1DPCA

Crystallographic and enzymatic investigations on the role of ser558, his610 and asn614 in the catalytic mechanism of azotobacter vinelandii dihydrolipoamide acetyltransferase (e2p)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
243
structure length
243
Chain Sequence
IPPIPPVDFAKYGEIEEVPMTRLMQIGATNLHRSWLNVPHVTQFESADITELEAFRVAQKAVAEKAGVKLTVLPLLLKACAYLLKELPDFNSSLAPSGQALIRKKYVHIGFAVDTPDGLLVPVIRNVDQKSLLQLAAEAAELAEKARSKKLGADAMQGACFTISSLGHIGGTAFTPIVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDHRVIDGAAAARFTKRLGDLLADIRAILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DIHYDROLIPOYL-TRANSACETYLASE
publication title Crystallographic and enzymatic investigations on the role of Ser558, His610, and Asn614 in the catalytic mechanism of Azotobacter vinelandii dihydrolipoamide acetyltransferase (E2p).
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Dihydrolipoamide acetyltransferase
total genus 67
structure length 243
sequence length 243
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1995-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1dpcA00
1EAAA 5KJUA 2E1TA 1CIAA 1Q23A 1C4TA 2BGHA 1XL8A 1XMDA 4G2MA 4N72A 2RKTA 1SCZA 2E1UA 2XR7A 1XMCA 5KJTA 4G22A 2II3A 1DPCA 2II4A 3U9FA 1EAEA 2E1VA 2VSQA 5FALA 2CLAA 5KJVA 3B2SA 3CLAA 5DU9A 3U9BA 1QCAA 2IHWA 1CLAA 2RKVA 4HVMA 1EACA 3B30A 2JGPA 1DPDA 3FP0A 1L5AA 1EADA 5T3EA 4CLAA 1E2OA 1EABA 1EAFA 2XHGA 3FOTA 4JN3A 5KJSA 1XL7A 4G0BA 1NOCB 4KE4A 1Q9JA 2ZBAA 4JN5A 2I9DA 2II5A 5KJWA 5DUAA 4KECA 1DPBA 3L60A 5FANA 1PD5A 3MAEA
chains in the Genus database with same CATH superfamily
2DEBA 1T7QA 2XR7A 2H3UA 2VSQA 1S5OA 3CLAA 5DU9A 2IHWA 1CLAA 4EYWA 1NM8A 4EPHA 1E2OA 2H3WA 1NDBA 1XL7A 1NOCB 2ZBAA 2I9DA 5FANA 2FY4A 2E1TA 2H3PA 1XMDA 2FW3A 1SCZA 5FALA 1NDFA 3B30A 3FP0A 1L5AA 4CLAA 1T7OA 4JN3A 4G0BA 5KJWA 2RCUA 1PD5A 3MAEA 5KJUA 1CIAA 1C4TA 2FY3A 1XL8A 4N72A 2FY2A 1XMCA 2II3A 1DPCA 2II4A 2E1VA 2CLAA 5KJVA 1Q6XA 3U9BA 1T7NA 2FY5A 2FYOA 1EACA 4EP9A 2JGPA 1DPDA 5T3EA 2XHGA 4KE4A 2H4TA 4JN5A 5DUAA 3L60A 1EAAA 1Q23A 2BGHA 4G2MA 2RKTA 1T1UA 2E1UA 5KJTA 4G22A 3U9FA 1EAEA 3B2SA 1QCAA 2RKVA 4HVMA 1EADA 1EABA 1EAFA 3FOTA 5KJSA 1Q9JA 2II5A 4KECA 1DPBA 1NDIA
chains in the Genus database with same CATH topology
1EAAA 5KJUA 2E1TA 1CIAA 1Q23A 1C4TA 2BGHA 1XL8A 1XMDA 4G2MA 4N72A 2RKTA 1SCZA 2E1UA 2XR7A 1XMCA 5KJTA 4G22A 2II3A 1DPCA 2II4A 3U9FA 1EAEA 2E1VA 2VSQA 5FALA 2CLAA 5KJVA 3B2SA 3CLAA 5DU9A 3U9BA 1QCAA 2IHWA 1CLAA 2RKVA 4HVMA 1EACA 3B30A 2JGPA 1DPDA 3FP0A 1L5AA 1EADA 5T3EA 4CLAA 1E2OA 1EABA 1EAFA 2XHGA 3FOTA 4JN3A 5KJSA 1XL7A 4G0BA 1NOCB 4KE4A 1Q9JA 2ZBAA 4JN5A 2I9DA 2II5A 5KJWA 5DUAA 4KECA 1DPBA 3L60A 5FANA 1PD5A 3MAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EAA A;  5KJU A;  2E1T A;  1CIA A;  1Q23 A;  1C4T A;  2BGH A;  1XL8 A;  1XMD A;  4G2M A;  4N72 A;  2RKT A;  1SCZ A;  2E1U A;  2XR7 A;  1XMC A;  5KJT A;  4G22 A;  2II3 A;  1DPC A;  2II4 A;  3U9F A;  1EAE A;  2E1V A;  2VSQ A;  5FAL A;  2CLA A;  5KJV A;  3B2S A;  3CLA A;  5DU9 A;  3U9B A;  1QCA A;  2IHW A;  1CLA A;  2RKV A;  4HVM A;  1EAC A;  3B30 A;  2JGP A;  1DPD A;  3FP0 A;  1L5A A;  1EAD A;  5T3E A;  4CLA A;  1E2O A;  1EAB A;  1EAF A;  2XHG A;  3FOT A;  4JN3 A;  5KJS A;  1XL7 A;  4G0B A;  1NOC B;  4KE4 A;  1Q9J A;  2ZBA A;  4JN5 A;  2I9D A;  2II5 A;  5KJW A;  5DUA A;  4KEC A;  1DPB A;  3L60 A;  5FAN A;  1PD5 A;  3MAE A; 
#chains in the Genus database with same CATH topology
 2DEB A;  1T7Q A;  2XR7 A;  2H3U A;  2VSQ A;  1S5O A;  3CLA A;  5DU9 A;  2IHW A;  1CLA A;  4EYW A;  1NM8 A;  4EPH A;  1E2O A;  2H3W A;  1NDB A;  1XL7 A;  1NOC B;  2ZBA A;  2I9D A;  5FAN A;  2FY4 A;  2E1T A;  2H3P A;  1XMD A;  2FW3 A;  1SCZ A;  5FAL A;  1NDF A;  3B30 A;  3FP0 A;  1L5A A;  4CLA A;  1T7O A;  4JN3 A;  4G0B A;  5KJW A;  2RCU A;  1PD5 A;  3MAE A;  5KJU A;  1CIA A;  1C4T A;  2FY3 A;  1XL8 A;  4N72 A;  2FY2 A;  1XMC A;  2II3 A;  1DPC A;  2II4 A;  2E1V A;  2CLA A;  5KJV A;  1Q6X A;  3U9B A;  1T7N A;  2FY5 A;  2FYO A;  1EAC A;  4EP9 A;  2JGP A;  1DPD A;  5T3E A;  2XHG A;  4KE4 A;  2H4T A;  4JN5 A;  5DUA A;  3L60 A;  1EAA A;  1Q23 A;  2BGH A;  4G2M A;  2RKT A;  1T1U A;  2E1U A;  5KJT A;  4G22 A;  3U9F A;  1EAE A;  3B2S A;  1QCA A;  2RKV A;  4HVM A;  1EAD A;  1EAB A;  1EAF A;  3FOT A;  5KJS A;  1Q9J A;  2II5 A;  4KEC A;  1DPB A;  1NDI A; 
#chains in the Genus database with same CATH homology
 1EAA A;  5KJU A;  2E1T A;  1CIA A;  1Q23 A;  1C4T A;  2BGH A;  1XL8 A;  1XMD A;  4G2M A;  4N72 A;  2RKT A;  1SCZ A;  2E1U A;  2XR7 A;  1XMC A;  5KJT A;  4G22 A;  2II3 A;  1DPC A;  2II4 A;  3U9F A;  1EAE A;  2E1V A;  2VSQ A;  5FAL A;  2CLA A;  5KJV A;  3B2S A;  3CLA A;  5DU9 A;  3U9B A;  1QCA A;  2IHW A;  1CLA A;  2RKV A;  4HVM A;  1EAC A;  3B30 A;  2JGP A;  1DPD A;  3FP0 A;  1L5A A;  1EAD A;  5T3E A;  4CLA A;  1E2O A;  1EAB A;  1EAF A;  2XHG A;  3FOT A;  4JN3 A;  5KJS A;  1XL7 A;  4G0B A;  1NOC B;  4KE4 A;  1Q9J A;  2ZBA A;  4JN5 A;  2I9D A;  2II5 A;  5KJW A;  5DUA A;  4KEC A;  1DPB A;  3L60 A;  5FAN A;  1PD5 A;  3MAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...