1L5A A;  4KE4 A;  1EAB A;  1DPC A;  3U9F A;  1XL8 A;  5FAN A;  3B2S A;  1XMC A;  3B30 A;  1DPB A;  2ZBA A; 
#chains in the Genus database with same CATH topology
 3U9F A;  2E1V A;  1EAD A;  1Q23 A;  2XR7 A;  1T7N A;  3FOT A;  3L60 A;  1CIA A;  5KJU A;  2FY2 A;  1Q9J A;  1NDI A;  4JN5 A;  1S5O A;  1EAC A;  2E1U A;  1L5A A;  1PD5 A;  1NDF A;  2H3U A;  1T7Q A;  1DPB A;  2RCU A;  3MAE A;  2ZBA A;  1EAA A;  5DUA A;  4CLA A;  1NOC B;  2RKT A;  5DU9 A;  2BGH A;  2H3P A;  5FAL A;  2II3 A;  2II5 A;  2FY3 A;  2JGP A;  1NDB A;  1EAB A;  1DPC A;  1XL8 A;  3B30 A;  2II4 A;  2I9D A;  1EAF A;  4KEC A;  5T3E A;  1QCA A;  4G22 A;  2VSQ A;  2FY5 A;  1DPD A;  1XL7 A;  3CLA A;  4EP9 A;  2CLA A;  2FW3 A;  2RKV A;  2XHG A;  4JN3 A;  1NM8 A;  1E2O A;  3U9B A;  2FYO A;  2H4T A;  1XMD A;  4G2M A;  1T7O A;  2H3W A;  1SCZ A;  2DEB A;  4N72 A;  2E1T A;  5KJV A;  1Q6X A;  3FP0 A;  4G0B A;  2FY4 A;  5KJW A;  4EPH A;  1C4T A;  1CLA A;  2IHW A;  1EAE A;  1T1U A;  5KJS A;  4HVM A;  5KJT A;  4KE4 A;  4EYW A;  5FAN A;  3B2S A;  1XMC A; 
#chains in the Genus database with same CATH homology
 2II4 A;  1EAA A;  2E1V A;  1EAF A;  1SCZ A;  2I9D A;  5DUA A;  4KEC A;  1EAD A;  2E1T A;  4N72 A;  1QCA A;  1Q23 A;  1NOC B;  5T3E A;  4CLA A;  2XR7 A;  5KJV A;  4G22 A;  2RKT A;  3FP0 A;  4G0B A;  5KJW A;  2VSQ A;  1DPD A;  2BGH A;  3FOT A;  5DU9 A;  1XL7 A;  3CLA A;  5FAL A;  3L60 A;  1C4T A;  1CIA A;  2II3 A;  2II5 A;  2CLA A;  5KJU A;  1CLA A;  1Q9J A;  2IHW A;  2RKV A;  1EAE A;  2XHG A;  4JN5 A;  4JN3 A;  5KJS A;  4HVM A;  1EAC A;  1E2O A;  5KJT A;  3U9B A;  2E1U A;  3MAE A;  1XMD A;  1PD5 A;  2JGP A;  4G2M A;  1L5A A;  4KE4 A;  1EAB A;  1DPC A;  3U9F A;  1XL8 A;  5FAN A;  3B2S A;  1XMC A;  3B30 A;  1DPB A;  2ZBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...