1DPCA

Crystallographic and enzymatic investigations on the role of ser558, his610 and asn614 in the catalytic mechanism of azotobacter vinelandii dihydrolipoamide acetyltransferase (e2p)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
243
structure length
243
Chain Sequence
b'IPPIPPVDFAKYGEIEEVPMTRLMQIGATNLHRSWLNVPHVTQFESADITELEAFRVAQKAVAEKAGVKLTVLPLLLKACAYLLKELPDFNSSLAPSGQALIRKKYVHIGFAVDTPDGLLVPVIRNVDQKSLLQLAAEAAELAEKARSKKLGADAMQGACFTISSLGHIGGTAFTPIVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDHRVIDGAAAARFTKRLGDLLADIRAILL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DIHYDROLIPOYL-TRANSACETYLASE
publication title Crystallographic and enzymatic investigations on the role of Ser558, His610, and Asn614 in the catalytic mechanism of Azotobacter vinelandii dihydrolipoamide acetyltransferase (E2p).
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Dihydrolipoamide acetyltransferase
total genus 67
structure length 243
sequence length 243
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1995-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1dpcA00
1E2OA 2ZBAA 2JGPA 2RKVA 1XL8A 5FALA 2RKTA 5DUAA 5KJVA 2CLAA 1EAEA 2E1TA 2II4A 1NOCB 1DPCA 3U9BA 5KJSA 1XL7A 2E1VA 2VSQA 4CLAA 1Q23A 4KE4A 2E1UA 3CLAA 1EABA 2II3A 5KJWA 1EADA 1EAAA 3B30A 4KECA 1EACA 1DPBA 5FANA 1QCAA 4G2MA 2I9DA 1DPDA 1SCZA 4N72A 3FP0A 5DU9A 2XHGA 4JN5A 5KJTA 5KJUA 3FOTA 2XR7A 3U9FA 1CLAA 1Q9JA 1L5AA 1XMCA 3L60A 4G0BA 2IHWA 1CIAA 2BGHA 2II5A 3B2SA 5T3EA 3MAEA 4G22A 4JN3A 1PD5A 1EAFA 1C4TA 4HVMA 1XMDA
chains in the Genus database with same CATH superfamily
2ZBAA 2JGPA 5FALA 1NDIA 1EAEA 2E1TA 1XL7A 1Q23A 4KE4A 2DEBA 4KECA 5FANA 4N72A 4EPHA 1Q9JA 1XMCA 3L60A 5T3EA 1CIAA 3B2SA 1XMDA 1E2OA 2FW3A 1S5OA 2II4A 1NOCB 1DPCA 2E1VA 1Q6XA 2VSQA 4CLAA 1EABA 1EACA 2FY4A 3FP0A 1NM8A 1T7OA 2XHGA 4JN5A 1L5AA 4G0BA 2IHWA 1T7QA 2BGHA 2II5A 3MAEA 2H3UA 2II3A 4HVMA 3U9FA 2FY5A 4EYWA 2RKVA 1XL8A 5KJSA 2E1UA 3CLAA 1EADA 1EAAA 2RCUA 1QCAA 2H4TA 1SCZA 1CLAA 2H3PA 1PD5A 1EAFA 5KJVA 2CLAA 2RKTA 5DUAA 3U9BA 4EP9A 2H3WA 5KJWA 3B30A 1DPBA 1T1UA 2FY3A 1NDFA 1DPDA 2I9DA 5DU9A 2FYOA 5KJTA 5KJUA 3FOTA 2XR7A 1NDBA 1T7NA 4G22A 4JN3A 1C4TA 2FY2A 4G2MA
chains in the Genus database with same CATH topology
1E2OA 2ZBAA 2JGPA 2RKVA 1XL8A 5FALA 2RKTA 5DUAA 5KJVA 2CLAA 1EAEA 2E1TA 2II4A 1NOCB 1DPCA 3U9BA 5KJSA 1XL7A 2E1VA 2VSQA 4CLAA 1Q23A 4KE4A 2E1UA 3CLAA 1EABA 2II3A 5KJWA 1EADA 1EAAA 3B30A 4KECA 1EACA 1DPBA 5FANA 1QCAA 4G2MA 2I9DA 1DPDA 1SCZA 4N72A 3FP0A 5DU9A 2XHGA 4JN5A 5KJTA 5KJUA 3FOTA 2XR7A 3U9FA 1CLAA 1Q9JA 1L5AA 1XMCA 3L60A 4G0BA 2IHWA 1CIAA 2BGHA 2II5A 3B2SA 5T3EA 3MAEA 4G22A 4JN3A 1PD5A 1EAFA 1C4TA 4HVMA 1XMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E2O A;  2ZBA A;  2JGP A;  2RKV A;  1XL8 A;  5FAL A;  2RKT A;  5DUA A;  5KJV A;  2CLA A;  1EAE A;  2E1T A;  2II4 A;  1NOC B;  1DPC A;  3U9B A;  5KJS A;  1XL7 A;  2E1V A;  2VSQ A;  4CLA A;  1Q23 A;  4KE4 A;  2E1U A;  3CLA A;  1EAB A;  2II3 A;  5KJW A;  1EAD A;  1EAA A;  3B30 A;  4KEC A;  1EAC A;  1DPB A;  5FAN A;  1QCA A;  4G2M A;  2I9D A;  1DPD A;  1SCZ A;  4N72 A;  3FP0 A;  5DU9 A;  2XHG A;  4JN5 A;  5KJT A;  5KJU A;  3FOT A;  2XR7 A;  3U9F A;  1CLA A;  1Q9J A;  1L5A A;  1XMC A;  3L60 A;  4G0B A;  2IHW A;  1CIA A;  2BGH A;  2II5 A;  3B2S A;  5T3E A;  3MAE A;  4G22 A;  4JN3 A;  1PD5 A;  1EAF A;  1C4T A;  4HVM A;  1XMD A; 
#chains in the Genus database with same CATH topology
 2ZBA A;  2JGP A;  5FAL A;  1NDI A;  1EAE A;  2E1T A;  1XL7 A;  1Q23 A;  4KE4 A;  2DEB A;  4KEC A;  5FAN A;  4N72 A;  4EPH A;  1Q9J A;  1XMC A;  3L60 A;  5T3E A;  1CIA A;  3B2S A;  1XMD A;  1E2O A;  2FW3 A;  1S5O A;  2II4 A;  1NOC B;  1DPC A;  2E1V A;  1Q6X A;  2VSQ A;  4CLA A;  1EAB A;  1EAC A;  2FY4 A;  3FP0 A;  1NM8 A;  1T7O A;  2XHG A;  4JN5 A;  1L5A A;  4G0B A;  2IHW A;  1T7Q A;  2BGH A;  2II5 A;  3MAE A;  2H3U A;  2II3 A;  4HVM A;  3U9F A;  2FY5 A;  4EYW A;  2RKV A;  1XL8 A;  5KJS A;  2E1U A;  3CLA A;  1EAD A;  1EAA A;  2RCU A;  1QCA A;  2H4T A;  1SCZ A;  1CLA A;  2H3P A;  1PD5 A;  1EAF A;  5KJV A;  2CLA A;  2RKT A;  5DUA A;  3U9B A;  4EP9 A;  2H3W A;  5KJW A;  3B30 A;  1DPB A;  1T1U A;  2FY3 A;  1NDF A;  1DPD A;  2I9D A;  5DU9 A;  2FYO A;  5KJT A;  5KJU A;  3FOT A;  2XR7 A;  1NDB A;  1T7N A;  4G22 A;  4JN3 A;  1C4T A;  2FY2 A;  4G2M A; 
#chains in the Genus database with same CATH homology
 1E2O A;  2ZBA A;  2JGP A;  2RKV A;  1XL8 A;  5FAL A;  2RKT A;  5DUA A;  5KJV A;  2CLA A;  1EAE A;  2E1T A;  2II4 A;  1NOC B;  1DPC A;  3U9B A;  5KJS A;  1XL7 A;  2E1V A;  2VSQ A;  4CLA A;  1Q23 A;  4KE4 A;  2E1U A;  3CLA A;  1EAB A;  2II3 A;  5KJW A;  1EAD A;  1EAA A;  3B30 A;  4KEC A;  1EAC A;  1DPB A;  5FAN A;  1QCA A;  4G2M A;  2I9D A;  1DPD A;  1SCZ A;  4N72 A;  3FP0 A;  5DU9 A;  2XHG A;  4JN5 A;  5KJT A;  5KJU A;  3FOT A;  2XR7 A;  3U9F A;  1CLA A;  1Q9J A;  1L5A A;  1XMC A;  3L60 A;  4G0B A;  2IHW A;  1CIA A;  2BGH A;  2II5 A;  3B2S A;  5T3E A;  3MAE A;  4G22 A;  4JN3 A;  1PD5 A;  1EAF A;  1C4T A;  4HVM A;  1XMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...