1PD5A

Crystal structure of e.coli chloramphenicol acetyltransferase type i at 2.5 angstrom resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
213
structure length
213
Chain Sequence
TGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFLKTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSSLWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANMDNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Chloramphenicol acetyltransferase
publication title Crystal structure of E.coli chloramphenicol acetyltransferase type I at 2.5 Angstrom resolution
rcsb
source organism Escherichia coli
total genus 60
structure length 213
sequence length 213
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.3.1.28: Chloramphenicol O-acetyltransferase.
pdb deposition date 2003-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00302 CAT Chloramphenicol acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1pd5A00
1SCZA 2II4A 1QCAA 5KJSA 5DUAA 1EADA 4G2MA 5KJTA 2RKVA 1EAEA 5KJWA 3FOTA 3B30A 5FANA 1CLAA 3U9BA 1XMDA 3FP0A 4KE4A 4HVMA 2VSQA 1NOCB 1EABA 2XHGA 1E2OA 2II5A 5FALA 2RKTA 1EACA 2II3A 1EAAA 2CLAA 1XL7A 1DPDA 2E1UA 1Q9JA 4KECA 3U9FA 4CLAA 2BGHA 3B2SA 3MAEA 4G22A 4N72A 3CLAA 3L60A 1CIAA 1Q23A 4G0BA 5KJVA 1EAFA 5KJUA 1DPCA 5T3EA 1PD5A 2IHWA 2XR7A 2ZBAA 1C4TA 1XMCA 2I9DA 2JGPA 4JN3A 1XL8A 1L5AA 1DPBA 5DU9A 2E1TA 2E1VA 4JN5A
chains in the Genus database with same CATH superfamily
1T1UA 2II4A 1QCAA 1EADA 3FOTA 2RCUA 3FP0A 4KE4A 4HVMA 2VSQA 1NOCB 5FALA 2II5A 3U9FA 1Q9JA 3B2SA 4N72A 1Q23A 5KJUA 2H4TA 5T3EA 2ZBAA 2JGPA 1XL8A 2H3WA 1L5AA 1Q6XA 1T7QA 4EYWA 1NDBA 1XMDA 2FY2A 2DEBA 2FYOA 1S5OA 2XHGA 1E2OA 1NM8A 2RKTA 1EACA 2CLAA 1DPDA 4CLAA 4KECA 4EPHA 4G22A 2H3UA 3CLAA 1T7NA 2H3PA 2FY3A 1DPCA 1T7OA 1PD5A 2I9DA 2FY5A 1DPBA 2E1TA 1SCZA 5KJSA 4G2MA 2RKVA 5KJWA 1CLAA 2FW3A 1EABA 2II3A 1NDIA 4EP9A 5KJVA 4G0BA 5DU9A 2E1VA 1NDFA 5DUAA 5KJTA 1EAEA 3B30A 5FANA 3U9BA 1EAAA 1XL7A 2E1UA 2BGHA 3MAEA 3L60A 1CIAA 1EAFA 2XR7A 1C4TA 1XMCA 4JN3A 2FY4A 2IHWA 4JN5A
chains in the Genus database with same CATH topology
1SCZA 2II4A 1QCAA 5KJSA 5DUAA 1EADA 4G2MA 5KJTA 2RKVA 1EAEA 5KJWA 3FOTA 3B30A 5FANA 1CLAA 3U9BA 1XMDA 3FP0A 4KE4A 4HVMA 2VSQA 1NOCB 1EABA 2XHGA 1E2OA 2II5A 5FALA 2RKTA 1EACA 2II3A 1EAAA 2CLAA 1XL7A 1DPDA 2E1UA 1Q9JA 4KECA 3U9FA 4CLAA 2BGHA 3B2SA 3MAEA 4G22A 4N72A 3CLAA 3L60A 1CIAA 1Q23A 4G0BA 5KJVA 1EAFA 5KJUA 1DPCA 5T3EA 1PD5A 2IHWA 2XR7A 2ZBAA 1C4TA 1XMCA 2I9DA 2JGPA 4JN3A 1XL8A 1L5AA 1DPBA 5DU9A 2E1TA 2E1VA 4JN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SCZ A;  2II4 A;  1QCA A;  5KJS A;  5DUA A;  1EAD A;  4G2M A;  5KJT A;  2RKV A;  1EAE A;  5KJW A;  3FOT A;  3B30 A;  5FAN A;  1CLA A;  3U9B A;  1XMD A;  3FP0 A;  4KE4 A;  4HVM A;  2VSQ A;  1NOC B;  1EAB A;  2XHG A;  1E2O A;  2II5 A;  5FAL A;  2RKT A;  1EAC A;  2II3 A;  1EAA A;  2CLA A;  1XL7 A;  1DPD A;  2E1U A;  1Q9J A;  4KEC A;  3U9F A;  4CLA A;  2BGH A;  3B2S A;  3MAE A;  4G22 A;  4N72 A;  3CLA A;  3L60 A;  1CIA A;  1Q23 A;  4G0B A;  5KJV A;  1EAF A;  5KJU A;  1DPC A;  5T3E A;  1PD5 A;  2IHW A;  2XR7 A;  2ZBA A;  1C4T A;  1XMC A;  2I9D A;  2JGP A;  4JN3 A;  1XL8 A;  1L5A A;  1DPB A;  5DU9 A;  2E1T A;  2E1V A;  4JN5 A; 
#chains in the Genus database with same CATH topology
 1T1U A;  2II4 A;  1QCA A;  1EAD A;  3FOT A;  2RCU A;  3FP0 A;  4KE4 A;  4HVM A;  2VSQ A;  1NOC B;  5FAL A;  2II5 A;  3U9F A;  1Q9J A;  3B2S A;  4N72 A;  1Q23 A;  5KJU A;  2H4T A;  5T3E A;  2ZBA A;  2JGP A;  1XL8 A;  2H3W A;  1L5A A;  1Q6X A;  1T7Q A;  4EYW A;  1NDB A;  1XMD A;  2FY2 A;  2DEB A;  2FYO A;  1S5O A;  2XHG A;  1E2O A;  1NM8 A;  2RKT A;  1EAC A;  2CLA A;  1DPD A;  4CLA A;  4KEC A;  4EPH A;  4G22 A;  2H3U A;  3CLA A;  1T7N A;  2H3P A;  2FY3 A;  1DPC A;  1T7O A;  1PD5 A;  2I9D A;  2FY5 A;  1DPB A;  2E1T A;  1SCZ A;  5KJS A;  4G2M A;  2RKV A;  5KJW A;  1CLA A;  2FW3 A;  1EAB A;  2II3 A;  1NDI A;  4EP9 A;  5KJV A;  4G0B A;  5DU9 A;  2E1V A;  1NDF A;  5DUA A;  5KJT A;  1EAE A;  3B30 A;  5FAN A;  3U9B A;  1EAA A;  1XL7 A;  2E1U A;  2BGH A;  3MAE A;  3L60 A;  1CIA A;  1EAF A;  2XR7 A;  1C4T A;  1XMC A;  4JN3 A;  2FY4 A;  2IHW A;  4JN5 A; 
#chains in the Genus database with same CATH homology
 1SCZ A;  2II4 A;  1QCA A;  5KJS A;  5DUA A;  1EAD A;  4G2M A;  5KJT A;  2RKV A;  1EAE A;  5KJW A;  3FOT A;  3B30 A;  5FAN A;  1CLA A;  3U9B A;  1XMD A;  3FP0 A;  4KE4 A;  4HVM A;  2VSQ A;  1NOC B;  1EAB A;  2XHG A;  1E2O A;  2II5 A;  5FAL A;  2RKT A;  1EAC A;  2II3 A;  1EAA A;  2CLA A;  1XL7 A;  1DPD A;  2E1U A;  1Q9J A;  4KEC A;  3U9F A;  4CLA A;  2BGH A;  3B2S A;  3MAE A;  4G22 A;  4N72 A;  3CLA A;  3L60 A;  1CIA A;  1Q23 A;  4G0B A;  5KJV A;  1EAF A;  5KJU A;  1DPC A;  5T3E A;  1PD5 A;  2IHW A;  2XR7 A;  2ZBA A;  1C4T A;  1XMC A;  2I9D A;  2JGP A;  4JN3 A;  1XL8 A;  1L5A A;  1DPB A;  5DU9 A;  2E1T A;  2E1V A;  4JN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...