1DPCA

Crystallographic and enzymatic investigations on the role of ser558, his610 and asn614 in the catalytic mechanism of azotobacter vinelandii dihydrolipoamide acetyltransferase (e2p)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
243
structure length
243
Chain Sequence
IPPIPPVDFAKYGEIEEVPMTRLMQIGATNLHRSWLNVPHVTQFESADITELEAFRVAQKAVAEKAGVKLTVLPLLLKACAYLLKELPDFNSSLAPSGQALIRKKYVHIGFAVDTPDGLLVPVIRNVDQKSLLQLAAEAAELAEKARSKKLGADAMQGACFTISSLGHIGGTAFTPIVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDHRVIDGAAAARFTKRLGDLLADIRAILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dihydrolipoamide acetyltransferase
molecule keywords DIHYDROLIPOYL-TRANSACETYLASE
publication title Crystallographic and enzymatic investigations on the role of Ser558, His610, and Asn614 in the catalytic mechanism of Azotobacter vinelandii dihydrolipoamide acetyltransferase (E2p).
pubmed doi rcsb
source organism Azotobacter vinelandii
total genus 67
structure length 243
sequence length 243
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1995-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1dpcA00
4JN5A 1L5AA 3U9BA 2VSQA 2II4A 2CLAA 4G22A 5KJSA 5KJWA 1DPBA 1DPDA 1SCZA 1XMDA 1XL7A 2XR7A 1C4TA 3CLAA 5KJTA 1E2OA 1DPCA 2E1TA 2RKVA 2II5A 2I9DA 5FANA 1QCAA 3L60A 4JN3A 4KECA 1EADA 5FALA 5T3EA 1EACA 1XMCA 3FOTA 5DUAA 2BGHA 1Q23A 3MAEA 2E1UA 1XL8A 4HVMA 1EAEA 4CLAA 1CLAA 2ZBAA 5DU9A 2XHGA 1Q9JA 2IHWA 1CIAA 1NOCB 3FP0A 2E1VA 3B30A 2RKTA 3B2SA 5KJVA 4G0BA 1PD5A 4KE4A 2II3A 3U9FA 1EABA 4G2MA 4N72A 1EAAA 5KJUA 2JGPA 1EAFA
chains in the Genus database with same CATH superfamily
2VSQA 2FW3A 5KJSA 1DPBA 1DPDA 2DEBA 2XR7A 3CLAA 5KJTA 1NDFA 1T7OA 1E2OA 1DPCA 2E1TA 2I9DA 5FANA 4JN3A 2FY5A 4HVMA 2ZBAA 2XHGA 1CIAA 1NOCB 2E1VA 3B30A 3B2SA 2H3UA 1PD5A 3U9FA 1EABA 4EYWA 1EAAA 1EAFA 1Q6XA 1SCZA 1NDBA 2FY3A 2RKVA 3L60A 1T1UA 2H4TA 1EACA 1XMCA 3FOTA 1NM8A 3MAEA 2E1UA 4CLAA 4EP9A 2IHWA 2RKTA 4N72A 5KJUA 2JGPA 4JN5A 1NDIA 5KJWA 1XMDA 2II5A 1QCAA 4KECA 1EADA 1T7NA 2H3PA 2FYOA 2BGHA 1EAEA 1CLAA 5KJVA 4G0BA 4KE4A 2H3WA 4G2MA 1L5AA 3U9BA 2FY2A 2II4A 2CLAA 4G22A 1XL7A 1C4TA 2RCUA 1T7QA 5FALA 5T3EA 5DUAA 1Q23A 1XL8A 2FY4A 1S5OA 5DU9A 1Q9JA 3FP0A 4EPHA 2II3A
chains in the Genus database with same CATH topology
4JN5A 1L5AA 3U9BA 2VSQA 2II4A 2CLAA 4G22A 5KJSA 5KJWA 1DPBA 1DPDA 1SCZA 1XMDA 1XL7A 2XR7A 1C4TA 3CLAA 5KJTA 1E2OA 1DPCA 2E1TA 2RKVA 2II5A 2I9DA 5FANA 1QCAA 3L60A 4JN3A 4KECA 1EADA 5FALA 5T3EA 1EACA 1XMCA 3FOTA 5DUAA 2BGHA 1Q23A 3MAEA 2E1UA 1XL8A 4HVMA 1EAEA 4CLAA 1CLAA 2ZBAA 5DU9A 2XHGA 1Q9JA 2IHWA 1CIAA 1NOCB 3FP0A 2E1VA 3B30A 2RKTA 3B2SA 5KJVA 4G0BA 1PD5A 4KE4A 2II3A 3U9FA 1EABA 4G2MA 4N72A 1EAAA 5KJUA 2JGPA 1EAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JN5 A;  1L5A A;  3U9B A;  2VSQ A;  2II4 A;  2CLA A;  4G22 A;  5KJS A;  5KJW A;  1DPB A;  1DPD A;  1SCZ A;  1XMD A;  1XL7 A;  2XR7 A;  1C4T A;  3CLA A;  5KJT A;  1E2O A;  1DPC A;  2E1T A;  2RKV A;  2II5 A;  2I9D A;  5FAN A;  1QCA A;  3L60 A;  4JN3 A;  4KEC A;  1EAD A;  5FAL A;  5T3E A;  1EAC A;  1XMC A;  3FOT A;  5DUA A;  2BGH A;  1Q23 A;  3MAE A;  2E1U A;  1XL8 A;  4HVM A;  1EAE A;  4CLA A;  1CLA A;  2ZBA A;  5DU9 A;  2XHG A;  1Q9J A;  2IHW A;  1CIA A;  1NOC B;  3FP0 A;  2E1V A;  3B30 A;  2RKT A;  3B2S A;  5KJV A;  4G0B A;  1PD5 A;  4KE4 A;  2II3 A;  3U9F A;  1EAB A;  4G2M A;  4N72 A;  1EAA A;  5KJU A;  2JGP A;  1EAF A; 
#chains in the Genus database with same CATH topology
 2VSQ A;  2FW3 A;  5KJS A;  1DPB A;  1DPD A;  2DEB A;  2XR7 A;  3CLA A;  5KJT A;  1NDF A;  1T7O A;  1E2O A;  1DPC A;  2E1T A;  2I9D A;  5FAN A;  4JN3 A;  2FY5 A;  4HVM A;  2ZBA A;  2XHG A;  1CIA A;  1NOC B;  2E1V A;  3B30 A;  3B2S A;  2H3U A;  1PD5 A;  3U9F A;  1EAB A;  4EYW A;  1EAA A;  1EAF A;  1Q6X A;  1SCZ A;  1NDB A;  2FY3 A;  2RKV A;  3L60 A;  1T1U A;  2H4T A;  1EAC A;  1XMC A;  3FOT A;  1NM8 A;  3MAE A;  2E1U A;  4CLA A;  4EP9 A;  2IHW A;  2RKT A;  4N72 A;  5KJU A;  2JGP A;  4JN5 A;  1NDI A;  5KJW A;  1XMD A;  2II5 A;  1QCA A;  4KEC A;  1EAD A;  1T7N A;  2H3P A;  2FYO A;  2BGH A;  1EAE A;  1CLA A;  5KJV A;  4G0B A;  4KE4 A;  2H3W A;  4G2M A;  1L5A A;  3U9B A;  2FY2 A;  2II4 A;  2CLA A;  4G22 A;  1XL7 A;  1C4T A;  2RCU A;  1T7Q A;  5FAL A;  5T3E A;  5DUA A;  1Q23 A;  1XL8 A;  2FY4 A;  1S5O A;  5DU9 A;  1Q9J A;  3FP0 A;  4EPH A;  2II3 A; 
#chains in the Genus database with same CATH homology
 4JN5 A;  1L5A A;  3U9B A;  2VSQ A;  2II4 A;  2CLA A;  4G22 A;  5KJS A;  5KJW A;  1DPB A;  1DPD A;  1SCZ A;  1XMD A;  1XL7 A;  2XR7 A;  1C4T A;  3CLA A;  5KJT A;  1E2O A;  1DPC A;  2E1T A;  2RKV A;  2II5 A;  2I9D A;  5FAN A;  1QCA A;  3L60 A;  4JN3 A;  4KEC A;  1EAD A;  5FAL A;  5T3E A;  1EAC A;  1XMC A;  3FOT A;  5DUA A;  2BGH A;  1Q23 A;  3MAE A;  2E1U A;  1XL8 A;  4HVM A;  1EAE A;  4CLA A;  1CLA A;  2ZBA A;  5DU9 A;  2XHG A;  1Q9J A;  2IHW A;  1CIA A;  1NOC B;  3FP0 A;  2E1V A;  3B30 A;  2RKT A;  3B2S A;  5KJV A;  4G0B A;  1PD5 A;  4KE4 A;  2II3 A;  3U9F A;  1EAB A;  4G2M A;  4N72 A;  1EAA A;  5KJU A;  2JGP A;  1EAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...