1PD5A

Crystal structure of e.coli chloramphenicol acetyltransferase type i at 2.5 angstrom resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
213
structure length
213
Chain Sequence
TGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFLKTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSSLWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANMDNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chloramphenicol acetyltransferase
publication title Crystal structure of E.coli chloramphenicol acetyltransferase type I at 2.5 Angstrom resolution
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 60
structure length 213
sequence length 213
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.3.1.28: Chloramphenicol O-acetyltransferase.
pdb deposition date 2003-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00302 CAT Chloramphenicol acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1pd5A00
1EAEA 1DPDA 5KJTA 2BGHA 2RKTA 4JN3A 3B30A 1CLAA 1XL7A 3FP0A 4KE4A 5KJSA 4G2MA 5KJUA 5DU9A 5FANA 1NOCB 1DPBA 1DPCA 2I9DA 3CLAA 1QCAA 4G22A 2E1UA 1Q23A 2II5A 2RKVA 2XHGA 3U9FA 5DUAA 4G0BA 3B2SA 4JN5A 2XR7A 2VSQA 4KECA 2E1VA 1CIAA 4N72A 1PD5A 1E2OA 2JGPA 1EAAA 5KJWA 1XL8A 2CLAA 1C4TA 5FALA 4HVMA 5KJVA 2II4A 3MAEA 1L5AA 1SCZA 5T3EA 2II3A 1Q9JA 3L60A 1XMDA 3U9BA 1EACA 2ZBAA 1EABA 1EAFA 2E1TA 3FOTA 1EADA 2IHWA 4CLAA 1XMCA
chains in the Genus database with same CATH superfamily
1EAEA 1DPDA 2RKTA 4JN3A 4KE4A 5KJSA 2FYOA 5DU9A 5FANA 1QCAA 2E1UA 1Q23A 1NDBA 1S5OA 2XHGA 3U9FA 4KECA 4N72A 2JGPA 1T7QA 5KJWA 1C4TA 5KJVA 2II4A 1L5AA 1SCZA 5T3EA 2II3A 3L60A 2FY4A 1EAFA 2E1TA 4EYWA 1XMCA 1Q6XA 1NM8A 3B30A 3FP0A 1NOCB 4EP9A 2FY3A 2XR7A 1CIAA 1E2OA 2DEBA 1EAAA 2H3UA 1XL8A 5FALA 4HVMA 3MAEA 1T1UA 2H4TA 1T7NA 3U9BA 2H3WA 1EABA 3FOTA 1EADA 5KJTA 2FY2A 5KJUA 1DPCA 3CLAA 2II5A 2RKVA 5DUAA 4JN5A 2VSQA 1NDFA 2FW3A 1Q9JA 1NDIA 1XMDA 2ZBAA 2H3PA 4CLAA 1CLAA 1XL7A 4G2MA 4EPHA 1DPBA 2FY5A 2I9DA 4G22A 2RCUA 4G0BA 3B2SA 2E1VA 1PD5A 2CLAA 1EACA 1T7OA 2IHWA 2BGHA
chains in the Genus database with same CATH topology
1EAEA 1DPDA 5KJTA 2BGHA 2RKTA 4JN3A 3B30A 1CLAA 1XL7A 3FP0A 4KE4A 5KJSA 4G2MA 5KJUA 5DU9A 5FANA 1NOCB 1DPBA 1DPCA 2I9DA 3CLAA 1QCAA 4G22A 2E1UA 1Q23A 2II5A 2RKVA 2XHGA 3U9FA 5DUAA 4G0BA 3B2SA 4JN5A 2XR7A 2VSQA 4KECA 2E1VA 1CIAA 4N72A 1PD5A 1E2OA 2JGPA 1EAAA 5KJWA 1XL8A 2CLAA 1C4TA 5FALA 4HVMA 5KJVA 2II4A 3MAEA 1L5AA 1SCZA 5T3EA 2II3A 1Q9JA 3L60A 1XMDA 3U9BA 1EACA 2ZBAA 1EABA 1EAFA 2E1TA 3FOTA 1EADA 2IHWA 4CLAA 1XMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EAE A;  1DPD A;  5KJT A;  2BGH A;  2RKT A;  4JN3 A;  3B30 A;  1CLA A;  1XL7 A;  3FP0 A;  4KE4 A;  5KJS A;  4G2M A;  5KJU A;  5DU9 A;  5FAN A;  1NOC B;  1DPB A;  1DPC A;  2I9D A;  3CLA A;  1QCA A;  4G22 A;  2E1U A;  1Q23 A;  2II5 A;  2RKV A;  2XHG A;  3U9F A;  5DUA A;  4G0B A;  3B2S A;  4JN5 A;  2XR7 A;  2VSQ A;  4KEC A;  2E1V A;  1CIA A;  4N72 A;  1PD5 A;  1E2O A;  2JGP A;  1EAA A;  5KJW A;  1XL8 A;  2CLA A;  1C4T A;  5FAL A;  4HVM A;  5KJV A;  2II4 A;  3MAE A;  1L5A A;  1SCZ A;  5T3E A;  2II3 A;  1Q9J A;  3L60 A;  1XMD A;  3U9B A;  1EAC A;  2ZBA A;  1EAB A;  1EAF A;  2E1T A;  3FOT A;  1EAD A;  2IHW A;  4CLA A;  1XMC A; 
#chains in the Genus database with same CATH topology
 1EAE A;  1DPD A;  2RKT A;  4JN3 A;  4KE4 A;  5KJS A;  2FYO A;  5DU9 A;  5FAN A;  1QCA A;  2E1U A;  1Q23 A;  1NDB A;  1S5O A;  2XHG A;  3U9F A;  4KEC A;  4N72 A;  2JGP A;  1T7Q A;  5KJW A;  1C4T A;  5KJV A;  2II4 A;  1L5A A;  1SCZ A;  5T3E A;  2II3 A;  3L60 A;  2FY4 A;  1EAF A;  2E1T A;  4EYW A;  1XMC A;  1Q6X A;  1NM8 A;  3B30 A;  3FP0 A;  1NOC B;  4EP9 A;  2FY3 A;  2XR7 A;  1CIA A;  1E2O A;  2DEB A;  1EAA A;  2H3U A;  1XL8 A;  5FAL A;  4HVM A;  3MAE A;  1T1U A;  2H4T A;  1T7N A;  3U9B A;  2H3W A;  1EAB A;  3FOT A;  1EAD A;  5KJT A;  2FY2 A;  5KJU A;  1DPC A;  3CLA A;  2II5 A;  2RKV A;  5DUA A;  4JN5 A;  2VSQ A;  1NDF A;  2FW3 A;  1Q9J A;  1NDI A;  1XMD A;  2ZBA A;  2H3P A;  4CLA A;  1CLA A;  1XL7 A;  4G2M A;  4EPH A;  1DPB A;  2FY5 A;  2I9D A;  4G22 A;  2RCU A;  4G0B A;  3B2S A;  2E1V A;  1PD5 A;  2CLA A;  1EAC A;  1T7O A;  2IHW A;  2BGH A; 
#chains in the Genus database with same CATH homology
 1EAE A;  1DPD A;  5KJT A;  2BGH A;  2RKT A;  4JN3 A;  3B30 A;  1CLA A;  1XL7 A;  3FP0 A;  4KE4 A;  5KJS A;  4G2M A;  5KJU A;  5DU9 A;  5FAN A;  1NOC B;  1DPB A;  1DPC A;  2I9D A;  3CLA A;  1QCA A;  4G22 A;  2E1U A;  1Q23 A;  2II5 A;  2RKV A;  2XHG A;  3U9F A;  5DUA A;  4G0B A;  3B2S A;  4JN5 A;  2XR7 A;  2VSQ A;  4KEC A;  2E1V A;  1CIA A;  4N72 A;  1PD5 A;  1E2O A;  2JGP A;  1EAA A;  5KJW A;  1XL8 A;  2CLA A;  1C4T A;  5FAL A;  4HVM A;  5KJV A;  2II4 A;  3MAE A;  1L5A A;  1SCZ A;  5T3E A;  2II3 A;  1Q9J A;  3L60 A;  1XMD A;  3U9B A;  1EAC A;  2ZBA A;  1EAB A;  1EAF A;  2E1T A;  3FOT A;  1EAD A;  2IHW A;  4CLA A;  1XMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...